Proton myo-inositol cotransporter-like

Overview
NameProton myo-inositol cotransporter-like
Smed IDSMED30019056
Length (bp)2612
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proton myo-inositol cotransporter-like (SMED30019056) t-SNE clustered cells

Violin plots show distribution of expression levels for Proton myo-inositol cotransporter-like (SMED30019056) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proton myo-inositol cotransporter-like (SMED30019056) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proton myo-inositol cotransporter-like (SMED30019056) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019056

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019056SMESG000056331.1 SMESG000056325.1 Contig482newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019056SMESG000056331.1 SMESG000056325.1 Contig482uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019056SMESG000006139.1 Contig482newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019056SMESG000006139.1 Contig482uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30019056SMESG000056326.1 SMESG000056325.1 SmedASXL_017015SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30019056SMESG000056326.1 SMESG000056325.1 dd_Smed_v4_4836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019056SMESG000056326.1 SMESG000056325.1 dd_Smed_v4_4836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Human
Match: SLC2A13 (solute carrier family 2 member 13 [Source:HGNC Symbol;Acc:HGNC:15956])

HSP 1 Score: 104.76 bits (260), Expect = 1.964e-22
Identity = 62/222 (27.93%), Postives = 110/222 (49.55%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYL-----KRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            AVPA+    G L +PES RWL+ K +  +A  ++ +++        + ++   ++     E+ +++      ++CR+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R          QN  C  +  C++        C +D + G+
Sbjct:  246 AVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRG------NQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNE--------CMLDPDCGF 453          

HSP 2 Score: 93.9745 bits (232), Expect = 4.940e-19
Identity = 49/119 (41.18%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            Y FC P+  +  W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+ N + +L F +      +Y  F++Y  F   G+  IY   PET    LE++  +   R+
Sbjct:  498 YNFC-PTPYS--WTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRL 613          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Human
Match: SLC2A12 (solute carrier family 2 member 12 [Source:HGNC Symbol;Acc:HGNC:18067])

HSP 1 Score: 65.855 bits (159), Expect = 2.181e-10
Identity = 36/111 (32.43%), Postives = 61/111 (54.95%), Query Frame = 2
Query: 2267 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETN-----QIDLE--KMNYV 2578
            + W+ L  +++YV +F+IG+GP+PW+V SEI+P   R   MAL++   W  N + +L F  +        + +IY   ++  +  +  + PET      QI +E  K+NYV
Sbjct:  460 LKWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSLEQISMELAKVNYV 570          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Human
Match: SLC2A8 (solute carrier family 2 member 8 [Source:HGNC Symbol;Acc:HGNC:13812])

HSP 1 Score: 58.151 bits (139), Expect = 9.278e-9
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 2
Query: 2255 STININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +++ + W+ +  M L++  FA+G GPIPW++ SEI+P   +     +     WL  F+    F+++      Y  FW+  AF I  +       PET    LE++ 
Sbjct:  103 ASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQIT 208          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Human
Match: SLC2A13 (solute carrier family 2 member 13 [Source:HGNC Symbol;Acc:HGNC:15956])

HSP 1 Score: 58.9214 bits (141), Expect = 1.685e-8
Identity = 32/107 (29.91%), Postives = 58/107 (54.21%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMY 1872
            AVPA+    G L +PES RWL+ K +  +A  ++ +++        + ++   ++     E+ +++      ++CR+L     R+ L++GC LQM  QL GIN +MY
Sbjct:  246 AVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRG------NQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMY 346          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Human
Match: SLC2A8 (solute carrier family 2 member 8 [Source:HGNC Symbol;Acc:HGNC:13812])

HSP 1 Score: 58.5362 bits (140), Expect = 2.047e-8
Identity = 30/106 (28.30%), Postives = 52/106 (49.06%), Query Frame = 2
Query: 2255 STININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +++ + W+ +  M L++  FA+G GPIPW++ SEI+P   +     +     WL  F+    F+++      Y  FW+  AF I  +       PET    LE++ 
Sbjct:  203 ASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQIT 308          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Celegans
Match: hmit-1.3 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q21455])

HSP 1 Score: 93.2041 bits (230), Expect = 2.725e-19
Identity = 64/223 (28.70%), Postives = 111/223 (49.78%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVE---NILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKR-NQNNICDNFLACDDWVS-----YHCEYCQIDENSGY 2193
            AVPA+   +  L +PES RWL    R  EA EV+ ++        TE+V+   N +  +   E   + +       + RIL     RK +++G  LQM  QL GIN +MYY  ++ +     +    +W +   + IN + +F+   L++++GRR L L+S+ G+I  L+ + V+  L++   L+  +Q N   N+       +      +C++C  DEN G+
Sbjct:  198 AVPAIIQFVCFLFLPESPRWLYEHGRTVEAREVLTRIYN----GHTEWVDYEINEISFSYEEELRAKAEHAGNGPTIIRILKTPHVRKAMIIGSLLQMFQQLSGINTVMYYTGNIIRSAGVKDNHTTIWISVGTSAINFLGTFIPIALVERVGRRVLLLVSMIGVILFLIAMGVSFLLINNDSLRTFDQQNYTLNYNPSVKHAAKCLKYSNCDFCVTDENCGF 416          

HSP 2 Score: 73.559 bits (179), Expect = 3.733e-13
Identity = 33/105 (31.43%), Postives = 61/105 (58.10%), Query Frame = 2
Query: 2291 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RIFKLK 2605
            M+ Y++SF+ G  P+PWV+ +E YP W RST +++ST   W+ N I +L F ++  +   Y  F+IYC  T+  +  ++ + PET    ++++  +   +  + K
Sbjct:  475 MVFYLLSFSAGYAPLPWVLNAEFYPLWARSTAVSVSTACNWIFNLIVSLTFLSLSQAATKYGTFFIYCGCTMVALVFVFFFVPETKGYSIDEVEMLFMTKEERRK 579          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Celegans
Match: hmit-1.3 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q21455])

HSP 1 Score: 93.2041 bits (230), Expect = 2.725e-19
Identity = 64/223 (28.70%), Postives = 111/223 (49.78%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVE---NILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKR-NQNNICDNFLACDDWVS-----YHCEYCQIDENSGY 2193
            AVPA+   +  L +PES RWL    R  EA EV+ ++        TE+V+   N +  +   E   + +       + RIL     RK +++G  LQM  QL GIN +MYY  ++ +     +    +W +   + IN + +F+   L++++GRR L L+S+ G+I  L+ + V+  L++   L+  +Q N   N+       +      +C++C  DEN G+
Sbjct:  198 AVPAIIQFVCFLFLPESPRWLYEHGRTVEAREVLTRIYN----GHTEWVDYEINEISFSYEEELRAKAEHAGNGPTIIRILKTPHVRKAMIIGSLLQMFQQLSGINTVMYYTGNIIRSAGVKDNHTTIWISVGTSAINFLGTFIPIALVERVGRRVLLLVSMIGVILFLIAMGVSFLLINNDSLRTFDQQNYTLNYNPSVKHAAKCLKYSNCDFCVTDENCGF 416          

HSP 2 Score: 73.559 bits (179), Expect = 3.733e-13
Identity = 33/105 (31.43%), Postives = 61/105 (58.10%), Query Frame = 2
Query: 2291 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RIFKLK 2605
            M+ Y++SF+ G  P+PWV+ +E YP W RST +++ST   W+ N I +L F ++  +   Y  F+IYC  T+  +  ++ + PET    ++++  +   +  + K
Sbjct:  475 MVFYLLSFSAGYAPLPWVLNAEFYPLWARSTAVSVSTACNWIFNLIVSLTFLSLSQAATKYGTFFIYCGCTMVALVFVFFFVPETKGYSIDEVEMLFMTKEERRK 579          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Celegans
Match: hmit-1.2 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXQ9])

HSP 1 Score: 83.9593 bits (206), Expect = 1.844e-16
Identity = 65/236 (27.54%), Postives = 104/236 (44.07%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENIL---EANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD---------------VRYLKRNQNNICDNFLACDDWV-SYHCEYCQIDENSGYTCV 2202
             +PAL   +  + +PE+ RWL      ++A +V+ K+        TE++E  L   +      +   E++++   ++ RIL      K   +G  LQ   QL GIN ++YY   + +     N    +W + +L+  NLI  F     I+K+GRRKL L S  G++ SLV+I V+  LV                  Y    +   C     CD  V S HC +C+  E     C+
Sbjct:  196 GIPALIQFVCFIFLPETPRWLYENGHTEQAEQVLEKIY----GGNTEWIEYELAEIKTYAEERQKQMEEEKKSGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYTADIIRSAGIENYHTIIWISVILSICNLIGPFAPMFFIEKLGRRKLFLFSCAGVVVSLVLIGVSFLLVGNDSAPNFDRSAYLLAGNYQSNGEAESCLMLSNCDSCVTSEHCGFCEDSETRTGFCL 427          

HSP 2 Score: 57.3806 bits (137), Expect = 3.852e-8
Identity = 33/94 (35.11%), Postives = 54/94 (57.45%), Query Frame = 2
Query: 2291 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            M +Y+++F+ G   +PWV+ SE YP W RST +++ST + W+ N I  L + ++  +   Y  FW+Y  FTI     IY   PET    ++++ 
Sbjct:  479 MGVYLLTFSCGFTSLPWVLNSEFYPMWARSTCVSISTLSNWVFNLIIALTYLSLTHAITKYGAFWLYAIFTIIAFIFIYFLVPETTGYSIDEVE 572          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Celegans
Match: hmit-1.1 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXR3])

HSP 1 Score: 77.7962 bits (190), Expect = 1.885e-14
Identity = 65/227 (28.63%), Postives = 104/227 (45.81%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKL----KQIPESNITE---FVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD---VRYLKRNQ--NNICDNFLACDDWVSY-HCEYCQIDENSGY 2193
            AVP++   +  + +PE+ RWL       E  EV+ K+    K+  E  + E   F E+  + N        E+      ++ RIL      K   +G  LQ   QL GIN ++YY   + +    +N    +W + LL+  N I  FV   LI+K+GRR + L S   ++ SLV I V   LV+      L  NQ  +N   ++      ++Y +C+YC   +  G+
Sbjct:  195 AVPSIIQFVCFMFLPETPRWLYENGFETETREVLEKVYNGDKEWVEYEMAEIIAFNEDQAKEN--------EKAHASGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYTADIIRSSGISNNHTTIWISVLLSLCNFIGPFVPMSLIEKVGRRIIFLFSCGLVVLSLVFIGVAFLLVNHDSAATLPANQYGSNFNSSYPDAKGCMAYSNCDYCVTTDACGF 413          

HSP 2 Score: 62.3882 bits (150), Expect = 9.593e-10
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 2297 LYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +Y+++F+ G   +PWV+ SE YP W RST +A+ST + W+ N I  L + ++      Y  FW+Y   T+     I    PET    +E++ 
Sbjct:  473 VYLLTFSSGFTSLPWVLNSEFYPMWARSTCVAISTTSNWVFNLIIALTYLSLTQVIGKYGAFWLYAGLTVIAFIFILFLVPETKGYSIEEVE 564          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Fly
Match: Tret1-1 (gene:FBgn0050035 transcript:FBtr0088074)

HSP 1 Score: 76.2554 bits (186), Expect = 5.213e-14
Identity = 34/126 (26.98%), Postives = 63/126 (50.00%), Query Frame = 2
Query: 2228 CSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RIFKLK 2605
            C  Y    P   ++ W+ L   ++Y++ F++G GPIPW++  EI PA  R +  +++T   W C F+    F ++  +   +  FW++ A    G+  +  Y PET    LE +   +  R+ ++ 
Sbjct:  355 CKTY---GPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGSAASVATAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGLFFVIIYVPETQGKTLEDIERKMMGRVRRMS 477          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Fly
Match: CG6484 (gene:FBgn0034247 transcript:FBtr0086903)

HSP 1 Score: 52.373 bits (124), Expect = 1.168e-13
Identity = 60/212 (28.30%), Postives = 105/212 (49.53%), Query Frame = 1
Query: 1504 YKYALFRTMPIILIT---PAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRY-LKRNQNNICDNF 2127
            Y Y +   +P++ I      +P +F +I    +PES  +L  K R D+A + ++ L+   +++I + ++ ILE +       Q+Q +  +  +   L   I  K L +   LQ+  Q  GIN +++Y+ S+F+   ++        T ++    + S+ VA  +IDK GRR L LI       S V++AV+  L+ V + LK N     DNF
Sbjct:  154 YGYLVGAFLPLLTINILCAILPVIFAIIHFF-MPESPVYLAMKGRNDDAAKALQWLRG-KDADIDDELKEILEES-------QKQIDMPQVNILSSLRRPIVLKGLGIAVLLQVFQQWTGINAVLFYSASIFEDTGSDISGSDA--TLIIGVTQVTSTLVAVAIIDKAGRRILLLI-------SGVLMAVSTALMGVYFQLKENDPASMDNF 347          

HSP 2 Score: 44.669 bits (104), Expect = 1.168e-13
Identity = 31/103 (30.10%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 2249 NPSTI-NINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYF--PETN 2548
            +P+++ N  W+ +  + +++I F+IG GP+PW+V +E++    +S   +++  + WL  F+  L+F  +  S      FWI+ A  +  IA  Y  F  PET 
Sbjct:  340 DPASMDNFGWLPISSICIFIIFFSIGFGPVPWLVMAELFSEDVKSVAGSIAGTSNWLSAFVVTLLFPILKSSIGPGPTFWIFTAIAV--IAFFYSLFFVPETK 440          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Fly
Match: Tret1-1 (gene:FBgn0050035 transcript:FBtr0088073)

HSP 1 Score: 75.485 bits (184), Expect = 1.371e-13
Identity = 34/125 (27.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query: 2228 CSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RIFKL 2602
            C  Y    P   ++ W+ L   ++Y++ F++G GPIPW++  EI PA  R +  +++T   W C F+    F ++  +   +  FW++ A    G+  +  Y PET    LE +   +  R+ ++
Sbjct:  723 CKTY---GPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGSAASVATAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGLFFVIIYVPETQGKTLEDIERKMMGRVRRM 844          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Fly
Match: Tret1-2 (gene:FBgn0033644 transcript:FBtr0088075)

HSP 1 Score: 73.1738 bits (178), Expect = 4.754e-13
Identity = 32/115 (27.83%), Postives = 59/115 (51.30%), Query Frame = 2
Query: 2249 NPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
             P   ++ W+ L   ++Y++ F++G GPIPW++  EI PA  R    ++ T   W C F+    F ++  +   +  FW++ A  I G+  +  + PET    LE++   +  R+
Sbjct:  359 GPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIERKMMGRV 473          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Fly
Match: sut3 (gene:FBgn0028561 transcript:FBtr0332247)

HSP 1 Score: 62.003 bits (149), Expect = 1.358e-9
Identity = 33/97 (34.02%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 2297 LYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFT--NIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
            LY+I+F +G+GP P+ + SEI+    R + MAL +   WL NF+ N+IF   N       + +  ++CA+   G  L Y+Y PET   D + +  ++
Sbjct:  337 LYIITFNMGLGPTPYFIGSEIFETASRPSAMALGSFFNWLANFVLNMIFPTLNSATGPFVFLLCVVFCAY---GFLLTYRYLPETRNRDAKDVAQLM 430          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Zebrafish
Match: slc2a13b (solute carrier family 2 member 13b [Source:ZFIN;Acc:ZDB-GENE-090812-1])

HSP 1 Score: 107.071 bits (266), Expect = 1.886e-23
Identity = 68/229 (29.69%), Postives = 112/229 (48.91%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRN---QNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 2217
            VPA    +G L +PES RWLL K     A+ V+R+++   + ++ E  E+I           +++      +L R+L    AR+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W      F N + + V   L++++GRR+L + SL G   SL+++A    L       V +   N    N+ C N+          CE C +D + G+    YG N
Sbjct:  201 VPAALQFLGFLFLPESPRWLLQKGFTQNALLVLRQIRG--DVDVEEEFESIR-----CSIQEEQRDVAGGPVLWRMLASPPARRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVQDDQMAIWLAAGTAFTNFLFTLVGVWLVERVGRRRLTMASLLGTAVSLMVLAAGFLLSAQASPPVTFHPSNPSIHNSTCGNY--------GFCESCMLDPDCGFC---YGLN 411          

HSP 2 Score: 96.6709 bits (239), Expect = 3.706e-20
Identity = 44/108 (40.74%), Postives = 65/108 (60.19%), Query Frame = 2
Query: 2270 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            +W++LLG+ILY+  FA GMGP+PW V SEIYP W RST  A S G  W+CN + +L F ++     +Y  F++Y A  + G   +    PET  + LE++  +   R+
Sbjct:  458 SWVVLLGLILYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAQYLTYYGAFFLYAALALLGFVFVSGCLPETKGLRLEEIESLFSRRL 565          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Zebrafish
Match: SLC2A13 (proton myo-inositol cotransporter-like [Source:NCBI gene;Acc:101882338])

HSP 1 Score: 84.7297 bits (208), Expect = 3.445e-17
Identity = 44/140 (31.43%), Postives = 76/140 (54.29%), Query Frame = 1
Query: 1777 RILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSY-HCEYCQIDENSGY 2193
            R+L    AR+ L++GC LQM  QL GIN +MYY+ ++ Q     + K+ +W   +  F N + + +   L++++GRRKL L S+FG + SL +++V   L+  ++      ++ D         ++  CE C +D   GY
Sbjct:    2 RMLTFPPARRALIVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDKLAIWLVTVTAFTNFLFTLLGVWLVERVGRRKLTLGSIFGTVLSLCVLSVGF-LLSAQHSPPVTLHLSDPTTPNSSCAAHLSCEPCMLDPGCGY 140          

HSP 2 Score: 78.9518 bits (193), Expect = 3.477e-15
Identity = 48/119 (40.34%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            Y FC  S    +W++LLG++LY+ SFA GMGP+PW V SEIYP W RST  A S G  W  N + +L F ++     +Y +F++Y +    G   IY   PET    LE++  +   R+
Sbjct:  184 YNFCPTS---YSWVVLLGLVLYLASFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWTFNVLVSLTFLHMAQYLTYYGVFFLYTSLAFTGFFFIYGCLPETKGRRLEEIESLFENRL 299          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 56.9954 bits (136), Expect = 3.198e-16
Identity = 49/183 (26.78%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 1597 ESYRWLL-SKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK----RNQNNICDN 2124
            ES R+LL S N+ DEA + +  L+     E +I E  +  ++ ++           +K+  +  +  +   R+ +++   LQ+  QL GIN +MYY+  +F+      I   ++ T  +  +N + + V+  L+++ GRR L LI L G+ F ++++ ++L+LVD    K    +N   I D+
Sbjct:  213 ESPRYLLISLNKEDEARQALTSLRGHSDVEDDIREMKDEAMKMSM-----------EKRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYSTEIFRNA---GITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKLVDSEIEKAKLLQNGTAIIDS 381          

HSP 2 Score: 48.521 bits (114), Expect = 3.198e-16
Identity = 34/120 (28.33%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 2216 TNGTCSIYEFCNPST--ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 2569
             NGT +I +  +PS     +  + +L +  +V SF +G GPIPW + +E++    R   MA++    W  +F+  L+F  I   +I   +F I+    +  I   Y   PET     E +
Sbjct:  373 QNGT-AIIDSASPSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGLLFP-ILSKKIGAYVFIIFLILLVVFIVFTYFRVPETKGRTFEDI 490          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 56.9954 bits (136), Expect = 3.198e-16
Identity = 49/183 (26.78%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 1597 ESYRWLL-SKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK----RNQNNICDN 2124
            ES R+LL S N+ DEA + +  L+     E +I E  +  ++ ++           +K+  +  +  +   R+ +++   LQ+  QL GIN +MYY+  +F+      I   ++ T  +  +N + + V+  L+++ GRR L LI L G+ F ++++ ++L+LVD    K    +N   I D+
Sbjct:  213 ESPRYLLISLNKEDEARQALTSLRGHSDVEDDIREMKDEAMKMSM-----------EKRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYSTEIFRNA---GITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKLVDSEIEKAKLLQNGTAIIDS 381          

HSP 2 Score: 48.521 bits (114), Expect = 3.198e-16
Identity = 34/120 (28.33%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 2216 TNGTCSIYEFCNPST--ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 2569
             NGT +I +  +PS     +  + +L +  +V SF +G GPIPW + +E++    R   MA++    W  +F+  L+F  I   +I   +F I+    +  I   Y   PET     E +
Sbjct:  373 QNGT-AIIDSASPSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGLLFP-ILSKKIGAYVFIIFLILLVVFIVFTYFRVPETKGRTFEDI 490          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 54.299 bits (129), Expect = 2.114e-15
Identity = 48/179 (26.82%), Postives = 93/179 (51.96%), Query Frame = 1
Query: 1597 ESYRWLL-SKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDN 2124
            ES R+LL S N+ DEA + +  L+     E +I E  +  ++ ++           +K+  +  +  +   R+ +++   LQ+  QL GIN +MYY+  +F+      I   ++ T  +  +N + + V+  L+++ GRR L LI L G+ F ++++ ++L+L  V  L +N   I D+
Sbjct:  217 ESPRYLLISLNKEDEARQALTSLRGHSDVEDDIREMKDEAMKMSM-----------EKRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYSTEIFRN---AGITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKL--VAKLLQNGTAIIDS 379          

HSP 2 Score: 48.9062 bits (115), Expect = 2.114e-15
Identity = 34/120 (28.33%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 2216 TNGTCSIYEFCNPST--ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKM 2569
             NGT +I +  +PS     +  + +L +  +V SF +G GPIPW + +E++    R   MA++    W  +F+  L+F  I   +I   +F I+    +  I   Y   PET     E +
Sbjct:  371 QNGT-AIIDSASPSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGLLFP-ILSKKIGAYVFIIFLILLVVFIVFTYFRVPETKGRTFEDI 488          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Xenopus
Match: phf21b (PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE-969993])

HSP 1 Score: 95.9005 bits (237), Expect = 2.740e-41
Identity = 48/118 (40.68%), Postives = 66/118 (55.93%), Query Frame = 2
Query: 2213 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEK 2566
            +  G+   Y +C  S    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+CN + +L F +      +Y  F++Y      G+  IY   PET    LE+
Sbjct:  488 KAGGSIWAYNYCPTS---YSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLACVGLIFIYGCLPETKGKKLEE 602          

HSP 2 Score: 94.7449 bits (234), Expect = 2.740e-41
Identity = 62/222 (27.93%), Postives = 111/222 (50.00%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRN---QNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            AVPA+   +G L +PES RWL+ K +  +A  V+ +++      I E  ++I  +     ++ +++      I+ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q    ++ ++ +W   +  F N   + +   L++K+GRRKL L SL G   +L ++A+   L       V +   +    N+ C  +         +C  C +D N G+
Sbjct:  244 AVPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRG--NQTIDEEYDSIKNS----IDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQY--------SYCNKCMLDPNCGF 451          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Xenopus
Match: phf21b (PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE-969993])

HSP 1 Score: 94.7449 bits (234), Expect = 3.499e-37
Identity = 62/222 (27.93%), Postives = 111/222 (50.00%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRN---QNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            AVPA+   +G L +PES RWL+ K +  +A  V+ +++      I E  ++I  +     ++ +++      I+ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q    ++ ++ +W   +  F N   + +   L++K+GRRKL L SL G   +L ++A+   L       V +   +    N+ C  +         +C  C +D N G+
Sbjct:  244 AVPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRG--NQTIDEEYDSIKNS----IDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQY--------SYCNKCMLDPNCGF 451          

HSP 2 Score: 82.4185 bits (202), Expect = 3.499e-37
Identity = 45/130 (34.62%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 2213 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFT---ICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            +  G+   Y +C  S    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+CN + +L F +      +Y  F++Y        CG +            D ++  Y+ + R+
Sbjct:  488 KAGGSIWAYNYCPTS---YSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLARLCTCGAS------------DSDEGRYIEYIRV 602          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 72.4034 bits (176), Expect = 2.043e-12
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 2267 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A      W  N +  L F ++  S      F +Y    +  IA IY + PET    LE+++
Sbjct:  427 LNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEID 528          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 72.0182 bits (175), Expect = 2.163e-12
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 2267 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A      W  N +  L F ++  S      F +Y    +  IA IY + PET    LE+++
Sbjct:  417 LNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEID 518          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 72.0182 bits (175), Expect = 2.178e-12
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 2267 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A      W  N +  L F ++  S      F +Y    +  IA IY + PET    LE+++
Sbjct:  417 LNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEID 518          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Mouse
Match: Slc2a13 (solute carrier family 2 (facilitated glucose transporter), member 13 [Source:MGI Symbol;Acc:MGI:2146030])

HSP 1 Score: 107.457 bits (267), Expect = 6.440e-44
Identity = 67/222 (30.18%), Postives = 112/222 (50.45%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            A+PA+   +G L +PES RWL+ K +  +A  ++ +++      I E  ++I  +    E++          I+CR+L     R+ LV+GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R   R     +QN  C  +  C++        C +D + G+
Sbjct:  235 AIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG--NQTIDEEYDSIRNSIEEEEKEATAAGP----IICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFLLSAQVSPRVTFRPTTPSDQNTTCTGYSYCNE--------CMLDPDCGF 442          

HSP 2 Score: 91.6633 bits (226), Expect = 6.440e-44
Identity = 47/127 (37.01%), Postives = 69/127 (54.33%), Query Frame = 2
Query: 2213 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            +  G    Y FC P+  +  W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F +      +Y  F++Y  F   G+  +Y   PET    LE++  +   R+
Sbjct:  479 KAEGAHWAYSFC-PTPYS--WTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIESLFDHRL 602          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Mouse
Match: Slc2a12 (solute carrier family 2 (facilitated glucose transporter), member 12 [Source:MGI Symbol;Acc:MGI:3052471])

HSP 1 Score: 68.1662 bits (165), Expect = 2.963e-11
Identity = 35/110 (31.82%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 2270 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETN-------QIDLEKMNYV 2578
             W+ L  +++YV +F+IG+GP+PW+V SEI+P   R   MAL++   W  N + +L F  +        + +IY   ++  +A +  + PET         ++L K NYV
Sbjct:  466 KWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGVNLLISLTFLTVTDLIGLSWVCFIYTIMSLASLAFVVLFIPETKGCSLEQISVELAKANYV 575          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Mouse
Match: Slc2a2 (solute carrier family 2 (facilitated glucose transporter), member 2 [Source:MGI Symbol;Acc:MGI:1095438])

HSP 1 Score: 62.7734 bits (151), Expect = 1.282e-9
Identity = 56/188 (29.79%), Postives = 96/188 (51.06%), Query Frame = 1
Query: 1534 IILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPES-----NITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 2082
            I+L   AVPAL   + +L  PES R+L  K  ++E +   + LK++  +     +I E  +   EA+            ++K  + ++  D   R+ +++   L M  Q  GING+ YY+ S+FQ   T  I   ++ T  +  IN+I + V+  L++K GRR L L  + G+ F  + ++V L L+D
Sbjct:  219 ILLGLSAVPALLQCLLLLFCPESPRYLYIK--LEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEEAST-----------EQKVSVIQLFTDANYRQPILVALMLHMAQQFSGINGIFYYSTSIFQ---TAGISQPVYATIGVGAINMIFTAVSVLLVEKAGRRTLFLTGMIGMFFCTIFMSVGLVLLD 390          

HSP 2 Score: 51.9878 bits (123), Expect = 3.020e-6
Identity = 31/106 (29.25%), Postives = 51/106 (48.11%), Query Frame = 2
Query: 2267 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYF-----PETNQIDLEKM 2569
            ++++ +  + L+V  F IG GPIPW + +E +    R T +AL+  + W+CNF+  L F  I            Y  F   G+ L++  F     PET     E++
Sbjct:  395 MSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPTALALAAFSNWVCNFVIALCFQYI------ADFLGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEI 494          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Mouse
Match: Slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:MGI Symbol;Acc:MGI:2156687])

HSP 1 Score: 60.4622 bits (145), Expect = 6.200e-9
Identity = 33/100 (33.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 2273 WILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            W  L+ M++YV +F++G GP+ W+V SEIYPA  R    A  +   W  N   +L F ++  +      F +Y    + G+A IY   PET    L ++ 
Sbjct:  406 WSALVCMMVYVSAFSVGFGPVTWLVLSEIYPAEIRGRAFAFCSSFNWAANLFISLSFLDLIGAIGLAWTFLLYGLTAVLGLAFIYLLVPETKGQSLAEIE 505          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Mouse
Match: Slc2a8 (solute carrier family 2, (facilitated glucose transporter), member 8 [Source:MGI Symbol;Acc:MGI:1860103])

HSP 1 Score: 56.9954 bits (136), Expect = 6.710e-8
Identity = 28/104 (26.92%), Postives = 48/104 (46.15%), Query Frame = 2
Query: 2261 ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            + + W+ +  M L++  FA+G GPIPW++ SEI+P   +     +     W   F+    F+++      Y  FW+  AF    +       PET    LE++ 
Sbjct:  368 VGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWFMAFLVTKEFSSVMEMLRPYGAFWLTAAFCALSVLFTLTVVPETKGRTLEQVT 471          
BLAST of Proton myo-inositol cotransporter-like vs. UniProt/SwissProt
Match: sp|Q3UHK1|MYCT_MOUSE (Proton myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc2a13 PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 3.922e-43
Identity = 67/222 (30.18%), Postives = 112/222 (50.45%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            A+PA+   +G L +PES RWL+ K +  +A  ++ +++      I E  ++I  +    E++          I+CR+L     R+ LV+GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R   R     +QN  C  +  C++        C +D + G+
Sbjct:  235 AIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG--NQTIDEEYDSIRNSIEEEEKEATAAGP----IICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFLLSAQVSPRVTFRPTTPSDQNTTCTGYSYCNE--------CMLDPDCGF 442          

HSP 2 Score: 91.6633 bits (226), Expect = 3.922e-43
Identity = 47/127 (37.01%), Postives = 69/127 (54.33%), Query Frame = 2
Query: 2213 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            +  G    Y FC P+  +  W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F +      +Y  F++Y  F   G+  +Y   PET    LE++  +   R+
Sbjct:  479 KAEGAHWAYSFC-PTPYS--WTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIESLFDHRL 602          
BLAST of Proton myo-inositol cotransporter-like vs. UniProt/SwissProt
Match: sp|Q9ZQP6|INT3_ARATH (Probable inositol transporter 3 OS=Arabidopsis thaliana OX=3702 GN=INT3 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.944e-26
Identity = 65/243 (26.75%), Postives = 111/243 (45.68%), Query Frame = 1
Query: 1537 ILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDK--------IARKTLVMGCSLQMLAQLIGINGLMYYANSL--FQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAV-------NLQLVDVRYLKRN--QNNICDNFLA------------CDDWVSYHCEYCQ 2172
            +L   A+PA+     MLT+PES RWL   +R  E+ +++ ++          +   ++EA +   ++    +   + I+     DK        + R  L  G ++Q+  Q +GIN +MYY+ ++  F  Y +N   + L    + + +N + S V+   +D+ GRRKL +IS+FGII  LVI+A        +   +D R   RN  +N  C  F              C   + Y C +C 
Sbjct:  188 MLGVSAIPAIIQFCLMLTLPESPRWLYRNDRKAESRDILERI----------YPAEMVEAEIAALKESVRAETADEDIIGHTFSDKLRGALSNPVVRHGLAAGITVQVAQQFVGINTVMYYSPTILQFAGYASNKTAMALAL--ITSGLNAVGSVVSMMFVDRYGRRKLMIISMFGIITCLVILAAVFNEASNHAPKIDKRD-SRNFAKNATCPAFAPFTASRSPPSNWNCMKCLQYDCGFCS 417          

HSP 2 Score: 56.6102 bits (135), Expect = 8.944e-26
Identity = 34/123 (27.64%), Postives = 58/123 (47.15%), Query Frame = 2
Query: 2213 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
             + G     + C PS      I+ LG  LY+I +A GMG +PW+V SEIYP   R     ++  + W+ N + +  F  +  +      F ++   +  G+  I+   PET  +  E++  +L
Sbjct:  440 HSKGRTFFKDGC-PSKFGYLAIVFLG--LYIIVYAPGMGTVPWIVNSEIYPLRYRGLAGGIAAVSNWMSNLVVSETFLTLTNAVGSSGTFLLFAGSSAVGLFFIWLLVPETKGLQFEEVEKLL 559          
BLAST of Proton myo-inositol cotransporter-like vs. UniProt/SwissProt
Match: sp|A9ZSY3|TRET1_BOMMO (Facilitated trehalose transporter Tret1 OS=Bombyx mori OX=7091 GN=Tret1 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.907e-25
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 2270 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
             W+ L  +++YV+ F+IG GPIPW++  EI P+  R T  +L+TG  W C FI    F NI  +   +   W++    I G+  +  + PET    LE++   L
Sbjct:  384 GWLPLACLVIYVLGFSIGFGPIPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQNIIDAIYMHGTLWLFAVICIGGLLFVIFFVPETKGKSLEEIEMKL 487          

HSP 2 Score: 61.6178 bits (148), Expect = 5.907e-25
Identity = 58/214 (27.10%), Postives = 97/214 (45.33%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKL--------KQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQ---KYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHC 2160
            A+P  F L+ +LT PE+ RW +SK R+ EA + +R L        K++ +  I++   +    N                   + L  K     +++   L +  QL GIN +++YA S+FQ     V  N+      + ++  +N IS+F+A  LID++GR+ L  IS      S+ +I   L L    YLK+N  ++         W+   C
Sbjct:  211 AIPVPFFLLMILT-PETPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDLTISQTESDRTGGNAF-----------------KQLFSKRYLPAVMISLGLMLFQQLTGINAVIFYAASIFQMSGSSVDENLA-----SIIIGVVNFISTFIATMLIDRLGRKVLLYIS------SVAMITTLLALGAYFYLKQNHIDVT-----AYGWLPLAC 390          
BLAST of Proton myo-inositol cotransporter-like vs. UniProt/SwissProt
Match: sp|Q96QE2|MYCT_HUMAN (Proton myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC2A13 PE=1 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 9.430e-22
Identity = 62/222 (27.93%), Postives = 110/222 (49.55%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYL-----KRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            AVPA+    G L +PES RWL+ K +  +A  ++ +++        + ++   ++     E+ +++      ++CR+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R          QN  C  +  C++        C +D + G+
Sbjct:  246 AVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRG------NQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNE--------CMLDPDCGF 453          

HSP 2 Score: 93.9745 bits (232), Expect = 2.372e-18
Identity = 49/119 (41.18%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            Y FC P+  +  W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+G  W+ N + +L F +      +Y  F++Y  F   G+  IY   PET    LE++  +   R+
Sbjct:  498 YNFC-PTPYS--WTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRL 613          
BLAST of Proton myo-inositol cotransporter-like vs. UniProt/SwissProt
Match: sp|Q921A2|MYCT_RAT (Proton myo-inositol cotransporter OS=Rattus norvegicus OX=10116 GN=Slc2a13 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 1.224e-21
Identity = 66/222 (29.73%), Postives = 109/222 (49.10%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            A+PA+   +G L +PES RWL+ K +  +A  ++ +++      I E  ++I  +    E++          I+CR+L     R+ L +GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L I+A+   L   V  R   R      QN  C  +  C++        C +D + G+
Sbjct:  235 AIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG--NQTIDEEYDSIRNSIEEEEKEASAAGP----IICRMLSYPPTRRALAVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALTILALGFLLSAQVSPRVTFRPTAPSGQNATCTEYSYCNE--------CMLDPDCGF 442          

HSP 2 Score: 91.2781 bits (225), Expect = 1.469e-17
Identity = 46/119 (38.66%), Postives = 67/119 (56.30%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            Y FC P+  +  W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F +      +Y  F++Y  F   G+  +Y   PET    LE++  +   R+
Sbjct:  487 YSFC-PTPYS--WTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIESLFDHRL 602          
BLAST of Proton myo-inositol cotransporter-like vs. TrEMBL
Match: A0A0H3YJX4 (Slc2a-9 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc2a-9 PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 3.472e-153
Identity = 221/236 (93.64%), Postives = 224/236 (94.92%), Query Frame = 1
Query: 1510 YALFRTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 2217
            Y    T PIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKEQKKFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGII S VIIAVNLQLVDVRYLKRNQNN C NFL+CDD ++  CEYCQIDENSGYTCVNYGAN
Sbjct:  184 YGSDTTTPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKEQKKFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIISSSVIIAVNLQLVDVRYLKRNQNNNCRNFLSCDDCINNICEYCQIDENSGYTCVNYGAN 419          

HSP 2 Score: 166.392 bits (420), Expect = 3.472e-153
Identity = 86/121 (71.07%), Postives = 92/121 (76.03%), Query Frame = 2
Query: 2219 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
             G   IY F N  T NINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALST A WL    CNL  T   F+R  Y  FWIY AFTICGIALIYK FPE NQ ++E++ +VL
Sbjct:  423 KGNYPIYNFDNHCTNNINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTAKWL----CNLTVTMTVFTRRLYETFWIYSAFTICGIALIYKNFPEMNQANMEEILHVL 539          
BLAST of Proton myo-inositol cotransporter-like vs. TrEMBL
Match: R7U3K5 (MFS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_175747 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.904e-45
Identity = 66/223 (29.60%), Postives = 112/223 (50.22%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK----RNQNNI---CDNFLACDDWVSY-HCEYCQIDENSG 2190
             VPA    +  + +PES RWL+ K RI +A EV++K++     +  + E   +  EA+    E              R L     R+ L++GC LQ+  Q+ GIN +MYY+ ++ +     +  + +W + L   +N I +FV   L++++GRR+L L S+ G+  SL ++A+  Q+  +R  +       N+    CD F  CD  VS   C +C +  +SG
Sbjct:  204 GVPAAIQFVAFIFMPESARWLVGKGRISQAGEVLKKIRGTENIDHELEEIRSSYAEAHACTSEAEGSSST-----FVRALKTPHVRRALIVGCGLQLFQQICGINTVMYYSATIIKMSGVKDASLAIWLSSLTAGVNFIFTFVGLYLVERMGRRRLTLFSVVGVTISLAVLAIGFQITAIRSPRVTFDEGMNSTSYDCDRFSTCDGCVSSPDCGFCFLPSSSG 421          

HSP 2 Score: 94.7449 bits (234), Expect = 2.904e-45
Identity = 42/112 (37.50%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            Y++C PS++   W+   G++LY+  FA GMGP+PW + SEIYP W RST  +LST   W+ N + ++ F ++  +   Y  FW+Y   ++ G    +   PET  + LE M 
Sbjct:  460 YDYC-PSSMA--WMSTFGLVLYLAFFAPGMGPMPWTINSEIYPLWARSTGNSLSTATNWIANLVVSMTFLSLLEALTKYGAFWLYSVLSLLGTIFFFALLPETRGLSLEHME 568          
BLAST of Proton myo-inositol cotransporter-like vs. TrEMBL
Match: A0A3Q3DIX2 (Solute carrier family 2 member 13b OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 9.962e-43
Identity = 64/221 (28.96%), Postives = 116/221 (52.49%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNIT-EFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK-------RNQNNICDNFLACDD-WVSYHCEYCQIDENSG 2190
            +P++   +G L +PES RWLL K R +EA +V+ +++   + +   +++   +E         +++      I  RILG    R+ L++GC LQM  QL GIN +MYY+ ++ Q     + +  +W + + +  N + + ++  L+D++GRRKL L SL G   SL +++V   L+  RY          + N+ C  +  C D  ++  C +C  + +SG
Sbjct:   58 LPSILQFVGFLFLPESPRWLLQKGRQEEARQVLSRIRGCQDVDEEFDYIRTSIEEE-------EKELRGGGIIFLRILGHGPTRRALIVGCGLQMFQQLTGINTVMYYSATILQMSGVRDERRAIWLSAVTSGTNFVCTSLSIWLVDRVGRRKLTLASLTGTALSLSVLSVGF-LLAARYSPPVTLHPLDSHNSSCTKYGYCGDCMLNPACGFCYHENSSG 270          

HSP 2 Score: 95.5153 bits (236), Expect = 9.962e-43
Identity = 48/112 (42.86%), Postives = 68/112 (60.71%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            Y FC P+T +  WI+L G++LY+ SFA GMGP+PW + SEIYP W RST  A S G  W+ N + +L F +I     +  IF++Y  FT+ G+   +   PET  + LE + 
Sbjct:  306 YNFC-PTTYS--WIVLTGLLLYLTSFAPGMGPMPWTINSEIYPLWARSTGNACSAGVNWIFNVVLSLTFLHIAELITYQGIFFVYMGFTVLGLLFAFGCLPETQGLQLEDIE 414          
BLAST of Proton myo-inositol cotransporter-like vs. TrEMBL
Match: A0A4Y6GR41 (Glucose transporter 13b OS=Lateolabrax maculatus OX=315492 GN=GLUT13b PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.360e-42
Identity = 68/219 (31.05%), Postives = 112/219 (51.14%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD------VRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            VPA+   +G L +PES RWLL K R  E  +V+ +++     N+ E    I  +     E+ +++      ++ RILG    R+ L++GCSLQM  QL GIN +MYY+ ++ Q     ++K  +W     +  N + + V   L++++GRRKL L SL G   SL ++AV   L          +   +QN+ C  + +        CE+C +D + G+
Sbjct:  202 VPAVLQFVGFLFLPESPRWLLKKGRSQEGRQVLSRIRG--GQNVDEEYNAIRTS----IEEEEKESGGGGIVILRILGHGPTRRALIVGCSLQMFQQLSGINTVMYYSATILQMAGVRDVKQAIWLAAATSATNFVFTLVGVYLVERVGRRKLTLGSLLGTALSLTLLAVGFLLSAQNSPPVTLHPVDSQNSTCRLYGS--------CEFCMLDPSCGF 406          

HSP 2 Score: 92.8189 bits (229), Expect = 1.360e-42
Identity = 49/123 (39.84%), Postives = 67/123 (54.47%), Query Frame = 2
Query: 2213 QTNGTCS---IYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            QT  T S    Y +C  S    +WI+L G+ILY+  FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F ++     +Y  F++Y    + G+  +    PET  + LE M 
Sbjct:  439 QTEATDSPIWAYNYCPTS---YSWIVLTGLILYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEFLTYYGAFFMYTGLVVLGLLFVQGCLPETQGLQLEDME 558          
BLAST of Proton myo-inositol cotransporter-like vs. TrEMBL
Match: A0A484D607 (MFS domain-containing protein OS=Perca flavescens OX=8167 GN=EPR50_G00091410 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 5.977e-42
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK-------RNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            VPA+   +G L +PES RWLL K R  EA + + +++     NI E  + I       E++    +    F++ RIL     R+ L++GC LQM  QL GIN +MYY+ ++ Q     ++K  +W     +  N + + V   L++++GRR L L SLFG   SL ++AV   L+  +Y          +QN+ C  + +        CE+C +D + G+
Sbjct:  220 VPAVLQFVGFLFLPESPRWLLQKGRNQEARQTLSRIRG--GQNIDEEYDTIRTTIEEEEKETGGGR----FVILRILRHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGIRDVKQAIWLAAATSATNFVFTLVGVWLVERVGRRHLTLGSLFGTALSLTLLAVGF-LLSAQYSPPITLHPVDSQNSTCRLYGS--------CEFCMLDPDCGF 424          

HSP 2 Score: 90.5077 bits (223), Expect = 5.977e-42
Identity = 48/123 (39.02%), Postives = 68/123 (55.28%), Query Frame = 2
Query: 2213 QTNGTCS---IYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            QT  T S    Y +C  S    +W++LLG+ILY+  FA GMG +PW V SEIYP W RST  A S G  W+ N + +L F ++     +Y  F++Y    + GI  +    PET  + LE ++
Sbjct:  457 QTEATDSPIWAYNYCPTS---YSWVVLLGLILYLAFFAPGMGTMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTYYGAFFMYTGLVVLGILFVQGCLPETRGLQLEDID 576          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Cavefish
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:103031966])

HSP 1 Score: 103.219 bits (256), Expect = 2.714e-22
Identity = 69/215 (32.09%), Postives = 111/215 (51.63%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSY-HCEYCQIDENSGY 2193
            AVPAL    G L +PES RWL+ K    +A  V+ +++     NI E  E+I  +     E+ ++       IL R+L    AR+ L++GC LQM  QL GIN +MYY+ ++ Q     + K+ +W + L    N + + +   L++K+GRR+L+L S+ G   SL ++A    L+  ++      +  D  LA      Y  CE C +D + G+
Sbjct:  258 AVPALVQFFGFLFLPESPRWLIQKGLTQKARRVLSQIRG--NQNIDEEYESIKSS----IEEEEKDCGGDGPILWRMLTYPPARRALIVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDKLAIWLSSLTALTNFLFTLLGVWLVEKVGRRRLSLGSIIGTSVSLCLLAFGF-LLSAQHSPPVTIHPTDPSLANSSCTRYLSCEPCMLDPSCGF 465          

HSP 2 Score: 92.0485 bits (227), Expect = 9.689e-19
Identity = 47/119 (39.50%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*RI 2593
            Y FC  S    +W++LLG+ILY+  FA G+GP+PW V SEIYP W RST  A S G  W  N + +L F ++     +Y  F++Y + ++ G   IY   PET    LE++  +   R+
Sbjct:  509 YNFCPTS---YSWVVLLGLILYLAFFAPGLGPMPWTVNSEIYPLWARSTGNACSAGVNWTFNVLVSLTFLHLAQYLTYYGAFFLYSSLSLLGFFFIYGCLPETKGRRLEEIESLFESRL 624          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Cavefish
Match: slc2a13b (solute carrier family 2 member 13b [Source:ZFIN;Acc:ZDB-GENE-090812-1])

HSP 1 Score: 93.5893 bits (231), Expect = 1.877e-19
Identity = 69/221 (31.22%), Postives = 105/221 (47.51%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILE--ANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            AVPA+   IG L +PES RWLL K R  +A EV+  ++           EN+ E   N+    + +E++     +L RIL    AR+ LV+GC LQM  QL GIN +MYY+ ++ Q     + K+ +W +    F N + + V   L++   + KL L+   G   SL ++AV   L       V     + N  C ++          CE C +D   G+
Sbjct:  141 AVPAVLQFIGFLFLPESPRWLLQKGRSQQAREVLTHIRA---------TENVDEEFNNIKNIIEEEEKESGGGLVLWRILTSAPARRALVVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKMAIWLSAATAFTNFLFTLVGVWLVEH--KTKLYLLLSSGTTVSLSVLAVGFLLSAQASPPVTIHPTSLNTTCSHY--------GFCENCMLDPACGF 342          

HSP 2 Score: 90.5077 bits (223), Expect = 1.828e-18
Identity = 41/101 (40.59%), Postives = 60/101 (59.41%), Query Frame = 2
Query: 2270 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +WI++LG++LY+  FA GMGP+PW V SEIYP W RST  A S G  W+CN + +L F ++     +Y  F++Y    + G   +    PET  + LE + 
Sbjct:  388 SWIVMLGLLLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAEYLTYYGAFFLYSGLALLGFFFVLGCLPETKGLMLEDIE 488          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Cavefish
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3-like [Source:NCBI gene;Acc:103028878])

HSP 1 Score: 50.8322 bits (120), Expect = 6.501e-14
Identity = 23/75 (30.67%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 2219 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIF 2443
            NGT ++    +  T  I+++ +L +  +V SF IG GPIPW + +E++    R   +A+   + W+ NF+  + F
Sbjct:  329 NGTVAVTSDASSKTPVISYVAILAVFGFVASFEIGPGPIPWFIATELFAQDARPAAVAVGGCSNWISNFLVAMFF 403          

HSP 2 Score: 46.9802 bits (110), Expect = 6.501e-14
Identity = 49/210 (23.33%), Postives = 101/210 (48.10%), Query Frame = 1
Query: 1531 PIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEA---IEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVS 2151
            P++L   A+PA+   + ++   ES R+LL   + +E    I V+ + ++  E +I E  E   EA+ L +E            +  +  + I R+ +++   + +  Q  GIN + YY+  +F+   ++ +   ++ T     IN + + V+  L+++ GRR L +  L G+    +++ + LQLV        Q ++C   + C+  V+
Sbjct:  140 PLLLGLTALPAVLQSVMLIFCSESPRYLLINLKQEEEARRILVLLRGQEDVEDDIREMKE---EADKLNQEQKVS--------IPELFRNPIYRQPIIIAIVMNVSQQFSGINAVFYYSTQIFK---SSGVSEPIYATIGTGIINTVFTVVSLFLVERAGRRTLQMFGLGGMAICALVMTIVLQLVLDPCAP--QEDLCAAPVVCNGTVA 333          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Cavefish
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3-like [Source:NCBI gene;Acc:103028878])

HSP 1 Score: 50.8322 bits (120), Expect = 8.627e-14
Identity = 23/75 (30.67%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 2219 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIF 2443
            NGT ++    +  T  I+++ +L +  +V SF IG GPIPW + +E++    R   +A+   + W+ NF+  + F
Sbjct:  381 NGTVAVTSDASSKTPVISYVAILAVFGFVASFEIGPGPIPWFIATELFAQDARPAAVAVGGCSNWISNFLVAMFF 455          

HSP 2 Score: 46.595 bits (109), Expect = 8.627e-14
Identity = 49/210 (23.33%), Postives = 103/210 (49.05%), Query Frame = 1
Query: 1531 PIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEA---IEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVS 2151
            P++L   A+PA+   + ++   ES R+LL   + +E    I V+ + ++  E +I E  E   EA+ L         +++K  +  +  + I R+ +++   + +  Q  GIN + YY+  +F+   ++ +   ++ T     IN + + V+  L+++ GRR L +  L G+    +++ + LQLV        Q ++C   + C+  V+
Sbjct:  192 PLLLGLTALPAVLQSVMLIFCSESPRYLLINLKQEEEARRILVLLRGQEDVEDDIREMKE---EADKL--------NQEQKVSIPELFRNPIYRQPIIIAIVMNVSQQFSGINAVFYYSTQIFK---SSGVSEPIYATIGTGIINTVFTVVSLFLVERAGRRTLQMFGLGGMAICALVMTIVLQLVLDPCAP--QEDLCAAPVVCNGTVA 385          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Cavefish
Match: slc2a10 (solute carrier family 2 member 10 [Source:NCBI gene;Acc:103042379])

HSP 1 Score: 64.3142 bits (155), Expect = 3.276e-10
Identity = 32/110 (29.09%), Postives = 57/110 (51.82%), Query Frame = 2
Query: 2252 PSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
            P+  + NW++L+ M+  V +F++  GP+ W++ SEI+PA  R    A +    W+ N I +  F ++  +      F+IY    +  +A IY   PET    L+ ++  L
Sbjct:  371 PAMGSYNWLILICMMSVVAAFSVSFGPMTWLILSEIFPAELRGRAFAFTNFFNWVANLIVSFSFLSVIDAIGLSGTFFIYGVIAVAAVAFIYFLLPETKGKSLQDIDQEL 480          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002434.1 (pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 gene:ENSPMAG00000002223.1 transcript:ENSPMAT00000002434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 7.988e-16
Identity = 35/100 (35.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query: 1765 FILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAV 2064
            ++L +++     R+ LV+GC LQM  QL GIN +MYY+ ++ Q     +    +W      F N I S +   L++++GRR+L+LIS+ G I SL ++  
Sbjct:    2 WVLWKMIKHPPTRRALVVGCGLQMFQQLAGINTVMYYSATILQMAGVADDSTAIWLASATAFTNFIFSALGVWLVERVGRRQLSLISMAGAIVSLALLGC 101          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006105.1 (pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 gene:ENSPMAG00000005515.1 transcript:ENSPMAT00000006105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 2.477e-7
Identity = 29/112 (25.89%), Postives = 46/112 (41.07%), Query Frame = 2
Query: 2246 CNPSTININWILLL---GMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
               ST ++ W+ L    G+      F++G GPIPW+V SE++P   R     +     W+  F+     +       F   FW + +    G  L     PET    LE++ 
Sbjct:   47 AGASTGSLGWLALASMAGLHRRCGRFSLGWGPIPWIVMSEVFPVRWRGVASGVCVAVNWISAFVVTKPTSAAVEWLGFPGAFWFFASVCAAGFVLTIVALPETKGRSLEQIQ 158          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Yeast
Match: ITR2 (Myo-inositol transporter; member of the sugar transporter superfamily; expressed constitutively; ITR2 has a paralog, ITR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005463])

HSP 1 Score: 63.5438 bits (153), Expect = 9.660e-11
Identity = 36/117 (30.77%), Postives = 64/117 (54.70%), Query Frame = 1
Query: 1804 KTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSY 2154
            + L++GC LQ + Q  G N LMY++ ++F+   T   K     + +++  N + + +A+  IDKIGRR + LI L G+  +LVI A+    + +++      N  D  +A D + S+
Sbjct:  359 RALIIGCGLQAIQQFTGWNSLMYFSGTIFE---TVGFKNSSAVSIIVSGTNFVFTLIAFFCIDKIGRRYILLIGLPGMTVALVICAIAFHFLGIKF------NGADAVVASDGFSSW 466          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Yeast
Match: HXT3 (Low affinity glucose transporter of the major facilitator superfamily; expression is induced in low or high glucose conditions; HXT3 has a paralog, HXT5, that arose from the whole genome duplication [Source:SGD;Acc:S000002753])

HSP 1 Score: 63.1586 bits (152), Expect = 1.216e-10
Identity = 54/196 (27.55%), Postives = 88/196 (44.90%), Query Frame = 1
Query: 1483 TNSFRKNYKYALFRTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQI-PESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTF--INLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA 2061
            TN   KNY  ++   +P+ L      ALF++ GM  VPES R+L+   +IDEA   + K+ ++ P+    +    ++EA+V            + F      G     K  +MG  +Q L QL G N   YY  ++F     N + +   F   + F  +N  S+  +   +D+ GRR   L    G++   V+ A
Sbjct:  219 TNFGTKNYSNSVQWRVPLGLCF--AWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWGELFT-----GKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVF-----NAVGMSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYA 402          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Yeast
Match: STL1 (Glycerol proton symporter of the plasma membrane; subject to glucose-induced inactivation, strongly but transiently induced when cells are subjected to osmotic shock [Source:SGD;Acc:S000002944])

HSP 1 Score: 62.3882 bits (150), Expect = 1.876e-10
Identity = 47/165 (28.48%), Postives = 79/165 (47.88%), Query Frame = 1
Query: 1561 ALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVI 2055
            ALFLL  M+ +PES RWL+S++R +EA  +V  L    + N  E +  +   +  +     E+      +  R     + R   ++  S Q   Q  G N  +YY+  LF K +  + ++ +    +   I  +S+  ++ LI+K+GRRKL L+   G   S  I
Sbjct:  213 ALFLLAFMIKLPESPRWLISQSRTEEARYLVGTLDD-ADPNDEEVITEVAMLHDAVNRTKHEKHSLSS-LFSRGRSQNLQRA--LIAASTQFFQQFTGCNAAIYYSTVLFNKTIKLDYRLSMIIGGVFATIYALSTIGSFFLIEKLGRRKLFLLGATGQAVSFTI 373          

HSP 2 Score: 47.7506 bits (112), Expect = 6.839e-6
Identity = 27/96 (28.12%), Postives = 50/96 (52.08%), Query Frame = 2
Query: 2285 LGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            +G+ L++  F + +  +PW+   EI     R++  A ST   WLCNF   ++FT IF  +  +  +  +       I +I+ ++PET    LE+++
Sbjct:  391 VGLFLFITFFGLSLLSLPWIYPPEIASMKVRASTNAFSTCTNWLCNFAV-VMFTPIFIGQSGWGCYLFFAVMNYLYIPVIFFFYPETAGRSLEEID 485          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Yeast
Match: HXT1 (Low-affinity glucose transporter of the major facilitator superfamily; expression is induced by Hxk2p in the presence of glucose and repressed by Rgt1p when glucose is limiting; HXT1 has a paralog, HXT6, what arose from the whole genome duplication [Source:SGD;Acc:S000001136])

HSP 1 Score: 62.3882 bits (150), Expect = 2.065e-10
Identity = 51/195 (26.15%), Postives = 89/195 (45.64%), Query Frame = 1
Query: 1483 TNSFRKNYKYALFRTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESN-ITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKY-VTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA 2061
            TN   KNY  ++   +P+ L      ALF++ GM+ VPES R+L+   RIDEA   + K+ + P  +   ++    +EA+V            + F      G     +  +MG  +Q L QL G N   YY   +FQ   ++++ +  +    +   +N  S+  +   +D+ GRR   +    G++   V+ A
Sbjct:  222 TNFGTKNYSNSVQWRVPLGLCFAW--ALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVEEMRAAGTASWGELFT-----GKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSFETSI----VFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYA 405          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Yeast
Match: HXT2 (High-affinity glucose transporter of the major facilitator superfamily; expression is induced by low levels of glucose and repressed by high levels of glucose [Source:SGD;Acc:S000004613])

HSP 1 Score: 61.2326 bits (147), Expect = 4.053e-10
Identity = 61/207 (29.47%), Postives = 93/207 (44.93%), Query Frame = 1
Query: 1561 ALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQ--IPESNITEFVENILEANVLIXXXXXXXXXXXXF-----ILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHC 2160
            A+F++ GML VPES R+L+ K R ++A   + K  +  I + +I   ++ I+ ANV  E         + F     IL R+          +MG  +Q L QL G N   YY  ++F       +K     + +L  +N  S+FVA   +DK GRRK     L G   S+ I  V    V V  L  N  +   +  A +  + + C
Sbjct:  237 AIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIM-ANVETERLAGNASWGELFSNKGAILPRV----------IMGIMIQSLQQLTGNNYFFYYGTTIFNAV---GMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKC----LLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTC 425          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Nematostella
Match: EDO46902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNS4])

HSP 1 Score: 91.2781 bits (225), Expect = 4.447e-19
Identity = 71/221 (32.13%), Postives = 110/221 (49.77%), Query Frame = 1
Query: 1552 AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNI-------CDNFLACDDWVSY-HCEYCQIDENSG 2190
            AVP++ +  G + +PES RWL+SK +  EA   + K++   +      V+  LEA  +      E+KE+   +L RIL     R+ L++GC LQ + QL GIN +MYY+ ++       N K  +W    + F N + + V   L+++IGRRKL L SL G+I SL ++     L      K +           C N   C D V+  +C YC   ++ G
Sbjct:  170 AVPSIIMFFGCVILPESPRWLISKCKYAEARAALCKIRGRTD------VDRELEA--VRRTCKVERKERSGQVLIRILRFPNTRRALLVGCMLQAIQQLCGINTVMYYSATIILMSGIGNSKTSIWLAAAIAFGNTLFTIVGIFLVERIGRRKLLLGSLAGVILSLFLLGGAFYLAMQHNPKVSTAETINPVFTHCTNQTTCMDCVNVRNCGYCYSTDSDG 382          

HSP 2 Score: 84.3445 bits (207), Expect = 7.325e-17
Identity = 37/106 (34.91%), Postives = 60/106 (56.60%), Query Frame = 2
Query: 2273 WILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*R 2590
            W+  LG+++Y+ +FA GMGP+PW + SE+YP W RST  A ST   W+CN + ++ F ++         FW+Y    + G    + + PET    LE+++ +   R
Sbjct:  424 WMAFLGLVIYIATFAPGMGPMPWTLNSEMYPLWARSTGNACSTAVNWICNLVISMTFLSLMGWITRPGAFWLYGCIAVAGWVFFFVFVPETKGKTLEELDSLFVSR 529          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Nematostella
Match: EDO32615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ6])

HSP 1 Score: 67.0106 bits (162), Expect = 1.594e-11
Identity = 33/120 (27.50%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2225 TCSIYEFC----NPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            TC++Y F       + ++I W+ +  + +Y++ FA+G GP  W++ SEI+P   R T   ++T   W C+F+    F+ +         F  + AF    +  +Y + PET    LE++ 
Sbjct:  315 TCAVYFFITVNFGMTEVDIAWLSVTSVAVYIVGFALGWGPCTWLIMSEIFPVRARGTATGIATFFNWFCSFVVTKTFSALIDGLTEAGTFCFFGAFVFASVLFVYFFVPETKGKTLEEIQ 434          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Nematostella
Match: EDO42861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E6])

HSP 1 Score: 60.8474 bits (146), Expect = 1.530e-9
Identity = 29/105 (27.62%), Postives = 51/105 (48.57%), Query Frame = 2
Query: 2264 NINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYV 2578
             I+W+ +  ++++ + FA+  GP+PW+V SEI+P   R    ++ST   W   F     F NI  +      +W Y   +  G   +  + PET    LE++  +
Sbjct:  350 KISWLAITSIVVFNLVFALAWGPVPWLVMSEIFPLQARGIASSISTLCNWSLAFAVTKTFVNIEDAITIQGTYWFYGGLSFLGFLFVLMFVPETKGKTLEQIERL 454          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Nematostella
Match: EDO35120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF8])

HSP 1 Score: 56.9954 bits (136), Expect = 2.106e-8
Identity = 42/161 (26.09%), Postives = 86/161 (53.42%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGI 2037
            +PA+F L+ +   P S R+LL +  +D+ ++ V  L+++  ++  +  E+I E  +  + +   +      +  R    +  +  L++GC + M  QL GIN ++YY+ S+F+K      ++    T  +  + L+ + +A +L++ +GRR L LI L G+
Sbjct:  205 LPAVFQLVTLPWCPNSPRYLLIE--LDQELQAVEALRKLRATD--DVTEDINEMKIERDREATTEHVSVLQLFVR----RDLQMPLLIGCVMMMAQQLGGINAVLYYSTSIFEKVGVPESRVA---TTGIGVVALVFTAIAVRLVEVLGRRTLMLIGLGGM 354          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Medaka
Match: slc2a13b (proton myo-inositol cotransporter [Source:NCBI gene;Acc:101158939])

HSP 1 Score: 103.219 bits (256), Expect = 2.558e-22
Identity = 67/218 (30.73%), Postives = 112/218 (51.38%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            +PA+   +G + +PES RWLL K +  EA++V+R ++   + N+ E  ++I +AN+   E+ +++      +L R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + K  +W     +  N + + V   L++++GRRKL L SL G   SL ++AV   L       V     + NN               CE C +D + G+
Sbjct:  201 LPAVLQFLGFIFLPESPRWLLQKGQNQEALQVLRWIRG--DQNVEEEYDSI-KANI---EEEEKEVGAGGVVLLRMLSHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKEAIWLAAATSATNFVFTLVGVWLVERVGRRKLTLGSLLGTGLSLALLAVGFLLSAQSSPPVTLHPVDPNNSTYRLYG-------SCEPCMLDPDCGF 405          

HSP 2 Score: 83.9593 bits (206), Expect = 2.942e-16
Identity = 44/112 (39.29%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            Y +C  S    +WI+L+G+ LY+  FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F ++     +Y  F++Y      G+  +    PET  + LE M 
Sbjct:  449 YNYCPTS---YSWIVLMGLFLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTYYGAFFLYTGLVFLGLLFVLGCLPETRGLQLEDME 557          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Medaka
Match: slc2a13b (proton myo-inositol cotransporter [Source:NCBI gene;Acc:101158939])

HSP 1 Score: 102.834 bits (255), Expect = 3.114e-22
Identity = 67/218 (30.73%), Postives = 112/218 (51.38%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 2193
            +PA+   +G + +PES RWLL K +  EA++V+R ++   + N+ E  ++I +AN+   E+ +++      +L R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + K  +W     +  N + + V   L++++GRRKL L SL G   SL ++AV   L       V     + NN               CE C +D + G+
Sbjct:  201 LPAVLQFLGFIFLPESPRWLLQKGQNQEALQVLRWIRG--DQNVEEEYDSI-KANI---EEEEKEVGAGGVVLLRMLSHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKEAIWLAAATSATNFVFTLVGVWLVERVGRRKLTLGSLLGTGLSLALLAVGFLLSAQSSPPVTLHPVDPNNSTYRLYG-------SCEPCMLDPDCGF 405          

HSP 2 Score: 83.9593 bits (206), Expect = 2.914e-16
Identity = 44/112 (39.29%), Postives = 62/112 (55.36%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            Y +C  S    +WI+L+G+ LY+  FA GMGP+PW V SEIYP W RST  A S G  W+ N + +L F ++     +Y  F++Y      G+  +    PET  + LE M 
Sbjct:  449 YNYCPTS---YSWIVLMGLFLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTYYGAFFLYTGLVFLGLLFVLGCLPETRGLQLEDME 557          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Medaka
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:101157657])

HSP 1 Score: 88.5817 bits (218), Expect = 6.088e-18
Identity = 40/112 (35.71%), Postives = 64/112 (57.14%), Query Frame = 2
Query: 2237 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMN 2572
            Y +C  S     W++LLG+++Y  +FA GMGP+PW + SEIYP W RST  A + G  W  N + ++ F ++     +Y +F++Y +  + G   +Y   PET    LE++ 
Sbjct:  308 YNYCPTSYF---WLVLLGLVMYFAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSVTFLHLAQYLTYYGVFFLYSSLALLGFVFVYGCLPETKARRLEEIE 416          

HSP 2 Score: 86.2705 bits (212), Expect = 2.674e-17
Identity = 62/214 (28.97%), Postives = 109/214 (50.93%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYH-CEYCQIDENSGY 2193
            +PA+   +G L +PES RWL+ +    +A  V+ +++     NI E  ++I  +     E+ ++       ++ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   L T  N + + +   L++K+GRRKL L S+ G   SL ++AV   L+  ++         D  +A      Y  CE C +D + G+
Sbjct:   58 IPAVLQFLGFLFLPESPRWLIQRGLTQKARRVLSQIRG--NQNIDEEYDSIKNS----IEEEEKDSGGDGPVVWRMLTYPPTRRALLVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDRLAIWLAGLATLTNFLFTLLGVWLVEKVGRRKLTLGSILGTTLSLSLLAVGF-LMSAQHSPPVTFRPLDPAMANSTCSKYRLCEPCMLDPSCGF 264          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Medaka
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:101157657])

HSP 1 Score: 86.6557 bits (213), Expect = 3.861e-17
Identity = 62/214 (28.97%), Postives = 109/214 (50.93%), Query Frame = 1
Query: 1555 VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYH-CEYCQIDENSGY 2193
            +PA+   +G L +PES RWL+ +    +A  V+ +++     NI E  ++I  +     E+ ++       ++ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   L T  N + + +   L++K+GRRKL L S+ G   SL ++AV   L+  ++         D  +A      Y  CE C +D + G+
Sbjct:  250 IPAVLQFLGFLFLPESPRWLIQRGLTQKARRVLSQIRG--NQNIDEEYDSIKNS----IEEEEKDSGGDGPVVWRMLTYPPTRRALLVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDRLAIWLAGLATLTNFLFTLLGVWLVEKVGRRKLTLGSILGTTLSLSLLAVGF-LMSAQHSPPVTFRPLDPAMANSTCSKYRLCEPCMLDPSCGF 456          

HSP 2 Score: 70.8626 bits (172), Expect = 3.264e-12
Identity = 34/94 (36.17%), Postives = 51/94 (54.26%), Query Frame = 2
Query: 2273 WILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIY-KYFPETNQ 2551
            W++LLG+++Y  +FA GMGP+PW + SEIYP W RST  A + G  W  N + ++ F ++     +Y  F   C      +A    + FP   Q
Sbjct:  509 WLVLLGLVMYFAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSVTFLHLAQYLTYYGQFEAPCFSPASSVADAQLQVFPSNQQ 602          
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Medaka
Match: slc2a8 (solute carrier family 2, facilitated glucose transporter member 8 [Source:NCBI gene;Acc:101171341])

HSP 1 Score: 66.2402 bits (160), Expect = 6.830e-11
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 2
Query: 2141 TGLVITVNIVKLTKIPDILVLIMGQTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYV 2578
            +G+ +T++ V L     +   +M +     +          +++W+ L  M +++  FAIG GPIPW++ SEI+PA  R    A+   + W   F+    F ++  S      FW++ +  +  I     + PET    LE++  +
Sbjct:  314 SGVAMTISTVAL----GVYFHLMSKLGSAVTDSTSVTAEQPDLSWLALASMAVFISGFAIGWGPIPWLIMSEIFPAKARGFASAMVVLSNWGMAFVVTKTFQDMLMSLTSAGTFWLFSSTCVVNILFTVFFIPETKGKTLEQIEAI 455          

HSP 2 Score: 56.225 bits (134), Expect = 1.072e-7
Identity = 49/193 (25.39%), Postives = 89/193 (46.11%), Query Frame = 1
Query: 1504 YKYALFRTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 2082
            Y   LF     + I  +VP   +++ M  +PE+ R+LLS+ +  EA E +R L+  P++  T F  + L+                         D    K L++G  L +  Q+ GIN +M+YA ++F++       +    + ++  I ++ + VA  ++DK GR+ L +IS   +  S V + V   L+ 
Sbjct:  170 YFLGLFMDWRWLAICCSVPPTLMMVLMCFMPETPRFLLSQGKRREAEEALRFLRG-PDAPGTSFHISDLK-------------------------DPGVYKPLIIGVMLMVFQQMTGINAIMFYAENIFEQAHFEESDLA---SVIVGLIQVVFTAVAALIMDKAGRKILLIISGVAMTISTVALGVYFHLMS 333          
BLAST of Proton myo-inositol cotransporter-like vs. Planmine SMEST
Match: SMESG000056331.1 (SMESG000056331.1)

HSP 1 Score: 256.144 bits (653), Expect = 1.794e-125
Identity = 146/228 (64.04%), Postives = 181/228 (79.39%), Query Frame = 1
Query: 1534 IILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 2217
            I+L TP +PA+ +LIGMLTV ESYRWLL+KNR DEA EV+RKLKQ+ ES+I EFV+ ILEAN++IEE+  +++    F+L RIL +KIARK+L+ GC +Q++ Q+ GIN ++Y +  LFQ +   + +  LWF  L+ F N I SFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV VR L  NQNN C NFL+CDD ++ +CEYCQIDE+SGYTCVN GAN
Sbjct:  173 IVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKR----FMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYERALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL--NQNNNCSNFLSCDDCINNYCEYCQIDESSGYTCVNSGAN 394          

HSP 2 Score: 214.542 bits (545), Expect = 1.794e-125
Identity = 109/122 (89.34%), Postives = 109/122 (89.34%), Query Frame = 2
Query: 2219 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 2584
             G  SIY F NP T  INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL    CNLIFT IFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF
Sbjct:  398 KGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL----CNLIFTLIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 515          
BLAST of Proton myo-inositol cotransporter-like vs. Planmine SMEST
Match: SMESG000056331.1 (SMESG000056331.1)

HSP 1 Score: 256.529 bits (654), Expect = 2.137e-125
Identity = 146/228 (64.04%), Postives = 181/228 (79.39%), Query Frame = 1
Query: 1534 IILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 2217
            I+L TP +PA+ +LIGMLTV ESYRWLL+KNR DEA EV+RKLKQ+ ES+I EFV+ ILEAN++IEE+  +++    F+L RIL +KIARK+L+ GC +Q++ Q+ GIN ++Y +  LFQ +   + +  LWF  L+ F N I SFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV VR L  NQNN C NFL+CDD ++ +CEYCQIDE+SGYTCVN GAN
Sbjct:  142 IVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKR----FMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYERALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL--NQNNNCSNFLSCDDCINNYCEYCQIDESSGYTCVNSGAN 363          

HSP 2 Score: 214.157 bits (544), Expect = 2.137e-125
Identity = 109/122 (89.34%), Postives = 109/122 (89.34%), Query Frame = 2
Query: 2219 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 2584
             G  SIY F NP T  INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL    CNLIFT IFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF
Sbjct:  367 KGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWL----CNLIFTLIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF 484          
BLAST of Proton myo-inositol cotransporter-like vs. Planmine SMEST
Match: SMESG000056325.1 (SMESG000056325.1)

HSP 1 Score: 159.073 bits (401), Expect = 1.464e-43
Identity = 82/121 (67.77%), Postives = 90/121 (74.38%), Query Frame = 2
Query: 2219 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
             G  SIY F NP T  INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALST A W  NF      T   F+   Y  FWIY AFT+CGIALIY+ FPE NQ ++E++ +VL
Sbjct:  139 KGNYSIYNFHNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSV----TMTVFAIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 255          

HSP 2 Score: 99.7525 bits (247), Expect = 4.680e-23
Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1
Query: 1582 MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI 1728
            MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI
Sbjct:    1 MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI 49          
BLAST of Proton myo-inositol cotransporter-like vs. Planmine SMEST
Match: SMESG000056221.1 (SMESG000056221.1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.524e-14
Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 1
Query: 1537 ILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI 1728
            +L   A+P+    IGMLTVPESYRWLLSKN++DEA  ++    Q+PE  ITE+++ I+ AN  I
Sbjct:  146 MLGGAAIPSFIEFIGMLTVPESYRWLLSKNKVDEARTIIVNQGQVPEERITEYIDEIVRANQQI 209          
BLAST of Proton myo-inositol cotransporter-like vs. Planmine SMEST
Match: SMESG000022417.1 (SMESG000022417.1)

HSP 1 Score: 54.299 bits (129), Expect = 6.521e-8
Identity = 31/102 (30.39%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 2276 ILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNLIFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 2581
            I ++ + LY+I FAIG+GPIP +V +EI+    R+   +L+ G  W  +FI  L++  I        +F I+  FT+  +  +  + PET      ++  +L
Sbjct:   94 ISVVAIFLYIIGFAIGLGPIPGIVVAEIFTQAPRAAAYSLALGIQWFSSFIILLLYPIINDVIPSGYVFVIFLCFTVPSLTFLVIFMPETKNRSFAEIAKIL 195          
The following BLAST results are available for this feature:
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A131.964e-2227.93solute carrier family 2 member 13 [Source:HGNC Sym... [more]
SLC2A122.181e-1032.43solute carrier family 2 member 12 [Source:HGNC Sym... [more]
SLC2A89.278e-928.30solute carrier family 2 member 8 [Source:HGNC Symb... [more]
SLC2A131.685e-829.91solute carrier family 2 member 13 [Source:HGNC Sym... [more]
SLC2A82.047e-828.30solute carrier family 2 member 8 [Source:HGNC Symb... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hmit-1.32.725e-1928.70H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.32.725e-1928.70H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.21.844e-1627.54H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.11.885e-1428.63H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tret1-15.213e-1426.98gene:FBgn0050035 transcript:FBtr0088074[more]
CG64841.168e-1328.30gene:FBgn0034247 transcript:FBtr0086903[more]
Tret1-11.371e-1327.20gene:FBgn0050035 transcript:FBtr0088073[more]
Tret1-24.754e-1327.83gene:FBgn0033644 transcript:FBtr0088075[more]
sut31.358e-934.02gene:FBgn0028561 transcript:FBtr0332247[more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b1.886e-2329.69solute carrier family 2 member 13b [Source:ZFIN;Ac... [more]
SLC2A133.445e-1731.43proton myo-inositol cotransporter-like [Source:NCB... [more]
slc2a3b3.198e-1626.78solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
slc2a3b3.198e-1626.78solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
slc2a3b2.114e-1526.82solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf21b2.740e-4140.68PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE... [more]
phf21b3.499e-3727.93PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE... [more]
slc2a102.043e-1237.25solute carrier family 2 (facilitated glucose trans... [more]
slc2a102.163e-1237.25solute carrier family 2 (facilitated glucose trans... [more]
slc2a102.178e-1237.25solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc2a136.440e-4430.18solute carrier family 2 (facilitated glucose trans... [more]
Slc2a122.963e-1131.82solute carrier family 2 (facilitated glucose trans... [more]
Slc2a21.282e-929.79solute carrier family 2 (facilitated glucose trans... [more]
Slc2a106.200e-933.00solute carrier family 2 (facilitated glucose trans... [more]
Slc2a86.710e-826.92solute carrier family 2, (facilitated glucose tran... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UHK1|MYCT_MOUSE3.922e-4330.18Proton myo-inositol cotransporter OS=Mus musculus ... [more]
sp|Q9ZQP6|INT3_ARATH8.944e-2626.75Probable inositol transporter 3 OS=Arabidopsis tha... [more]
sp|A9ZSY3|TRET1_BOMMO5.907e-2534.62Facilitated trehalose transporter Tret1 OS=Bombyx ... [more]
sp|Q96QE2|MYCT_HUMAN9.430e-2227.93Proton myo-inositol cotransporter OS=Homo sapiens ... [more]
sp|Q921A2|MYCT_RAT1.224e-2129.73Proton myo-inositol cotransporter OS=Rattus norveg... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJX43.472e-15393.64Slc2a-9 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
R7U3K52.904e-4529.60MFS domain-containing protein OS=Capitella teleta ... [more]
A0A3Q3DIX29.962e-4328.96Solute carrier family 2 member 13b OS=Hippocampus ... [more]
A0A4Y6GR411.360e-4231.05Glucose transporter 13b OS=Lateolabrax maculatus O... [more]
A0A484D6075.977e-4231.36MFS domain-containing protein OS=Perca flavescens ... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A132.714e-2232.09solute carrier family 2 member 13 [Source:NCBI gen... [more]
slc2a13b1.877e-1931.22solute carrier family 2 member 13b [Source:ZFIN;Ac... [more]
slc2a3b6.501e-1430.67solute carrier family 2, facilitated glucose trans... [more]
slc2a3b8.627e-1430.67solute carrier family 2, facilitated glucose trans... [more]
slc2a103.276e-1029.09solute carrier family 2 member 10 [Source:NCBI gen... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002434.17.988e-1635.00pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 g... [more]
ENSPMAT00000006105.12.477e-725.89pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 ... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ITR29.660e-1130.77Myo-inositol transporter; member of the sugar tran... [more]
HXT31.216e-1027.55Low affinity glucose transporter of the major faci... [more]
STL11.876e-1028.48Glycerol proton symporter of the plasma membrane; ... [more]
HXT12.065e-1026.15Low-affinity glucose transporter of the major faci... [more]
HXT24.053e-1029.47High-affinity glucose transporter of the major fac... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO469024.447e-1932.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326151.594e-1127.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428611.530e-927.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351202.106e-826.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b2.558e-2230.73proton myo-inositol cotransporter [Source:NCBI gen... [more]
slc2a13b3.114e-2230.73proton myo-inositol cotransporter [Source:NCBI gen... [more]
SLC2A136.088e-1835.71solute carrier family 2 member 13 [Source:NCBI gen... [more]
SLC2A133.861e-1728.97solute carrier family 2 member 13 [Source:NCBI gen... [more]
slc2a86.830e-1124.66solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056331.11.794e-12564.04SMESG000056331.1[more]
SMESG000056331.12.137e-12564.04SMESG000056331.1[more]
SMESG000056325.11.464e-4367.77SMESG000056325.1[more]
SMESG000056221.18.524e-1451.56SMESG000056221.1[more]
SMESG000022417.16.521e-830.39SMESG000022417.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019056 ID=SMED30019056|Name=Proton myo-inositol cotransporter-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2612bp
TTTTAGCGTATAGTTTTAAAAAGCCATATCTAAAAATATTATTAAATAAA
ATTAAATGTAGTATTTAATAATTAAAAAATAGTATTTTAAAGTTAAGAGT
AATTTAAATTATATTTAATCTAAAATTTTATTATAAATACAGGCGAAATT
TCTGTGTAAAGGACGTGATTCGAACAAAAATCAAGAAACAAGTTCACATG
GCGAACCTGCGCTGACAATGAATTTGTCTATGAATTAAGTTTAGCAGTCA
AAATCCTATCGAAGTTTTATAACCTTCATTGTATCATTCATGTATATTAA
AATAATACTTAAAAATCAGATGCATATTATTGTTGGGTTTTAGTTAAATA
TATAATTATAGTCAGCAGTTCTGACTCCAAGAGCTCTATAAAATAAAACA
CAATAAGCCTTACGTATATTTGTATTTACAGTTACATATCACAAATATAG
CCCCGTATTACCATAGCAAGAAATAATATGCGATATAACTTATAGCCACC
CGGTGATTTCCACAATAGCTGTTTGACTCCTTGCACTTTGATACAATAAT
CTTCTTCAATAATCTGTTCCTGATAAGATTCTAATTGATCTATTGGTTTT
TCATATATTTTTCCTTACTTACAATGGACTTTAATTGTTCTTAAATAGTA
CTCTCAAGTTTTTCGTCCCTAACTGAGGAAAATGCCAGTGGTTTATGATT
TTCGATTTCCTTATATAATGGAAATAATCCTTTTGATTAATTTTTAATCT
TTAAACTAATTAGCATTTGTTTGACAATCTTTGCATTGTGGCTTCCTTTC
AAGTTCTCTCTACAGAAAATATTTAATTACTCTGCATTCGCTTTCCTCTT
AATTATCTATTTTTATTTGTTCCCATTAATCATAATGGTTTTTCAAATTC
TTCTTGGTTTGTTTTTCTTTGTCTACCAAGCTCGAGTTTTCCTTATTAAA
TTAACAATTTTATGGTCTTACCTATTTTATTGTTTTCTGCCCTTGCTAAG
CGTATTCCAACGGATCCATTATCCATTTCACAATTGTGTACTCTATACCA
AGCTCGTTTTCCACTTTTGAATTCGATTGATAATATTAACGATTAATTAA
TAAATTAATCATTAGTGTAAATTGCAATTTTTTGATTTTGTAGTGCAGTA
TACTGTTGGTGTGCCCGATTGGCAGATTTCGAGTGGAACTCCACAATTTT
TCAGAGACCTTATATGATGCTGAAAATATTTTACAGATGCTGCAAAATGA
GTATAATTCACCATTCAACAATTTAGGTTTCTAACTGTAATATAGATTTC
ATTGAGGACTTTAATACTTTGAACTTATGAGTCAAACTCCGTTTACTGTT
TGTATACTTGTATAATATATTTATTCAAATTGTGATGATACATAATAAGT
TTATTGAAATCAAAAGCATAAATTAATAACAATAAAACATGCAATAAAAT
AATAATAAAGTCTCATCAAATTTGTGTTGATGACAAACAGTTTTAGAAAA
AATTATAAATATGCTCTTTTCAGAACAATGCCAATCATACTAATTACCCC
TGCCGTACCGGCACTTTTCCTATTGATCGGAATGCTTACGGTTCCGGAGA
GTTACAGGTGGCTGTTGTCGAAAAACAGAATCGACGAAGCGATAGAAGTA
GTTCGGAAGCTGAAACAAATTCCAGAATCGAATATTACAGAGTTTGTGGA
AAATATTTTGGAAGCTAACGTTTTGATTGAAGAGGATTTGCAAGAACAAA
AAGAACAAAAGAAATTTATTTTATGTCGAATTCTTGGCGATAAAATAGCG
AGAAAGACTCTCGTAATGGGATGTTCTCTCCAAATGCTTGCTCAGTTAAT
TGGAATAAATGGGCTAATGTATTACGCGAATTCATTGTTTCAAAAGTACG
TAACTAATAATATCAAAATTTACTTGTGGTTCACTCCATTGCTTACTTTC
ATCAATTTGATATCGTCGTTTGTTGCTTATAAACTAATTGACAAAATTGG
AAGAAGAAAATTGGCGCTCATCAGTTTGTTTGGAATCATTTTCAGTTTGG
TAATCATTGCGGTAAACCTTCAACTAGTCGACGTGAGGTATCTAAAAAGA
AACCAGAATAATATTTGTGACAATTTTCTGGCATGCGATGACTGGGTTAG
TTATCACTGTGAATATTGTCAAATTGACGAAAATTCCGGATATACTTGTG
TTAATTATGGGGCAAACTAATGGCACTTGTTCAATTTATGAGTTTTGTAA
TCCAAGCACAATAAATATTAATTGGATTCTTTTGTTGGGAATGATATTGT
ATGTCATCAGTTTTGCAATTGGAATGGGGCCGATTCCTTGGGTGGTCACT
TCGGAAATATACCCCGCGTGGTGCCGCAGTACCAATATGGCATTATCAAC
AGGAGCTATGTGGTTATGTAATTTCATATGTAATCTCATATTTACAAATA
TTTTCTTTAGTCGAATATTTTACGCAATATTTTGGATTTATTGCGCTTTT
ACAATTTGTGGAATCGCCCTGATATATAAATATTTCCCAGAAACGAACCA
AATAGATTTGGAAAAAATGAATTATGTCTTATTTTAAAGAATTTTTAAAT
TGAAAATGTGAC
back to top

protein sequence of SMED30019056-orf-1

>SMED30019056-orf-1 ID=SMED30019056-orf-1|Name=SMED30019056-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MTNSFRKNYKYALFRTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNR
IDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKEQKKFILCR
ILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLW
FTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV
DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN*
back to top

protein sequence of SMED30019056-orf-2

>SMED30019056-orf-2 ID=SMED30019056-orf-2|Name=SMED30019056-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MTGLVITVNIVKLTKIPDILVLIMGQTNGTCSIYEFCNPSTININWILLL
GMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNFICNL
IFTNIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
IPR003663Sugar/inositol_transpt
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0022857transmembrane transporter activity
GO:0022891substrate-specific transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 19..196
e-value: 7.8E-32
score: 110.7
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 9..217
e-value: 2.8E-37
score: 130.6
NoneNo IPR availablePANTHERPTHR23503:SF8GLUCOSE TRANSPORTER TYPE 1coord: 19..198
NoneNo IPR availablePANTHERPTHR23503FAMILY NOT NAMEDcoord: 19..198
NoneNo IPR availableCDDcd17357MFS_GLUT_Class1_2_likecoord: 19..201
e-value: 2.23421E-23
score: 95.7913
NoneNo IPR availableTMHMMTMhelixcoord: 11..33
NoneNo IPR availableTMHMMTMhelixcoord: 147..166
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 20..195