Innexin

Overview
NameInnexin
Smed IDSMED30019050
Length (bp)1532
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30019050) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30019050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30019050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30019050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019050SMESG000051126.1 SmedASXL_013285SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019050SMESG000051126.1 dd_Smed_v4_13435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019050SMESG000051126.1 dd_Smed_v6_13435_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 247.284 bits (630), Expect = 4.833e-77
Identity = 134/376 (35.64%), Postives = 222/376 (59.04%), Query Frame = 2
Query:  239 DIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWR---LWSKRLPI--LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNP--STRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY----RQAKLNGAED 1333
            D DFVD+LNY Y++ ++F F  I+  +QYVG PIQCWVP QFT +WE+Y EN CW+++TY L      P  ++     + ISYYQWV  V+  +A+  Y+P ++WR    W   + +  L + A +A + D + RA  +Q I   +E+  E Q R      G+       C     +  +T+L++F++ L++ N + Q++++ +F+ T+N ++G  ++ DLL G EW+  GNFPR+T C   VR  G +    HT QCVL IN F EKI++FLW W+ ++A ++ ++   W +I  LP +  +FI++YL+A  L ++ +    ++FV + LG DG+F ++ +S  + D++A ++   LW N+    R+ + N  E 
Sbjct:   18 DDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPL-EYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQ-REVTDVSGM-------CVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH--HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTES 380          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 247.284 bits (630), Expect = 4.833e-77
Identity = 134/376 (35.64%), Postives = 222/376 (59.04%), Query Frame = 2
Query:  239 DIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWR---LWSKRLPI--LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNP--STRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY----RQAKLNGAED 1333
            D DFVD+LNY Y++ ++F F  I+  +QYVG PIQCWVP QFT +WE+Y EN CW+++TY L      P  ++     + ISYYQWV  V+  +A+  Y+P ++WR    W   + +  L + A +A + D + RA  +Q I   +E+  E Q R      G+       C     +  +T+L++F++ L++ N + Q++++ +F+ T+N ++G  ++ DLL G EW+  GNFPR+T C   VR  G +    HT QCVL IN F EKI++FLW W+ ++A ++ ++   W +I  LP +  +FI++YL+A  L ++ +    ++FV + LG DG+F ++ +S  + D++A ++   LW N+    R+ + N  E 
Sbjct:   18 DDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPL-EYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQ-REVTDVSGM-------CVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH--HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTES 380          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 245.743 bits (626), Expect = 6.118e-76
Identity = 133/378 (35.19%), Postives = 226/378 (59.79%), Query Frame = 2
Query:  239 DIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWR---LWSKRLPI--LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY----RQAKLNGAEDDITR 1345
            D DFVD+LNY Y++ ++F F  I+  +QYVG PIQCWVP QFT +WE+Y EN CW+++TY L      P  ++     + ISYYQWV  V+  +A+  Y+P ++WR    W   + +  L + A +A + D + RA  +Q I   +E+  E Q R      G+  +  +     +  +T+L++F++ L++ N + Q++++ +F+ T+N ++G  ++ DLL G EW+  GNFPR+T C   VR  G +    HT QCVL IN F EKI++FLW W+ ++A ++ ++   W +I  LP +  +FI++YL+A  L ++ +    ++FV + LG DG+F ++ +S  + D++A ++   LW N+    R++ +   E  +T+
Sbjct:   18 DDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPL-EYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQ-REVTDVSGMCVQKRW-----ANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH--HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQ--SVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKSPIEMFEGGVTQ 384          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 244.202 bits (622), Expect = 7.265e-76
Identity = 132/369 (35.77%), Postives = 215/369 (58.27%), Query Frame = 2
Query:  239 DIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPI----LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAED 1333
            D D +D+LNY Y+T ++ +F  ++  +QYVG PIQCWVP  FT+  E+Y EN CW+Q+TY L  ++ IP +  E  + + I YYQWV  V+  +A++ Y+P ++WRL S +  I    L++ A ++ + D E R +A+Q I T +EE    + +   G        +    +    +T L++ V+ L+ +N +GQI+L+  F+   + W+G++V++DL+ G EW++ G+FPR+T C   V+  G + +  HT QCVL IN F EKI++FLW W+ LLA  T  +   W  I  +P +Q  F+ +YL  ++     + +  +RFV   L  DG+F+L+ V+  + +L   ++  TLW NY   K     D
Sbjct:   20 DDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHR--HTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHD 385          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 221.09 bits (562), Expect = 6.128e-67
Identity = 131/371 (35.31%), Postives = 205/371 (55.26%), Query Frame = 2
Query:  239 DIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKT----AREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQ---RFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAE 1330
            D D +D+LNY ++  LL IF   +  +QYVG+PIQCW+P QFT +WE+Y+EN C++Q+TY +  ++ IP+ + +    + I YYQWV  ++G QAI+ YLP L WRL +    + LK     A++A   D + R +A +     L E    Q R        F +Y        + LT L+LFV+ L+++  + Q  ++ NF+ T+ T++G+ ++SD+L G EW++ G+FPR+T C   VR  G   +  HT QCVL IN F EK+YVFLW W  ++ V T LN + W   +     +   I+ YL+     S+   R  Q   +FV   L  DG+F+   +      + + DV   +W  + Q + N ++
Sbjct:   16 DDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDREGAE-IGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSR--------FAKYTSAFTYGGSYLTYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGN--KHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMWDRFLQDEDNRSQ 375          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 92.0485 bits (227), Expect = 6.289e-20
Identity = 80/283 (28.27%), Postives = 123/283 (43.46%), Query Frame = 2
Query:  257 QLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKL------LDNEDIPEDDFEIH-----SLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGN-------FPRITYCTINVRKFGQIKQA-SHTFQCVLPINHFVEKIYVFLWLWF 1048
            +++Y+ +  +L  F  ++  RQY+G PI C V +      + Y    CWI ST+ +      +   D+ +     H      +KY  YYQWV  V+  QAI+ Y+P  +W+ W      +L     + I + E +    + +V                  G   R+ F+ F         F     L  +N IGQIY +  F+    + +G    SD+LK  E +           FP++T CT +  K+G      +H   CVLP+N   EKIYVFLW WF
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------IGNLNRHNFYAFR--------FFVCEALNFVNVIGQIYFVDFFLDGEFSTYG----SDVLKFTELEPDERIDPMARVFPKVTKCTFH--KYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF 275          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 92.0485 bits (227), Expect = 6.289e-20
Identity = 80/283 (28.27%), Postives = 123/283 (43.46%), Query Frame = 2
Query:  257 QLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKL------LDNEDIPEDDFEIH-----SLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGN-------FPRITYCTINVRKFGQIKQA-SHTFQCVLPINHFVEKIYVFLWLWF 1048
            +++Y+ +  +L  F  ++  RQY+G PI C V +      + Y    CWI ST+ +      +   D+ +     H      +KY  YYQWV  V+  QAI+ Y+P  +W+ W      +L     + I + E +    + +V                  G   R+ F+ F         F     L  +N IGQIY +  F+    + +G    SD+LK  E +           FP++T CT +  K+G      +H   CVLP+N   EKIYVFLW WF
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------IGNLNRHNFYAFR--------FFVCEALNFVNVIGQIYFVDFFLDGEFSTYG----SDVLKFTELEPDERIDPMARVFPKVTKCTFH--KYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF 275          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 92.0485 bits (227), Expect = 6.289e-20
Identity = 80/283 (28.27%), Postives = 123/283 (43.46%), Query Frame = 2
Query:  257 QLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKL------LDNEDIPEDDFEIH-----SLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGN-------FPRITYCTINVRKFGQIKQA-SHTFQCVLPINHFVEKIYVFLWLWF 1048
            +++Y+ +  +L  F  ++  RQY+G PI C V +      + Y    CWI ST+ +      +   D+ +     H      +KY  YYQWV  V+  QAI+ Y+P  +W+ W      +L     + I + E +    + +V                  G   R+ F+ F         F     L  +N IGQIY +  F+    + +G    SD+LK  E +           FP++T CT +  K+G      +H   CVLP+N   EKIYVFLW WF
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------IGNLNRHNFYAFR--------FFVCEALNFVNVIGQIYFVDFFLDGEFSTYG----SDVLKFTELEPDERIDPMARVFPKVTKCTFH--KYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF 275          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 92.0485 bits (227), Expect = 6.289e-20
Identity = 80/283 (28.27%), Postives = 123/283 (43.46%), Query Frame = 2
Query:  257 QLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKL------LDNEDIPEDDFEIH-----SLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGN-------FPRITYCTINVRKFGQIKQA-SHTFQCVLPINHFVEKIYVFLWLWF 1048
            +++Y+ +  +L  F  ++  RQY+G PI C V +      + Y    CWI ST+ +      +   D+ +     H      +KY  YYQWV  V+  QAI+ Y+P  +W+ W      +L     + I + E +    + +V                  G   R+ F+ F         F     L  +N IGQIY +  F+    + +G    SD+LK  E +           FP++T CT +  K+G      +H   CVLP+N   EKIYVFLW WF
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYF--------------IGNLNRHNFYAFR--------FFVCEALNFVNVIGQIYFVDFFLDGEFSTYG----SDVLKFTELEPDERIDPMARVFPKVTKCTFH--KYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF 275          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112570)

HSP 1 Score: 82.0333 bits (201), Expect = 1.297e-16
Identity = 74/265 (27.92%), Postives = 112/265 (42.26%), Query Frame = 2
Query:  317 RQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLD------NEDIPEDDFEIH--------SLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEG--TEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGN-----FPRITYCTINVRKFGQIKQAS-HTFQCVLPINHFVEKIYVFLWLW 1045
            RQYVG PI C   +      E+     CWI STY ++D        ++P     +H        ++K+  YYQWVA  +  QAI+ Y P  +W+ W                         I  ++  L+ G  +EA+ + ++        Y++            +     L ++N IGQ++LM  F       FG+KVI  +    E  D  +     FPR+T CT    K+G   +   H   C+LP+N   EKIY+FLW W
Sbjct:   33 RQYVGNPIDCVHTRDIP---EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPG--VHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWE---------------------GGKIHALIMDLDIGICSEAEKKQKKKL---LLDYLWENLRYHNWWAYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQE--DRMDPMIYIFPRMTKCTFF--KYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 9.241e-75
Identity = 132/369 (35.77%), Postives = 215/369 (58.27%), Query Frame = 2
Query:  239 DIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPI----LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAED 1333
            D D +D+LNY Y+T ++ +F  ++  +QYVG PIQCWVP  FT+  E+Y EN CW+Q+TY L  ++ IP +  E  + + I YYQWV  V+  +A++ Y+P ++WRL S +  I    L++ A ++ + D E R +A+Q I T +EE    + +   G        +    +    +T L++ V+ L+ +N +GQI+L+  F+   + W+G++V++DL+ G EW++ G+FPR+T C   V+  G + +  HT QCVL IN F EKI++FLW W+ LLA  T  +   W  I  +P +Q  F+ +YL  ++     + +  +RFV   L  DG+F+L+ V+  + +L   ++  TLW NY   K     D
Sbjct:   20 DDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHR--HTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHD 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.595e-59
Identity = 121/383 (31.59%), Postives = 211/383 (55.09%), Query Frame = 2
Query:  203 IGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWR---LWSKRLPI--LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTR--------LTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKAL---KLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY 1303
            +   F   Y   D DFVD+LNY Y+T +L  F  ++  +QYVG PIQCWVP  FT + E+Y EN CW+Q+TY +   EDIP + +   + + I YYQWV  ++  +A++ Y+P ++WR    W   + +  L++ A +A + D E++ + +  +   +++  +     R+G     +R  F                +T+L++ ++ L+  N + Q +L+ + + +N+  +G  ++ DL+   EW+  G FPR+T C   VR  G I +  HT QCVL IN F EKI++FLW WF    ++T  NT+ W LI+ +P +   F+++YL+ L        ++    ++F    L  DG+F+L+ +S  + +L++ ++   LW ++
Sbjct:  126 LASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRN-RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGH----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHR--HTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDF 501          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.063e-52
Identity = 122/386 (31.61%), Postives = 205/386 (53.11%), Query Frame = 2
Query:  191 TFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIP--EDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSK----RLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTR-LTILFLFVRTLFILNNIGQIYLMKNFIKTN-NTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISN-------SEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY 1303
            TFL + K+        D D+ D+LNY  +  +L  F  +I F+Q+ G+PI+C  P +F  SWE+YAEN CW Q TY +   +D+   + +      + +SYYQWV   +  QA     P  +W+ +S     R+  +++ A++++  + E+R K I  +   L      Q    R +  +     F  F  S+  ++ ++LF + L+ LN   Q+YLM  F+ TN + W+G  V+ D+++G  W+  G FPR   C   VR+   I++  ++ QCVL IN F EKI+V LW W+ +L + +T++ +QW +++  P     F++++L AL  + N        E  +  +FV + L  DG+FVL+ VS  +  + A D+   L+  Y
Sbjct:    6 TFLGMAKYLSPR---EDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQR--YSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHL-ALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 9.692e-52
Identity = 119/380 (31.32%), Postives = 198/380 (52.11%), Query Frame = 2
Query:  251 VDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPI----LLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYV----FFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVAR--------------NLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY--RQAKL 1318
             D+LNY YST ++      I  RQYVG P+QCWVP QFTK+WE+YAE+ C++ +TY +  N+ +P    E  S + I YYQW   +M  +A   YLP + W + S +  I    L++TA++A   + E R K I  I   +       +R RR E    T+       F       +T ++L  + +++ N+  Q Y    F+  N+ ++G++++ D+LKG +W+  GNFPRI  C   VR  G +++  ++ QCVL +N F EKI++FL++WF L+  +T  +++     +    K  +F+Q++L       N E +  +R V R                  D I +L+ ++  + D++  ++   +W  +  R AKL
Sbjct:   20 TDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQLI-YYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNN----LRKRRNEEET-TKMAKIQRIFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLGNLQR--YSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAKL 391          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 1.007e-49
Identity = 117/389 (30.08%), Postives = 193/389 (49.61%), Query Frame = 2
Query:  209 KHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLL------DNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAI--QCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGREC---QRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNY--RQAKLNGAEDD 1336
            + F  +   NDI   D+ +YQY++ LL     ++   QYVG+PIQCWVP QFT++WE+YAE  C+I+ TY L           +   D  + +   + YYQW+ IV+  QA + YLP +IWR +++   + +K     S   R++++     Q   TK       ++ +R   P +F +           L  L+L V+ L++ N + Q +++  F++T +  +G +   DL+ G EW+  G FPR+T C  ++     +    H+ QCV+ IN   EK+YVF W W   + +LT  +   W +I  L      FI  YL+        + R       FV + L  DG+F+ + V + S DL    +   +++ Y  R+A+    +DD
Sbjct:   10 RKFQRSAESNDI--ADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNFRNESP-VF-KETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTSVHD--HSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYRAREAEKAHKKDD 392          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M9 (Innexin OS=Dugesia japonica OX=6161 GN=inx5 PE=2 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 7.524e-173
Identity = 247/393 (62.85%), Postives = 321/393 (81.68%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMET 1357
            ME+  F +IG+ F   YGG  +DFVDQLNYQ+++GLL +FI IIG RQYVGKPIQCWVPQ+FT+SWEEYAEN+CW+Q+TY LL +ED+P +++E+  ++YISYYQWVAIV+ GQA+MS++PHLIWR+WS+R+PILL++AREAS PDRE+R KAI C+V  LEE TE+  R+R+ + GIF +      NP+ R+T+LF+FVR LFI NNIGQI++MK FI TN T FGI V  DLL G E +    FPR+TYCTI VRK GQ+K  S+T QCVLPIN+FVEK+YVFLW WF +L++LTTLNT+QW L VC+P ++ QFI++YLKALK+I++++ R+C RFV +NLGCDGIF+LQ+VS++SSDLIALDVT TLW NY++AKL G EDDI R +++
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNEYELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIK-GIFGK-CLGGVNPTARVTLLFIFVRLLFIANNIGQIFMMKKFIGTNETTFGITVFRDLLDGNEGQISATFPRVTYCTIKVRKMGQVKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCVPLRRVQFIRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDS 391          
BLAST of Innexin vs. TrEMBL
Match: C1LEY2 (Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE=2 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 9.241e-168
Identity = 237/396 (59.85%), Postives = 315/396 (79.55%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFN---PSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMET 1357
            M+ N  LK+G+ F   YGG  +DFVDQLNYQ+++G++ +FI +IGFRQYVGKP+ CWVPQ+FT SWE+YAEN+CW+Q+TY LL NE IPEDDFE+  +++ISYYQWVAI++ GQA+M+++PH++WR+WSKR+P+LLK AREA++PD+E+R KAI C+V  LEE +EA  RYRR   GIF R    C     P+TR+T+LFL VR  FI NNIGQIY+MK+FI TN+T FG+ V  +LL G EW+  G FPR+TYC + VRK GQ+K AS+T QCVLP+N+F+EK+Y+FLW W+ L+A LT LNT  W   +CLP+++ QFI++YLKALK +S++E  EC RFV  NLGCDGIF+LQAVSK+SSDLI LDVT  LW+NY++AK+ G E++I R++E+
Sbjct:    1 MDANNALKLGRLFRVPYGGEGVDFVDQLNYQFTSGIIVLFIVMIGFRQYVGKPLHCWVPQEFTSSWEDYAENICWVQNTYFLLPNEAIPEDDFEMLRVRHISYYQWVAIILAGQAMMAWIPHVLWRVWSKRVPVLLKNAREAAVPDKEVRHKAISCLVAALEEISEASKRYRRAR-GIFQR----CLGGPPPTTRITLLFLIVRVFFIANNIGQIYVMKHFIGTNDTLFGLHVFQELLVGSEWEVSGLFPRVTYCDVKVRKLGQLKPASYTLQCVLPVNYFIEKVYIFLWFWYILMACLTILNTFLWITKLCLPYRRVQFIRQYLKALKQLSHTEETECARFVNNNLGCDGIFLLQAVSKISSDLIVLDVTGMLWSNYQRAKITGTEENIGRFIES 391          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0R9P5 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 2.781e-167
Identity = 238/396 (60.10%), Postives = 317/396 (80.05%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFN---PSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMET 1357
            M+    LK+ + FH AYGG  +DF+DQLNYQ+S+G+L +FI +IGFRQYVGKP+ CWVPQ+FT SWE+YAENLCW+Q+TY LL NE IPE++FE+  +K+ISYYQWVAIV+ GQA+MS++PH+ WR+WSKR+P+LL+ AREA+IPD+E+R KAI C+V  LEE +EA  R+RR   G+F R    C     P+T +T+LFLFVR  FI+NNIGQIY+M+ FI TN+T+FG+ V  +LL G +W+  G FPR+TYC + VRK GQ+K AS+T QCVLP+N+F+EK+YVFLW WF L+A LT+LNTLQW   VC+P+++  FI++YLKALK +S++E  EC RFV  +LGCDG+F+LQAVS++SSDLI LDVT  LW+NY++AK+ G E DITR++E+
Sbjct:    1 MDPGGALKLSRFFHVAYGGEGVDFIDQLNYQFSSGILVMFIVMIGFRQYVGKPLDCWVPQEFTSSWEDYAENLCWVQNTYFLLPNEAIPEEEFEMLKVKHISYYQWVAIVLAGQAMMSWIPHICWRVWSKRVPVLLRNAREAAIPDKELRHKAISCLVAALEELSEASKRFRRTR-GVFKR----CLRGAPPTTHITLLFLFVRLAFIVNNIGQIYIMRKFIGTNDTFFGLHVFQELLTGSQWEVSGLFPRVTYCDVKVRKLGQLKPASYTLQCVLPVNYFIEKVYVFLWFWFILIAGLTSLNTLQWIFNVCVPFRRVYFIRQYLKALKQLSHTEETECARFVNSDLGCDGVFLLQAVSRISSDLIVLDVTGMLWSNYQRAKITGTEGDITRFIES 391          
BLAST of Innexin vs. TrEMBL
Match: A0A5K4F4I8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 1.221e-165
Identity = 241/386 (62.44%), Postives = 307/386 (79.53%), Query Frame = 2
Query:  200 KIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMET 1357
            K+G+ F T YGG  +DF+DQLNYQ++ GL+ IFI+II FRQYVGKPIQCWVPQ+FTKSWEEYAENLCW+ +TY LL NE+IP D  +   +K+I YYQWVAIV+ GQA+MS++PHL+WR+ S+RLP+LLK+AREA+IPDRE+R KA+ C+V  LEE  E+Q R+RR +  I TR       P+ RLT+LFLFVR LF+ N++GQIYLMK F   N+T FG++++ DL  G EW+  G+FPR+TYCTI VRK GQ K AS+T QCVLPIN+F EKIYVFLW WF +L +LTTLNTLQW L   LP ++ ++I++YLKAL+LIS++E R+C RFV  NLG DG+F+L  VSK++SDLIALDVTATLW NYRQAK+ G E+D+ R +ET
Sbjct:   16 KLGRLFKTPYGGEGVDFIDQLNYQFTGGLMVIFIAIISFRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVAIVLAGQAMMSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIK-SILTR-CLCGVTPNARLTMLFLFVRALFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGLLTTLNTLQWALNTILPSRRVRYIKQYLKALRLISSTEERDCARFVNNNLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLET 399          
BLAST of Innexin vs. TrEMBL
Match: A0A068WK09 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 482.641 bits (1241), Expect = 3.230e-165
Identity = 229/392 (58.42%), Postives = 309/392 (78.83%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYME 1354
            M   + L+ GK F T+YGG+ +DF+DQLNYQY+ GL+ IFI+IIG RQYVGKPIQCWVPQ+F   WEEYAENLCWIQ+TY LL NED+PEDDFE+H +KY+ YYQW+ IV+ GQA++S++P+LIWR+ SKRLPILL++AREA+IPDRE+R KA+ C+V  LEE +E+  R +R +  +  + +F    P+  +T+LF FVR LFI N++GQIYLMK+FI +N+++FGI ++++L+ G +W+  G FPR+TYCT+NVRK GQIK AS+T QCVLPIN+FVEKI+VFLW WF LL   T  +TLQW     +P ++  +I++Y++A++ +SN+E R+C RFV  NLG DG+ +LQ VS+ SSDLIALDVTATLW NYR AK+ G E+D +R++E
Sbjct:    1 MNPESVLRAGKLFQTSYGGDGVDFIDQLNYQYTGGLMVIFIAIIGVRQYVGKPIQCWVPQEFKHPWEEYAENLCWIQNTYFLLPNEDVPEDDFELHRVKYVGYYQWIVIVLAGQAMLSWVPYLIWRVGSKRLPILLRSAREAAIPDRELRQKAVSCLVATLEEISESTARQKRVKSSL--KRIFCSIRPNVEITLLFFFVRCLFIGNSVGQIYLMKHFIGSNSSYFGIDMLNNLIAGRDWETTGQFPRVTYCTVNVRKMGQIKPASYTLQCVLPINYFVEKIFVFLWFWFLLLGAFTAFSTLQWAFNTLVPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRASSDLIALDVTATLWNNYRHAKITGTEEDFSRFIE 390          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 402/402 (100.00%), Postives = 402/402 (100.00%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV 1384
            METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV
Sbjct:    1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV 402          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 504.982 bits (1299), Expect = 1.610e-177
Identity = 249/393 (63.36%), Postives = 321/393 (81.68%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMET 1357
            ME+  F +IG+ F   YGG  +DFVDQLNYQ+++GLL +FI IIG RQYVGKPIQCWVPQ+FT+SWEEYAEN+CW+Q+TY LL +ED+P +DFE+  ++YISYYQWVAIV+ GQA+MS++PHLIWR+WS+R+PILL++AREAS PDRE+R KAI C+V  LEE TE+  R+R+ + GIF +      NP+ R+T+LF+FVR LFI NN+GQI++MK FI TN T FGI V  DLL G E +    FPR+TYCTI VRK GQIK  S+T QCVLPIN+FVEK+YVFLW WF +L++LTTLNT+QW L VCLP ++ QF+++YLKALK+I++++ R+C RFV +NLGCDGIF+LQ+VS++SSDLIALDVT TLW NY++AKL G EDDI R +++
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIK-GIFGK-CLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDS 391          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 477.248 bits (1227), Expect = 2.351e-166
Identity = 230/402 (57.21%), Postives = 311/402 (77.36%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV 1384
            ME+    KIG+ F T YGG  +DF DQLNYQ+++GL+ IFI+I+  RQYVGKPIQCWVPQ+FTK+WEEYAENLCW+ +TY LL +++IP DD E  ++KYISYYQW+ IV+ GQA++S++PHL WR+ S+RLP+LL++AREA +PDR++R KA+ C+V  LEE  +A +R RR + GIF R       P+TRLT+LF+ VR +FI N +GQIYLM+ F+ +NN  FG  ++ DLL G +W+  GNFPR+TYCTI VR+ GQ+KQAS+T QCVLPINHF+EK+YVFLW WF L+A +T L+TLQW     LP K+  ++++YLKA++LI+++E R+C RFV  NLG DG+F+L  VS  +SDLI+LDVTATLW N+RQAK+ G E+D++R +ET  +   +IV
Sbjct:   12 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVK-GIFRR-CLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 411          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000027007.1 (SMESG000027007.1)

HSP 1 Score: 422.55 bits (1085), Expect = 4.527e-145
Identity = 217/402 (53.98%), Postives = 298/402 (74.13%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV 1384
            M    FLKI + F   YGG D+DFVDQLNYQ+++GLL +F+ IIGFRQY+GKPIQCWVPQ+FTK+WEEYAENLCW+Q+TY L   EDIP  D E++ +KYISYYQWVAIV+ GQA+MS++P+L+WRL+S+++ +LL +A+EASIPD  +R KA+  +V  LEE ++   ++ + + GI  RY+    NP+ R+T +F+ VR LF+ N  GQI +M+ FI +++  FG  V   LL+ ++W+    FPR+TYCT+ VRK GQ++  S+T QCVLP+N+FVEK+YVFLW WF +L VLTT++T QW   VC+P  + QFI++YLKALK+IS  E ++C RFV + LGCDGIF+L +VSK+SSDLIALDV   LW N++ AK  G E D+   ++ S+    N+V
Sbjct:    1 MNAGIFLKIIRFFKVPYGGADVDFVDQLNYQFTSGLLAVFVIIIGFRQYMGKPIQCWVPQEFTKAWEEYAENLCWVQNTYFLSPEEDIPRTDVELNKMKYISYYQWVAIVLSGQALMSWIPYLVWRLFSQKVIVLLNSAKEASIPDWSVRRKAVSYLVNALEEQSQINNQFYKRK-GIVRRYLT-EINPAYRITFIFIVVRILFVTNCFGQIIIMRIFIGSSDFMFGYNVFQYLLRNHQWQISETFPRVTYCTVKVRKLGQLRPGSYTLQCVLPVNYFVEKVYVFLWFWFIILGVLTTISTAQWIANVCIPPWRVQFIRQYLKALKVISGPEEKDCNRFVNKKLGCDGIFLLHSVSKLSSDLIALDVAGHLWQNFKMAKSQGNEVDLNNLIQ-SIHRGPNVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000032206.1 (SMESG000032206.1)

HSP 1 Score: 396.356 bits (1017), Expect = 5.383e-135
Identity = 193/389 (49.61%), Postives = 274/389 (70.44%), Query Frame = 2
Query:  179 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTXXXXXXXXXXXXRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFC-FNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFXXXXXXXXXXXXQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDIT 1342
            M++++ LK+G+ F +  GG+ + F+D LNYQYS+ +L +FI+IIG RQY+GKPIQCWVPQ+FT++WE+YAEN+CW+Q+TY L   + +P+ D E+HS ++ISYYQW+ IVMG QA++ YLP +IWR+ S+R P+LL+ ++EA +PDRE+R KA+ C+V  LEE      R+R+    I   Y   C   P   L                 Q+YLM++F+ TN+T FG+ +  D+L G++WK  G+FPR+T+C + +RK GQIK A +T QCVLPIN+FVEKIY FLW WF  LA  T+ NTLQW + + +  +Q  F+  YLKALK +S++E R+C RFV   LG DGIF+L+AV+ V+SDL+ALDVT  +W NY+ AK+ G E+D+ 
Sbjct:    1 MDSDSILKLGRIFRSPLGGDGVSFIDVLNYQYSSAVLVVFIAIIGTRQYIGKPIQCWVPQEFTRAWEDYAENICWVQNTYFLPPEKAVPDSDVELHSAEFISYYQWIVIVMGAQAVLCYLPQIIWRVGSRRFPVLLRNSKEAILPDRELRRKAVACLVAALEEQAIRNCRFRKNNSTI---YKLLCGLGPGAELR----------------QLYLMRDFLGTNHTTFGVMIFQDILAGHDWKVSGHFPRVTFCPVEIRKMGQIKPAIYTLQCVLPINYFVEKIYAFLWFWFVSLACATSFNTLQWFIDLFVKNRQVVFVSNYLKALKQLSSTEERDCGRFVEVVLGNDGIFLLRAVANVASDLMALDVTGIMWRNYKHAKVTGTEEDMA 370          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-14.833e-7735.64Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-14.833e-7735.64Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-16.118e-7635.19Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-97.265e-7635.77Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-136.128e-6735.31Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx26.289e-2028.27gene:FBgn0027108 transcript:FBtr0301860[more]
Inx26.289e-2028.27gene:FBgn0027108 transcript:FBtr0071005[more]
Inx26.289e-2028.27gene:FBgn0027108 transcript:FBtr0332314[more]
Inx26.289e-2028.27gene:FBgn0027108 transcript:FBtr0071006[more]
shakB1.297e-1627.92gene:FBgn0085387 transcript:FBtr0112570[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL9.241e-7535.77Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.595e-5931.59Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL2.063e-5231.61Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q27295|EAT5_CAEEL9.692e-5231.32Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23027|INX5_CAEEL1.007e-4930.08Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6M97.524e-17362.85Innexin OS=Dugesia japonica OX=6161 GN=inx5 PE=2 S... [more]
C1LEY29.241e-16859.85Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE... [more]
A0A4E0R9P52.781e-16760.10Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A5K4F4I81.221e-16562.44Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A068WK093.230e-16558.42Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051126.10.000e+0100.00SMESG000051126.1[more]
SMESG000033444.11.610e-17763.36SMESG000033444.1[more]
SMESG000068735.12.351e-16657.21SMESG000068735.1[more]
SMESG000027007.14.527e-14553.98SMESG000027007.1[more]
SMESG000032206.15.383e-13549.61SMESG000032206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019050 ID=SMED30019050|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1532bp
CTTAAAATAGGTTTTCCGATTAAATAAATTTATTTGTTTCTTGGATATAT
TTTGGAAAATTAAAATGGAATTTTATTTTAAAAATTCAAATAAGATTCAG
TTCAATAAATCTTTTCAATTGATAAATAAATTCCAGGAATAAATTTGATT
TTTAGATTTGTTTTGCCACATCTTTCGAATGGAAACCAATACATTTTTAA
AAATTGGAAAACATTTTCATACAGCCTATGGAGGAAATGACATTGACTTT
GTGGATCAGTTAAACTATCAGTATAGTACAGGATTATTATTTATTTTTAT
CAGCATTATTGGATTCAGACAATATGTCGGTAAACCTATTCAGTGTTGGG
TGCCTCAACAATTCACAAAGTCATGGGAAGAATATGCAGAAAACCTTTGC
TGGATACAGAGCACTTATAAGCTTCTTGACAATGAAGATATCCCAGAAGA
TGATTTTGAAATTCATTCACTAAAATATATAAGTTATTACCAATGGGTGG
CCATTGTTATGGGAGGACAAGCCATAATGAGTTATCTTCCTCATTTGATT
TGGAGATTATGGTCTAAACGATTGCCGATTCTTTTAAAGACTGCTCGCGA
AGCCTCTATTCCAGACAGGGAAATGAGAGCAAAAGCTATTCAGTGCATCG
TTACGAAGTTAGAAGAGGGTACTGAAGCTCAAATCAGATATAGACGAGGT
GAACCAGGAATATTTACCCGATATGTTTTCTTTTGTTTCAACCCATCGAC
TAGATTGACAATTCTATTTCTTTTTGTCAGAACATTATTTATTTTAAATA
ATATTGGACAGATTTATCTAATGAAAAACTTTATCAAAACAAATAACACT
TGGTTTGGAATAAAAGTGATTTCCGATTTATTAAAAGGTTATGAATGGAA
AGATTACGGAAATTTTCCTCGAATTACATATTGCACGATAAATGTCAGAA
AGTTTGGACAAATTAAACAAGCAAGTCATACATTCCAGTGTGTCCTGCCT
ATAAATCATTTTGTCGAGAAAATCTATGTTTTTCTTTGGTTATGGTTCAC
CTTATTAGCGGTTCTGACCACTCTTAACACTTTACAATGGGGCCTCATTG
TTTGCCTTCCTTGGAAACAAACGCAATTTATTCAGAGATATCTCAAAGCT
CTTAAGTTAATTTCCAACTCAGAGGGTCGAGAATGTCAAAGATTTGTAGC
AAGAAATCTCGGTTGTGATGGTATATTTGTCCTTCAAGCTGTGAGTAAAG
TTTCCAGTGACTTAATTGCTCTCGATGTCACGGCAACATTATGGACGAAC
TATAGACAAGCTAAACTTAACGGTGCCGAAGATGACATAACAAGATACAT
GGAGACCTCATTGAAAACAAATTTAAATATTGTTTAACTCTAGAAAACAA
AAACAAAAAAAATGTTTTAGCTCAAAAATATTTATAGATATTTAATTATA
TTTGAATTATTTATTATGATATTTTATTAATTAGAACTTTTAGAAAATTC
TGATAAATATGATTATGAAATTTTTACTCGAC
back to top

protein sequence of SMED30019050-orf-1

>SMED30019050-orf-1 ID=SMED30019050-orf-1|Name=SMED30019050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYV
GKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKY
ISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMR
AKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFV
RTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRIT
YCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLN
TLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIF
VLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLN
IV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 245..254
score: 50.4
coord: 45..56
score: 53.67
coord: 73..82
score: 43.2
coord: 197..211
score: 28.27
coord: 271..287
score: 62.12
coord: 103..125
score: 44.87
IPR000990InnexinPFAMPF00876Innexincoord: 23..375
e-value: 7.9E-103
score: 344.4
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 13..386
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..381
score: 30.949
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 193..215
NoneNo IPR availableTMHMMTMhelixcoord: 27..46