Synaptic vesicle 2-related protein

Overview
NameSynaptic vesicle 2-related protein
Smed IDSMED30019041
Length (bp)2122
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptic vesicle 2-related protein (SMED30019041) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptic vesicle 2-related protein (SMED30019041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptic vesicle 2-related protein (SMED30019041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptic vesicle 2-related protein (SMED30019041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019041SMESG000019460.1 dd_Smed_v4_3645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019041SMESG000019460.1 dd_Smed_v4_3645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019041SMESG000019460.1 dd_Smed_v4_3645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019041SMESG000019460.1 dd_Smed_v4_3645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019041SMESG000019460.1 dd_Smed_v4_3645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019041SMESG000035457.1 dd_Smed_v4_59_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019041SMESG000035457.1 dd_Smed_v4_59_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019041SMESG000035457.1 dd_Smed_v4_59_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019041SMESG000035457.1 dd_Smed_v4_59_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019041SMESG000019460.1 Contig45292uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019041SMESG000019460.1 Contig45292newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30019041SMESG000035457.1 dd_Smed_v6_59_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30019041SMESG000035457.1 dd_Smed_v6_59_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019041SMESG000035457.1 dd_Smed_v4_59_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOP (SV2 related protein [Source:HGNC Symbol;Acc:HGNC:25417])

HSP 1 Score: 363.614 bits (932), Expect = 5.281e-117
Identity = 197/464 (42.46%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VF+G    S  WG +SD YGRKT   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  +RAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS+VP++L AVL  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  +++LF   +R T LLL  +WF   FSYYG+VLL  E F   + C  +S     E + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     T+L+F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + L VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLA------CEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQES 520          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 303.138 bits (775), Expect = 1.709e-94
Identity = 163/461 (35.36%), Postives = 269/461 (58.35%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            T+T+E AVET G G F + L +++G     +AME++L++++ P ++CEW L + Q AL+TT+VF G+ + S  +G+++D YGR    LI     +Y   +TSF+P+YIW + LR  VG G+ G +    +  EFLP+  R  +L   QVFW  GS   +GLA  ++P  GWRW++ ++S+P I+  V   F+PES RF ++ G    +   + ++  +N   + +G+L+     ++    +L   +Y  T L + ++W G++F+YYG++L +AE       C   S +A     G+     + C C      DY++M++S+ GE  + P+N   ++ +GR+ +++ ++  T+ FFLLL  C         +F +R   +  FN  YIYT+EV+PT++R+   G   S  RI A++ PF++QVL+   S++  L ++SSV  VC IS   LPIETKGRA+ Q
Sbjct:   31 TFTVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 201.06 bits (510), Expect = 6.824e-58
Identity = 114/338 (33.73%), Postives = 189/338 (55.92%), Query Frame = 1
Query:  946 AASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            AA    +  EFLP+  R  +L   QVFW  GS   +GLA  ++P  GWRW++ ++S+P I+  V   F+PES RF ++ G    +   + ++  +N   + +G+L+     ++    +L   +Y  T L + ++W G++F+YYG++L +AE       C   S +A     G+     + C C      DY++M++S+ GE  + P+N   ++ +GR+ +++ ++  T+ FFLLL  C         +F +R   +  FN  YIYT+EV+PT++R+   G   S  RI A++ PF++QVL+   S++  L ++SSV  VC IS   LPIETKGRA+ Q
Sbjct:    2 AAGRLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 201.06 bits (510), Expect = 6.824e-58
Identity = 114/338 (33.73%), Postives = 189/338 (55.92%), Query Frame = 1
Query:  946 AASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            AA    +  EFLP+  R  +L   QVFW  GS   +GLA  ++P  GWRW++ ++S+P I+  V   F+PES RF ++ G    +   + ++  +N   + +G+L+     ++    +L   +Y  T L + ++W G++F+YYG++L +AE       C   S +A     G+     + C C      DY++M++S+ GE  + P+N   ++ +GR+ +++ ++  T+ FFLLL  C         +F +R   +  FN  YIYT+EV+PT++R+   G   S  RI A++ PF++QVL+   S++  L ++SSV  VC IS   LPIETKGRA+ Q
Sbjct:    2 AAGRLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 188.348 bits (477), Expect = 8.504e-53
Identity = 105/313 (33.55%), Postives = 177/313 (56.55%), Query Frame = 1
Query: 1021 VFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            VFW  GS   +GLA  ++P  GWRW++ ++S+P I+  V   F+PES RF ++ G    +   + ++  +N   + +G+L+     ++    +L   +Y  T L + ++W G++F+YYG++L +AE       C   S +A     G+     + C C      DY++M++S+ GE  + P+N   ++ +GR+ +++ ++  T+ FFLLL  C         +F +R   +  FN  YIYT+EV+PT++R+   G   S  RI A++ PF++QVL+   S++  L ++SSV  VC IS   LPIETKGRA+ Q
Sbjct:   59 VFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLM-SASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 370          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 322.783 bits (826), Expect = 4.298e-102
Identity = 189/468 (40.38%), Postives = 269/468 (57.48%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKT--TFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISS---GKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQA--STTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAM 1950
            +  T+T+++AVE  G G FQLKL ++ G+   ADAMEM+LLS++ PAL CEW +SS Q+AL+TT VF G  + S FWG + D +GR+   TF  +++ I   G I+  SP +  ++  R   GFGIGG   S TL  EFLP+A RAK ++  + FWA G+ FE  LAYFV+  +GWR ++ LSS+P+ + AV   +LPES RF +  G  E++ + +     +N  QL  GRL+SS   G   +  I NL   + R T +LL  +W    FSYYG+VL     F  H+ C+    S     E            C+ L   DY  +L ++  EF  + I   +++  GRK TMA    + + F  LLY C+     TVL+F  R   SG F   Y+YT EV+PT++R+   G CS+ ARI AI+TPF+AQV   + S+ + + +Y + A +  I+   LPIETKGR M
Sbjct:   63 SEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACI--MGVISGMSPHFYVLLFFRGLTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDECHGGLFSNGTQME-----------VCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQV-ASEKSLSLPIGIYGTAAILGLIASLSLPIETKGRQM 516          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 322.783 bits (826), Expect = 4.298e-102
Identity = 189/468 (40.38%), Postives = 269/468 (57.48%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKT--TFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISS---GKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQA--STTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAM 1950
            +  T+T+++AVE  G G FQLKL ++ G+   ADAMEM+LLS++ PAL CEW +SS Q+AL+TT VF G  + S FWG + D +GR+   TF  +++ I   G I+  SP +  ++  R   GFGIGG   S TL  EFLP+A RAK ++  + FWA G+ FE  LAYFV+  +GWR ++ LSS+P+ + AV   +LPES RF +  G  E++ + +     +N  QL  GRL+SS   G   +  I NL   + R T +LL  +W    FSYYG+VL     F  H+ C+    S     E            C+ L   DY  +L ++  EF  + I   +++  GRK TMA    + + F  LLY C+     TVL+F  R   SG F   Y+YT EV+PT++R+   G CS+ ARI AI+TPF+AQV   + S+ + + +Y + A +  I+   LPIETKGR M
Sbjct:   63 SEKTFTVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACI--MGVISGMSPHFYVLLFFRGLTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDECHGGLFSNGTQME-----------VCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQV-ASEKSLSLPIGIYGTAAILGLIASLSLPIETKGRQM 516          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: oct-2 (Organic Cation Transporter [Source:UniProtKB/TrEMBL;Acc:Q23501])

HSP 1 Score: 99.3673 bits (246), Expect = 5.613e-22
Identity = 104/409 (25.43%), Postives = 178/409 (43.52%), Query Frame = 1
Query:  769 IGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLC-EFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKG----RLISSGKVQKFSIKNLFLQEYRCTFL-----LLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCK---ELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            +G+ +G F  G +SD YGRKT       L    GF+ ++S  +   +++R  +      A  +  +LC E   +  R+ V    Q  WACG  F   +AY       W  I  +  +  I+  +L+ FLPESPR+L+   K ++++KII +    N  +L       R     K  K + K  +   +R + L     +L I+W      YYG+V+  ++  +     +  +   N    G +       C     +G +  + ++L   G F +       V ++ RK +                       A + M   + C  G FN+ YI+TSE+ PT VR+SA G+ S  AR+ A  + ++A +L   T  +V + +++  + +    V  LP ET+G  +P 
Sbjct:   28 LGYLVGCFVGGFISDRYGRKTAITGFGILTMLFGFLLTYSKEFEIFLVVRFLLAATNEAADLAAYVLCMEVTGTKYRSIVGSLIQAPWACGYAFLALIAYLT---KSWTMIHLICVLLHIISLMLLYFLPESPRWLILNNKTKQAEKIIREACHYNKSRLPSDLGLVRHAEKKKWMKHNEKPSYFHLFRSSELRFRNVVLFIVWIATALVYYGMVIALSDQSSPGRRVFDGNFFLNNAMAGAIELPTLVFCVFLLRMGRKRSQMLVLFGSGLFLLTS-----VVMVYRKQSTL---------------------ALIFMLLSKACIQGSFNILYIFTSELNPTVVRNSAVGISSMVARMGAGASGYIA-ILSDVTMPLVPMTIFACFSLLAGCLVLLLP-ETQGLPLPD 405          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: oct-2 (Organic Cation Transporter [Source:UniProtKB/TrEMBL;Acc:Q23501])

HSP 1 Score: 100.138 bits (248), Expect = 1.525e-21
Identity = 113/462 (24.46%), Postives = 198/462 (42.86%), Query Frame = 1
Query:  619 WFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQ---KALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLC-EFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKG----RLISSGKVQKFSIKNLFLQEYRCTFL-----LLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCK---ELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            W Q+K +   G ++     E    S++   +  EW+   +    +A +     +G+ +G F  G +SD YGRKT       L    GF+ ++S  +   +++R  +      A  +  +LC E   +  R+ V    Q  WACG  F   +AY       W  I  +  +  I+  +L+ FLPESPR+L+   K ++++KII +    N  +L       R     K  K + K  +   +R + L     +L I+W      YYG+V+  ++  +     +  +   N    G +       C     +G +  + ++L   G F +       V ++ RK +                       A + M   + C  G FN+ YI+TSE+ PT VR+SA G+ S  AR+ A  + ++A +L   T  +V + +++  + +    V  LP ET+G  +P 
Sbjct:  264 WAQVKDMNATGKINRCKEWE-YDTSVMDRTIVTEWNRVCDNNWSRAHVHMSYSLGYLVGCFVGGFISDRYGRKTAITGFGILTMLFGFLLTYSKEFEIFLVVRFLLAATNEAADLAAYVLCMEVTGTKYRSIVGSLIQAPWACGYAFLALIAYLT---KSWTMIHLICVLLHIISLMLLYFLPESPRWLILNNKTKQAEKIIREACHYNKSRLPSDLGLVRHAEKKKWMKHNEKPSYFHLFRSSELRFRNVVLFIVWIATALVYYGMVIALSDQSSPGRRVFDGNFFLNNAMAGAIELPTLVFCVFLLRMGRKRSQMLVLFGSGLFLLTS-----VVMVYRKQSTL---------------------ALIFMLLSKACIQGSFNILYIFTSELNPTVVRNSAVGISSMVARMGAGASGYIA-ILSDVTMPLVPMTIFACFSLLAGCLVLLLP-ETQGLPLPD 693          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: F45E10.2 (pep chromosome:WBcel235:II:11052140:11054578:-1 gene:WBGene00009729.1 transcript:F45E10.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F45E10.2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.620e-17
Identity = 95/434 (21.89%), Postives = 179/434 (41.24%), Query Frame = 1
Query:  718 EWHLSSEQ---KALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGF---GIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKG---------RLISSGKVQKFSIKNLF-LQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRK---GTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAF-VCFISVACLPIETKGRAMPQN 1959
             W +  +    +A +  + FIG  +GSF  G+++D  GRK      + L      +   +PT+    +L+   GF   GI G A    L  E +    R+ + +   VF   G      +AYF++    +R +    ++P ++       + ES R+L++  K + +  ++      N K + K           + ++ K   F + +L    + R   +   ++W   T  YYG+ +                       R ++           G   + + + S   E   + I   L+D +GR+        +  +      L +  +P  +A +++   +G  S  + V Y YTSE+FPT +R++A G CS+ AR  AI   F+A  L+ +   IV ++ ++ +A     +S   LP ET  + +P +
Sbjct:  101 RWEMDGDNGWIRATVQAVYFIGQMIGSFTCGVMADKIGRKKVLFWCLVLQVVCALLLIVAPTWWIYAILKAGTGFTQPGIYGVA--VVLGIELVGKKYRSFIAVIANVFGVIGGVLLAVMAYFIV---DYRLLHASIAIPSLIFITYYWMIHESARWLVSQEKYDDANVVLCATANWNKKTIPKNWAEKIEKKMDVTATKKKDSFGVFDLIRTPQMRKRTIANFVMWPVTTMMYYGLTM-----------------------RSDVG----------GGSLFVTFVTSQLMELPAVIIVALLIDRLGRRIMYSGAIFTAGMLLLASWLTHDLIPSQYAVIMLMVAKGAVSVAYTVMYTYTSELFPTVIRNTAVGCCSTIARFGAISASFIAFFLVDRFGRIVMIIPFTILALCASIVSWTMLP-ETVNQQLPDS 495          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0343347)

HSP 1 Score: 277.715 bits (709), Expect = 2.709e-85
Identity = 162/456 (35.53%), Postives = 247/456 (54.17%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQ-KFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKG 1941
            TYT++QA+   G GWF +KL ++VG+   +D+MEM +LSILGP+L CEW+++  Q+A +TT+VF+G  + S FW  +S+ YGRK+   +   L+     ++S +P+Y W++ LR  VGF IG    S TL  EFLP+  + K ++    FWA G+ FEV LA  V P YGWR ++ LS+ P+++  +L  +L ES R+    G  +K+ K++ ++   N + ++ GRL++  +     S ++L       T +LL  LW    F YYG+VL+  E     N                   H N C   + S D+  +L  +  EF  I +   +V L G+K T+           L+L         +V +F  RG  SGIF   Y+YT E++P ++RS     CS  AR+ A+LTPFVAQVL+  +S I  +  Y+ V  +  I+   LP ET G
Sbjct:   39 TYTVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNK----------------ESHPNECVTFMTS-DFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLM-DSSRIQAMSTYAIVGLLASIACVFLPRETVG 476          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0072197)

HSP 1 Score: 277.715 bits (709), Expect = 2.709e-85
Identity = 162/456 (35.53%), Postives = 247/456 (54.17%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQ-KFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKG 1941
            TYT++QA+   G GWF +KL ++VG+   +D+MEM +LSILGP+L CEW+++  Q+A +TT+VF+G  + S FW  +S+ YGRK+   +   L+     ++S +P+Y W++ LR  VGF IG    S TL  EFLP+  + K ++    FWA G+ FEV LA  V P YGWR ++ LS+ P+++  +L  +L ES R+    G  +K+ K++ ++   N + ++ GRL++  +     S ++L       T +LL  LW    F YYG+VL+  E     N                   H N C   + S D+  +L  +  EF  I +   +V L G+K T+           L+L         +V +F  RG  SGIF   Y+YT E++P ++RS     CS  AR+ A+LTPFVAQVL+  +S I  +  Y+ V  +  I+   LP ET G
Sbjct:   39 TYTVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNK----------------ESHPNECVTFMTS-DFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLM-DSSRIQAMSTYAIVGLLASIACVFLPRETVG 476          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340268)

HSP 1 Score: 144.821 bits (364), Expect = 6.071e-36
Identity = 125/483 (25.88%), Postives = 222/483 (45.96%), Query Frame = 1
Query:  589 EQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGF---ITSFSPTYIWVILLRCFVGFGIGGAASS-FTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPR-----------YGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKF------SIKNLFLQE-----------YRCTFLLLLILWFGVTFS----YYGIVLLNAEFFNLHNTCYQA---------STTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLV---DLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFV-AQVLI---PQTSMIV-GLVV 1878
            E+A+E  G G F   L+ + G++S ++ M+++ +S + P+ +C+  L++E K  L +I+FIG  +G++FWG ++D++GRK   LIVIS +  N F    +SFS TY + +L R   G  +GG+    ++   EF P A R  +L     FW  G+ F   LA+ ++PR             WR  + + S+P  L   L+ +LPESP+FLL  GK +++  I   +   N K+     ++   +V +       ++KN + +            ++   L   I+   + F+    YYG+++   E FN      +A         + T    +      ++ +C  ++    +   L+S       +P N   +   D++GRK  + +          L+Y     +   V+     G  S          +EVFPT +R++   +    AR+  I+   V AQ+L    P  + IV GL++
Sbjct:  138 ERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKV-LIVISFM--NAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASA---LPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIFSGAISAANAALDCLITEVFPTKLRATGVAISMVAARLGGIIGNIVIAQLLDNYCPSPTFIVSGLLI 614          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340266)

HSP 1 Score: 144.821 bits (364), Expect = 6.071e-36
Identity = 125/483 (25.88%), Postives = 222/483 (45.96%), Query Frame = 1
Query:  589 EQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGF---ITSFSPTYIWVILLRCFVGFGIGGAASS-FTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPR-----------YGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKF------SIKNLFLQE-----------YRCTFLLLLILWFGVTFS----YYGIVLLNAEFFNLHNTCYQA---------STTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLV---DLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFV-AQVLI---PQTSMIV-GLVV 1878
            E+A+E  G G F   L+ + G++S ++ M+++ +S + P+ +C+  L++E K  L +I+FIG  +G++FWG ++D++GRK   LIVIS +  N F    +SFS TY + +L R   G  +GG+    ++   EF P A R  +L     FW  G+ F   LA+ ++PR             WR  + + S+P  L   L+ +LPESP+FLL  GK +++  I   +   N K+     ++   +V +       ++KN + +            ++   L   I+   + F+    YYG+++   E FN      +A         + T    +      ++ +C  ++    +   L+S       +P N   +   D++GRK  + +          L+Y     +   V+     G  S          +EVFPT +R++   +    AR+  I+   V AQ+L    P  + IV GL++
Sbjct:  138 ERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKV-LIVISFM--NAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASA---LPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIFSGAISAANAALDCLITEVFPTKLRATGVAISMVAARLGGIIGNIVIAQLLDNYCPSPTFIVSGLLI 614          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340267)

HSP 1 Score: 144.821 bits (364), Expect = 6.071e-36
Identity = 125/483 (25.88%), Postives = 222/483 (45.96%), Query Frame = 1
Query:  589 EQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGF---ITSFSPTYIWVILLRCFVGFGIGGAASS-FTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPR-----------YGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKF------SIKNLFLQE-----------YRCTFLLLLILWFGVTFS----YYGIVLLNAEFFNLHNTCYQA---------STTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLV---DLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFV-AQVLI---PQTSMIV-GLVV 1878
            E+A+E  G G F   L+ + G++S ++ M+++ +S + P+ +C+  L++E K  L +I+FIG  +G++FWG ++D++GRK   LIVIS +  N F    +SFS TY + +L R   G  +GG+    ++   EF P A R  +L     FW  G+ F   LA+ ++PR             WR  + + S+P  L   L+ +LPESP+FLL  GK +++  I   +   N K+     ++   +V +       ++KN + +            ++   L   I+   + F+    YYG+++   E FN      +A         + T    +      ++ +C  ++    +   L+S       +P N   +   D++GRK  + +          L+Y     +   V+     G  S          +EVFPT +R++   +    AR+  I+   V AQ+L    P  + IV GL++
Sbjct:  138 ERAIELCGYGKFHYILLAICGLVSTSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKV-LIVISFM--NAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASA---LPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIFSGAISAANAALDCLITEVFPTKLRATGVAISMVAARLGGIIGNIVIAQLLDNYCPSPTFIVSGLLI 614          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 338.191 bits (866), Expect = 1.439e-107
Identity = 186/464 (40.09%), Postives = 272/464 (58.62%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S + ALLT++VFIG  + S  WG +SD YGRKT   + +    + G +++F+P Y W++ LR  VGFGIGGA  S TL  EFLP  SRA  ++  ++FWA G+ FEV LA  V+P  GWRW++ LS++P+ + A L  +LPES R+ +  G  EK+   + ++   N   +  G+LI + +  +  I++LF   +R T +LL  +WF   FSYYG+VLL  E F     C  A  +   E   +L       CK L S+DYK +L ++  EF  + +  + +D +GR+ TMA   F+ S   + LY C+     TV +F  R   +G F   Y+YT EV+PT+ R+   G  S  AR+ A++TPFVAQV++ ++S+ + L VY     +  I+   LPIET GR + ++
Sbjct:   63 TDDTFMVEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQEDRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTELFQEGGVCGGAKGS-KMEPGCSLE------CKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-ESSVYLTLSVYCCCCLLAAIASCALPIETTGRGLQES 518          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 338.191 bits (866), Expect = 1.791e-107
Identity = 186/464 (40.09%), Postives = 272/464 (58.62%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S + ALLT++VFIG  + S  WG +SD YGRKT   + +    + G +++F+P Y W++ LR  VGFGIGGA  S TL  EFLP  SRA  ++  ++FWA G+ FEV LA  V+P  GWRW++ LS++P+ + A L  +LPES R+ +  G  EK+   + ++   N   +  G+LI + +  +  I++LF   +R T +LL  +WF   FSYYG+VLL  E F     C  A  +   E   +L       CK L S+DYK +L ++  EF  + +  + +D +GR+ TMA   F+ S   + LY C+     TV +F  R   +G F   Y+YT EV+PT+ R+   G  S  AR+ A++TPFVAQV++ ++S+ + L VY     +  I+   LPIET GR + ++
Sbjct:   53 TDDTFMVEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQEDRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTELFQEGGVCGGAKGS-KMEPGCSLE------CKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-ESSVYLTLSVYCCCCLLAAIASCALPIETTGRGLQES 508          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 313.538 bits (802), Expect = 1.592e-98
Identity = 175/461 (37.96%), Postives = 272/461 (59.00%), Query Frame = 1
Query:  580 YTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            YT+E+AVE+ G G F + L V++G  +  +AME++LL+++ P ++CEWHL   Q AL++T+VF GF +     G ++D YGR           SY  F+TSFS +Y W I LRC VG G+   +  F L  EF+P+  RA +L    +FW  GS   + L   V+P  GWRW++  S +P ++   L +F+PES RF ++ G ++ +   + ++  +N   L +G L      ++ +   L    +R T LLL   WF  +FSYYG VL ++E    +  C    T  + EH+      +  C C    S+DY+++L+S  GE  +IP+N  L++++GRK +M   L L++ FF+L+  C   +  T+L+F +R   S  FNV YIYT+EV+PTSVRS   G C+SF+RI  ++ PF+AQVL+ + S+I+ L  +++   +C I V  LPIET+GRA+ Q+
Sbjct:   49 YTVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCV---TDPDLEHQIKHIQEETLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK-SVILALSPFATACIICAIGVFFLPIETRGRALLQD 505          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 313.538 bits (802), Expect = 1.592e-98
Identity = 175/461 (37.96%), Postives = 272/461 (59.00%), Query Frame = 1
Query:  580 YTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            YT+E+AVE+ G G F + L V++G  +  +AME++LL+++ P ++CEWHL   Q AL++T+VF GF +     G ++D YGR           SY  F+TSFS +Y W I LRC VG G+   +  F L  EF+P+  RA +L    +FW  GS   + L   V+P  GWRW++  S +P ++   L +F+PES RF ++ G ++ +   + ++  +N   L +G L      ++ +   L    +R T LLL   WF  +FSYYG VL ++E    +  C    T  + EH+      +  C C    S+DY+++L+S  GE  +IP+N  L++++GRK +M   L L++ FF+L+  C   +  T+L+F +R   S  FNV YIYT+EV+PTSVRS   G C+SF+RI  ++ PF+AQVL+ + S+I+ L  +++   +C I V  LPIET+GRA+ Q+
Sbjct:   49 YTVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCV---TDPDLEHQIKHIQEETLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK-SVILALSPFATACIICAIGVFFLPIETRGRALLQD 505          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 311.612 bits (797), Expect = 1.271e-97
Identity = 175/461 (37.96%), Postives = 271/461 (58.79%), Query Frame = 1
Query:  580 YTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            YT+E+AVE+ G G F + L V++G  +  +AME++LL+++ P ++CEWHL   Q AL++T+VF GF +     G ++D YGR           SY  F+TSFS +Y W I LRC VG G+   +  F L  EF+P+  RA +L    +FW  GS   + L   V+P  GWRW++  S +P ++   L +F+PES RF ++ G ++ +   + ++  +N   L +G L      ++ +   L    +R T LLL   WF  +FSYYG VL ++E    +  C    T  + EH+      +  C C    S+DY+++L+S  GE  +IP+N  L++++GRK +M   L L++ FF+L+  C   +  T+L+F +R   S  FNV YIYT+EV+PTSVRS   G C+SF+RI  ++ PF+AQVL+ + S+I+ L  +++   +C I V  LPIET+GRA+  N
Sbjct:   49 YTVEEAVESIGFGRFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCV---TDPDLEHQIKHIQEEMLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK-SVILALSPFATACIICAIGVFFLPIETRGRALLVN 505          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 357.451 bits (916), Expect = 1.295e-114
Identity = 195/464 (42.03%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG VSD YGR+T   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  SRAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS++P+ L A+L  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  I++LF  ++R T LLL  +WF   FSYYG+VLL  E F   + C  ++     + + +L       C+ L  EDY  +L ++  EF  + I  +++D +GRK TMA    + S   LLL+ C+     TV +F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + ++VYS    +  ++   LPIETKGR + ++
Sbjct:   63 TDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQEDRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISNQRKAVKPKCSL------ACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQES 519          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 355.91 bits (912), Expect = 4.262e-114
Identity = 194/464 (41.81%), Postives = 281/464 (60.56%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG VSD YGR+T   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  SRAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS++P+ L A+L  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  I++LF  ++R T LLL  +WF   FSYYG+VLL  E F   + C     ++  + +       +  C+ L  EDY  +L ++  EF  + I  +++D +GRK TMA    + S   LLL+ C+     TV +F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + ++VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQEDRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC-----SSKLKSKTMCRPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQES 521          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 355.525 bits (911), Expect = 5.348e-114
Identity = 196/464 (42.24%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG VSD YGR+T   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  SRAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS++P+ L A+L  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  I++LF  ++R T LLL  +WF   FSYYG+VLL  E F   + C   S+    + + +L       C+ L  EDY  +L ++  EF  + I  +++D +GRK TMA    + S   LLL+ C+     TV +F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + ++VYS    +  ++   LPIETKGR + ++
Sbjct:   58 TDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQEDRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC---SSKKAVKPKCSL------ACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQES 511          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 351.673 bits (901), Expect = 5.282e-112
Identity = 194/464 (41.81%), Postives = 277/464 (59.70%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG VSD YGR+T   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  SRAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS++P+ L A+L  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  I++LF  ++R T LLL  +WF   FSYYG+VLL  E F   +      + A               C+ L  EDY  +L ++  EF  + I  +++D +GRK TMA    + S   LLL+ C+     TV +F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + ++VYS    +  ++   LPIETKGR + ++
Sbjct:  110 TDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQEDRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDAVKPKCSLA---------------CEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQES 557          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 316.235 bits (809), Expect = 5.287e-99
Identity = 186/468 (39.74%), Postives = 266/468 (56.84%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPM----ILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG VSD YGR+T   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  SRAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS++P+    ILC V + +L     F                         MK  ++   K  +  I++LF  ++R T LLL  +WF   FSYYG+VLL  E F   + C  ++     + + +L       C+ L  EDY  +L ++  EF  + I  +++D +GRK TMA    + S   LLL+ C+     TV +F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + ++VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFVSLFYLKLYFYFSFT----------------------MKRNILFVLKEDRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISNQRKAVKPKCSLA------CEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQES 502          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Svop (SV2 related protein [Source:MGI Symbol;Acc:MGI:1915916])

HSP 1 Score: 350.903 bits (899), Expect = 2.954e-112
Identity = 198/464 (42.67%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG +SD YGRKT   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  +RAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS+ P++L AVL  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  +++LF   +R T LLL  +WF   FSYYG+VLL  E F   + C  +S     E + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     T+L+F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + L VYS    +  ++   LPIETKGRA+ ++
Sbjct:   64 TDDTFMVEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPSLGWRWLLLLSAAPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAKCSLA------CEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAGVASCFLPIETKGRALQES 520          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Svopl (SV2 related protein homolog (rat)-like [Source:MGI Symbol;Acc:MGI:2444335])

HSP 1 Score: 295.819 bits (756), Expect = 7.395e-92
Identity = 163/468 (34.83%), Postives = 267/468 (57.05%), Query Frame = 1
Query:  562 EYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTAN--FEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            +  T T+T+E AVET G G F + L +++G     +AME++L++++ P ++CEW L + Q A +TT+VF G+ + S  +G+++D YGR    L+     +Y   +TSFSP+YIW + LR  VG G+ G A    +  EFLP+  R  +L   QVFW  GS   + +A  V+P  GWRW++ ++S+P I+  +   F+PES RF ++ G  + +   +  +  +N   + +G+L+     ++    +L   +Y  T L + I+W G++F+YYG++L +AE       C   S +     E  G+     + C C      DY++M++S+ GE  + P+N   ++ +GR+ +++ ++  T+ FFLLL  C         +F +R   +  FN  YIYT+EV+PT +R+   G   S  RI A++ PF++QVL+   S +  L ++SSV  VC IS   LPIETKGRA+ Q
Sbjct:   26 QKETKTFTVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVEPILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVILASAELLERDLVCGSKSESEPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAPFISQVLM-SASFLGALCLFSSVCVVCAISAFTLPIETKGRALQQ 492          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 120.939 bits (302), Expect = 2.642e-28
Identity = 114/436 (26.15%), Postives = 196/436 (44.95%), Query Frame = 1
Query:  718 EWHLSSEQKAL---LTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLC-----EFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMK--------GRLISSGKV-QKFSIKNLF-LQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXX--XXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNFK 1965
            EW L  +Q+ L    +T  FIG  +G+  +G +SD +GR+   L+        G +++ S  YI  +  R   G  + G    FT++      E+L    R    +    FW  G      + Y +     WRW++  +++P +   + + ++PES R+LL  G++E+++K ++    +NG+ + +         ++I+  +V Q+ S  +LF   + R   L  +++WFGV FSYYG+ L                              D S    LG   Y++ LL    E       FFLV L+GR+ T A  L  T+      LL       W T L+   +  +   F   Y++TSE++PT +R +  G  +   R+ A L P V  VL+    +++  + Y  ++F+   +V  LP ETK   +P+  +
Sbjct:  131 EWDLVCQQRGLNKVTSTCFFIGVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAG----FTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLI---RSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTL------------------------------DASG---LGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLV--VLLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPETIQ 523          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 118.627 bits (296), Expect = 4.522e-28
Identity = 113/435 (25.98%), Postives = 195/435 (44.83%), Query Frame = 1
Query:  721 WHLSSEQKAL---LTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLC-----EFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMK--------GRLISSGKV-QKFSIKNLF-LQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXX--XXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNFK 1965
            W L  +Q+ L    +T  FIG  +G+  +G +SD +GR+   L+        G +++ S  YI  +  R   G  + G    FT++      E+L    R    +    FW  G      + Y +     WRW++  +++P +   + + ++PES R+LL  G++E+++K ++    +NG+ + +         ++I+  +V Q+ S  +LF   + R   L  +++WFGV FSYYG+ L                              D S    LG   Y++ LL    E       FFLV L+GR+ T A  L  T+      LL       W T L+   +  +   F   Y++TSE++PT +R +  G  +   R+ A L P V  VL+    +++  + Y  ++F+   +V  LP ETK   +P+  +
Sbjct:    8 WDLVCQQRGLNKVTSTCFFIGVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAG----FTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLI---RSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTL------------------------------DASG---LGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLV--VLLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPETIQ 399          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Svop (SV2 related protein [Source:MGI Symbol;Acc:MGI:1915916])

HSP 1 Score: 110.538 bits (275), Expect = 1.399e-27
Identity = 55/110 (50.00%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTY 897
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG +SD YGRKT   I +    Y G +++F+P Y
Sbjct:   63 TDDTFMVEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVY 172          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q1JP63|SVOP_BOVIN (Synaptic vesicle 2-related protein OS=Bos taurus OX=9913 GN=SVOP PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 1.114e-116
Identity = 197/464 (42.46%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VF+G    S  WG +SD YGRKT   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  +RAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS+VP++L AVL  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  +++LF   +R T LLL  +WF   FSYYG+VLL  E F   + C  +S     E + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     T+L+F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + L VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAKCSLA------CEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFICVGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQES 520          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q8N4V2|SVOP_HUMAN (Synaptic vesicle 2-related protein OS=Homo sapiens OX=9606 GN=SVOP PE=1 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 2.536e-116
Identity = 197/464 (42.46%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VF+G    S  WG +SD YGRKT   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  +RAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS+VP++L AVL  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  +++LF   +R T LLL  +WF   FSYYG+VLL  E F   + C  +S     E + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     T+L+F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + L VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLA------CEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQES 520          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q5R5T8|SVOP_PONAB (Synaptic vesicle 2-related protein OS=Pongo abelii OX=9601 GN=SVOP PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 2.822e-116
Identity = 197/464 (42.46%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VF+G    S  WG +SD YGRKT   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  +RAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS+VP++L AVL  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  +++LF   +R T LLL  +WF   FSYYG+VLL  E F   + C  +S     E + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     T+L+F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + L VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLA------CEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQES 520          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q2XWK0|SVOP_XENLA (Synaptic vesicle 2-related protein OS=Xenopus laevis OX=8355 GN=svop PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 9.342e-116
Identity = 194/464 (41.81%), Postives = 284/464 (61.21%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG VSD YGR+T   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  SRAK ++  ++FWA G+ FEV LA FV+P  GWRW++ LS++P++L A+L  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  I++LF  ++RCT LLL  +WF   FSYYG+VLL  E F   + C  ++     + + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     TV +F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + ++VYS    +  ++   LPIETKGR + ++
Sbjct:   64 TDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVIWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEIFWALGTVFEVLLAIFVMPTLGWRWLLILSALPLMLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQEDRGKIRDLFSPQFRCTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISNQRKAVKPKCSL------ACEYLTVEDYTDLLWTTLSEFPGLLVTLWIIDRVGRKKTMAICFIIFSFSALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAAVASCFLPIETKGRGLQES 520          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q9Z2I7|SVOP_RAT (Synaptic vesicle 2-related protein OS=Rattus norvegicus OX=10116 GN=Svop PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 5.162e-112
Identity = 197/464 (42.46%), Postives = 282/464 (60.78%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL V+ G+   ADAMEM++LSIL P L CEW L S Q ALLT++VFIG    S  WG +SD YGRKT   I +    Y G +++F+P Y W+++LR  VGFGIGG   S TL  EFLP  +RAK ++  +VFWA G+ FEV LA FV+P  GWRW++ LS+ P+++ AVL  +LPES R+ +  G  EK+   + ++ T NG  +  G+LI S +  +  +++LF   +R T LLL  +WF   FSYYG+VLL  E F   + C  +S     E + +L       C+ L  EDY  +L ++  EF  + +  +++D +GRK TMA    + S   LLL+ C+     T+L+F  R   SG F   Y+YT EV+PT+ R+   G CS  AR+ A++TPF+AQV++ ++S+ + L VYS    +  ++   LPIETKGRA+ ++
Sbjct:   64 TDDTFMVEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPSLGWRWLLLLSAAPLLVFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISSRKKAVEAKCSLA------CEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFVIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRALQES 520          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A267GPA2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029535g2 PE=4 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 3.098e-149
Identity = 233/464 (50.22%), Postives = 313/464 (67.46%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSG--KVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNF 1962
            TYT+EQAVE  G G FQL+++ + G+++AADAMEMLLLS+LGPAL+C+W LSS Q A++TT+VF G F G+  WG VSD +GR+  F + +SLI+Y G + SFSP++ W++ LR  VGF I GA SSFTLL E+LP   RAKVLIAY VFW  GS+FEV LAY VLP  GWR++   S++P+ +  + + FLPES R+LL  G+ +K+  +I+++   N K  M GR +++   +  + ++ +LF   YR T L L  +WFGV F YYGIVL++ E F+ H+ CY  S+     H       D SCC+ L  +DYK+ML+SSFGEF IIP N   +D +GR+ TMA +  LTS FF L Y C+P    T  +F IR   +GIFN  YIYT EV+PT VRS   G+CSS AR+ ++ TPFVAQVL+P  S+++   VY +VA  C +    LPIET+GRAMPQ  
Sbjct:   71 TYTVEQAVEKLGFGRFQLRILFICGIMTAADAMEMLLLSVLGPALRCDWQLSSAQVAIITTVVFAGMFGGAPAWGAVSDKHGRRGVFGLSLSLIAYFGLLCSFSPSFFWLVSLRGMVGFCISGATSSFTLLSEYLPQTYRAKVLIAYNVFWGLGSSFEVLLAYMVLPNLGWRYLTAFSALPLFIFMLALGFLPESARYLLASGQPKKAAAVIDQIARDNRKPPMTGRPVAASVTEADRGTLLSLFHPNYRRTTLTLFFMWFGVAFLYYGIVLISTEIFHFHSDCY-GSSEVTVGHNTTEIVTDESCCRSLQPDDYKAMLISSFGEFVIIPFNLITIDALGRRWTMAINYGLTSVFFGLTYICVPKAVTTAFLFMIRAHAAGIFNTIYIYTVEVYPTVVRSVGLGVCSSIARLGSMSTPFVAQVLMPDVSVLLAFCVYVTVAVACAVLALLLPIETRGRAMPQGL 533          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A267E6E2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029535g7 PE=4 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.651e-148
Identity = 232/463 (50.11%), Postives = 312/463 (67.39%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSG--KVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            TYT+E AVE  G G FQL+++ + G+++AADAMEMLLLS+LGPAL+C+W LSS Q A++TT+VF G F G+  WG VSD +GR+  F + +SLI+Y G + SFSP++ W++ LR  VGF I GA SSFTLL E+LP   RAKVLIAY VFW  GS+FEV LAY VLP  GWR++   S++P+ +  + + FLPES R+LL  G+ +K+  +I+++   N K  M GR +++   +  + ++ +LF   YR T L L  +WFGV F YYGIVL++ E F+ H+ CY  S+     H       D SCC+ L  +DYK+ML+SSFGEF IIP N   +D +GR+ TMA +  LTS FF L Y C+P    T  +F IR   +GIFN  YIYT EV+PT VRS   G+CSS AR+ ++ TPFVAQVL+P  S+++   VY +VA  C +    LPIET+GRAMPQ 
Sbjct:   71 TYTVEHAVEKLGFGRFQLRILFICGIMTAADAMEMLLLSVLGPALRCDWQLSSAQVAIITTVVFAGMFGGAPAWGAVSDKHGRRGVFGLSLSLIAYFGLLCSFSPSFFWLVSLRGMVGFCISGATSSFTLLSEYLPQTYRAKVLIAYNVFWGLGSSFEVLLAYMVLPNLGWRYLTAFSALPLFIFMLALGFLPESARYLLASGQPKKAAAVIDQIARDNRKPPMTGRPVAASVTEADRGTLLSLFHPNYRRTTLTLFFMWFGVAFLYYGIVLISTEIFHFHSDCY-GSSEVTVGHNTTEIVTDESCCRSLQPDDYKAMLISSFGEFVIIPFNLITIDALGRRWTMAINYGLTSVFFGLTYICVPKAVTTAFLFMIRAHAAGIFNTIYIYTVEVYPTVVRSVGLGVCSSIARLGSMSTPFVAQVLMPDVSVLLAFCVYVTVAVACAVLALLLPIETRGRAMPQG 532          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A267E881 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029535g4 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 2.233e-148
Identity = 232/464 (50.00%), Postives = 311/464 (67.03%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSG--KVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNF 1962
            TYT+E AVE  G G FQL+++ + G+++AADAMEMLLLS+LGPAL+C+W LSS Q A++TT+VF G F G+  WG VSD +GR+  F + +SLI+Y G + SFSP++ W++ LR  VGF I GA SSFTLL E+LP   RAKVLIAY VFW  GS+FEV LAY VLP  GWR++   S++P+ +  + + FLPES R+LL  G+ +K+  +I+++   N K  M GR +++   +  + ++ +LF   YR T L L  +WFGV F YYGIVL++ E F  H+ CY  S+     H       D SCC+ L  +DYK+ML+SSFGEF IIP N   +D +GR+ TMA +  LTS FF L Y C+P    T  +F IR   +GIFN  YIYT EV+PT VRS   G+CSS AR+ ++ TPFVAQVL+P  S+++   VY +VA  C +    LPIET+GRAMPQ  
Sbjct:   71 TYTVEHAVEKLGFGRFQLRILFICGIMTAADAMEMLLLSVLGPALRCDWQLSSAQVAIITTVVFAGMFGGAPAWGAVSDKHGRRGVFGLSLSLIAYFGLLCSFSPSFFWLVSLRGMVGFCISGATSSFTLLSEYLPQTYRAKVLIAYNVFWGLGSSFEVLLAYMVLPNLGWRYLTAFSALPLFIFMLALGFLPESARYLLASGQPKKAAAVIDQIARDNRKPPMTGRPVAASVTEADRGTLLSLFHPNYRRTTLTLFFMWFGVAFLYYGIVLISTEIFQFHSDCY-GSSEVTVGHNTTEIVTDESCCRSLQPDDYKAMLISSFGEFVIIPFNLITIDALGRRWTMAINYGLTSVFFGLTYICVPKAVTTAFLFMIRAHAAGIFNTIYIYTVEVYPTVVRSVGLGVCSSIARLGSMSTPFVAQVLMPDVSVLLAFCVYVTVAVACAVLALLLPIETRGRAMPQGL 533          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A3Q0KSV1 (Putative sugar transporter OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.676e-146
Identity = 240/475 (50.53%), Postives = 326/475 (68.63%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKV--QKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHD------------NSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            TYT+E AVE+AG G FQLKL V+ G +SAADAMEMLLLS+LGPAL+C W LSS Q A +TT+VF GF  G+  WG ++D +GR  T LIV+S+I+Y G ITS +PTYIWVI+LR  VGF IGG  SSFTL  EFL    RAKVL+A+ +FWA GSTFEVGLAY +LPR+GWRW+V +S++P+++   L+ FLPESPR+L+  GK E++++II  +   N    + G L+SS      + SIK +F + Y  T L+L I+WF   F YYG+VL++AE F   ++C+        ++RGNL+  +            N CCKEL  +DY +ML+SS GEF  IP+   +VDL GRK T+A+   L +  F+LLY CMP    T L+F +R  ++G+F++ Y+YT+EV+PT+VR+ A GM SS AR+ A++TP+VAQV++P+ S I  L +Y+SV  V  I    LPIETKGR +P +
Sbjct:   57 TYTVEDAVESAGFGRFQLKLFVLCGAISAADAMEMLLLSVLGPALRCYWLLSSGQVAAITTVVFAGFLFGAPLWGFIADRFGRWPTLLIVLSMITYFGIITSCAPTYIWVIILRLLVGFAIGGGNSSFTLFSEFLTVKHRAKVLLAFNIFWAFGSTFEVGLAYLILPRFGWRWLVFVSALPLLIFLFLLRFLPESPRYLVGAGKTEEAERIIADLFRTNRVVPLSGTLVSSTVPIRDRGSIKGMFGKTYLVTTLMLPIIWFSAAFVYYGVVLISAEIFRFKHSCFGKPVLTP-DYRGNLSHFNVAPLVETSNQMVNFCCKELSEDDYVAMLVSSIGEFVSIPLMILMVDLAGRKVTLATWNGLIAVLFMLLYLCMPKSALTALLFVLRALSAGLFSLAYVYTTEVYPTTVRAVAVGMFSSIARLGAMVTPYVAQVMMPEVSEIGALSLYASVTLVVSIVSLFLPIETKGRQLPNS 530          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A0X3PAK1 (MFS domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR164745 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 2.963e-146
Identity = 222/470 (47.23%), Postives = 328/470 (69.79%), Query Frame = 1
Query:  571 TTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKF--SIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFH-----DNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            + TYT+E+A+ET GLG+FQL+++ + G+L AADAME+LLLS+LGP L+C W+L+  + AL+TTIVF+G+ +G+  WG  SD YGRKT  L V+SLI+Y G +T+ SPTYIWV++LR  VGF IGG +SS+ L+ E+LP   RA VL+A Q+FWA G + E+GL++ +LPR+GWRW++  SS+P+ L   L+L LPES R+L    +LE++Q+I+N +  +N K  M+G L+SS   +    +I +LF + Y CT LLL I+WFG  F+YYG +L++++ F  H+ C+        +H GNLT       D SCC EL +EDY SML+SS GEF I+P+N  +V+++GR+ ++A    L + FF+ +  C+P     V +F +R  +S   N+ Y+YT+EV+PT++RS   G+ SS +R  A+ TP+VAQVL+P+ S++  L  YS+++ +C I+  CLPIETKGRAM  +
Sbjct:   13 SPTYTVEEAIETYGLGFFQLRVVGISGILQAADAMELLLLSVLGPTLRCTWNLTPSEVALITTIVFVGYLLGAPLWGKFSDKYGRKTCLLTVLSLIAYFGLLTTLSPTYIWVLVLRGIVGFNIGGGSSSYALMAEYLPLHHRATVLLAAQLFWAIGGSVEIGLSFLILPRFGWRWLIFASSLPLALFLGLLLLLPESVRYLTAANRLEEAQQIVNNIAKMNKKVEMEGSLVSSESTESSLGNIMHLFAKRYLCTSLLLPIIWFGAAFTYYGSILVSSDIFRFHSQCFGVKADP-IDHHGNLTAGLTPVVDTSCCVELQTEDYTSMLVSSLGEFAILPLNIVMVNVLGRRLSLAGVYLLLAIFFIAINACVPSTVTIVFLFILRALSSSTINLVYLYTTEVYPTTIRSLGLGLFSSISRFGAMSTPYVAQVLMPEVSVLAALGTYSAMSVLCAIASGCLPIETKGRAMQHS 481          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 352.829 bits (904), Expect = 4.965e-113
Identity = 191/464 (41.16%), Postives = 276/464 (59.48%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S + ALLT++VFIG  + S  WG +SD YGRKT   + +    + G ++SF+P Y W++ LR  VGFGIGGA  S TL  EFLP  SRA  ++  +VFWA G+ FEV LA  V+P  GWRW++ LS++P+ + A+L  +LPES R+ +  G  EK+   + ++ T N   +  G+LI + + ++  IK+LFL  +R T +LL  +WF   FSYYG+VLL  E F     C   +  +  E R NL       CK L S+DYK +L ++  EF  + +  + +D +GR+ TMA      S   + LY C+     TVL+F  R   +G F   Y+YT EV+PT+ R+   G  S  AR+ A++TPFVAQV++ ++S+ + L VY     +  ++   LPIET GR + ++
Sbjct:   65 TDDTFMVEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQEERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGACGD-TKGSKAEPRCNLE------CKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFLFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-ESSVYLTLSVYCCCCLLAAVASCALPIETTGRGLQES 520          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 350.132 bits (897), Expect = 4.340e-112
Identity = 191/464 (41.16%), Postives = 274/464 (59.05%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S + ALLT++VFIG  + S  WG +SD YGRKT   + +    + G ++SF+P Y W++ LR  VGFGIGGA  S TL  EFLP  SRA  ++  +VFWA G+ FEV LA  V+P  GWRW++ LS++P+ + A+L  +LPES R+ +  G  EK+   + ++ T N   +  G+LI + + ++  IK+LFL  +R T +LL  +WF   FSYYG+VLL  E F     C         E R NL       CK L S+DYK +L ++  EF  + +  + +D +GR+ TMA      S   + LY C+     TVL+F  R   +G F   Y+YT EV+PT+ R+   G  S  AR+ A++TPFVAQV++ ++S+ + L VY     +  ++   LPIET GR + ++
Sbjct:   67 TDDTFMVEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQEERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGACGGIKA----EPRCNLE------CKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFLFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-ESSVYLTLSVYCCCCLLAAVASCALPIETTGRGLQES 519          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 251.136 bits (640), Expect = 4.005e-75
Identity = 162/461 (35.14%), Postives = 256/461 (55.53%), Query Frame = 1
Query:  580 YTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            Y++E+AVE+ G G F + L +++G  +  +AME++LL+++ P ++CEW L   Q AL++T+VF+GF +     G V+D YGR           +Y   +TSF+P+Y W I LR  VG G+   +  F L  EF+P+  RA +L    +FW  GS   + L   V+P  GWRW++  S +P +   +L+      PR+ +    LE     I  +L +    +++ ++I              L  YR +   +L+L F  +F+YYG VL ++E    +  C      A+ EH       +  C C      DY+++L+S  GE  +IP+N  L++++GRK +M   L L++ FF+L+  C      TVL+F +R   S  FNV YIYT+EV+PTSVRS   G C+SF+RI  ++ PF+AQVL+ + S+++ L  +S    +C +  A LPIET+GRA+  N
Sbjct:   32 YSVEEAVESIGFGRFHVLLFIIMGSANIVEAMEIMLLAVVSPEIRCEWRLEDWQVALVSTMVFLGFMICGVLCGYVADKYGRWKVVFGGFVWAAYFSLLTSFAPSYGWFIFLRSMVGCGVAATSQGFVLKTEFIPAKHRAFLLPLASIFWMVGSLLIIILGMTVVPTLGWRWMIRFSIIPSL---ILIGLFQVKPRWWI----LEYLNLFIELLLII----VLEVKII--------------LSRYRYS---ILVLKFVASFTYYGSVLSSSELLEKNLLCV---VDADAEHGIKHNQEEALCYCIPFNMADYQTLLISCLGEVALIPLNIGLLNVVGRKLSMIILLLLSAVFFMLVNVCTTMFGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTSVRSLGMGFCTSFSRIGGMIAPFIAQVLMSK-SVLLALSPFSLACCLCAVGTALLPIETRGRALLVN 460          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: sv2bb (synaptic vesicle glycoprotein 2B-like [Source:NCBI gene;Acc:103039163])

HSP 1 Score: 135.191 bits (339), Expect = 1.391e-32
Identity = 92/325 (28.31%), Postives = 155/325 (47.69%), Query Frame = 1
Query:  559 TEYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAAS-SFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYG-------------WRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVN------GKQLMKGRLISSGKVQ--------------------------KFSIKN---LFLQEYRCTFLLLLILWFGVTFSYYGIVL 1386
            +E        E  +E  G G FQ  L V++G+   AD++E  +++   P+ + +  LS+ +K +L  IVF+G   G+F WG +SD  GR+   +I +++   + F++SF+  Y + I  R F G GIGG+    ++   EFL    R + L    +FW  G  +    A+ ++PRYG             WR  V + ++P I   + ++F+PESPRFLL   K +++  I+ ++   N       +++     I + K Q                          K  +KN   L  +E R + LL+ I+WF + FSYYG+ +
Sbjct:   88 SEQEELAEQYEDIMEDCGHGRFQWSLFVVLGLALMADSVECFVVAFALPSAEKDMCLSNAEKGMLGLIVFLGMMFGAFIWGGMSDKVGRRKCLIIALAINCVSAFLSSFAQGYGFFIFFRLFSGIGIGGSVPIVYSYFSEFLQMDKRGEHLSWLCMFWMMGGIYASFTAWGIVPRYGWGFSMGSEFQFHSWRVFVLVCALPAIAALIGLMFMPESPRFLLEHAKHDEAWMILKQVHDTNWRAKGEPERVFTVSQIKTPKTQEDEFFEIQSSTGTAFQRWVVRTVTLIKLVLKNVLSLLTRELRLSTLLMAIIWFTMAFSYYGLAV 412          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: sv2bb (synaptic vesicle glycoprotein 2B-like [Source:NCBI gene;Acc:103039163])

HSP 1 Score: 135.191 bits (339), Expect = 1.566e-32
Identity = 92/325 (28.31%), Postives = 155/325 (47.69%), Query Frame = 1
Query:  559 TEYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAAS-SFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYG-------------WRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVN------GKQLMKGRLISSGKVQ--------------------------KFSIKN---LFLQEYRCTFLLLLILWFGVTFSYYGIVL 1386
            +E        E  +E  G G FQ  L V++G+   AD++E  +++   P+ + +  LS+ +K +L  IVF+G   G+F WG +SD  GR+   +I +++   + F++SF+  Y + I  R F G GIGG+    ++   EFL    R + L    +FW  G  +    A+ ++PRYG             WR  V + ++P I   + ++F+PESPRFLL   K +++  I+ ++   N       +++     I + K Q                          K  +KN   L  +E R + LL+ I+WF + FSYYG+ +
Sbjct:   88 SEQEELAEQYEDIMEDCGHGRFQWSLFVVLGLALMADSVECFVVAFALPSAEKDMCLSNAEKGMLGLIVFLGMMFGAFIWGGMSDKVGRRKCLIIALAINCVSAFLSSFAQGYGFFIFFRLFSGIGIGGSVPIVYSYFSEFLQMDKRGEHLSWLCMFWMMGGIYASFTAWGIVPRYGWGFSMGSEFQFHSWRVFVLVCALPAIAALIGLMFMPESPRFLLEHAKHDEAWMILKQVHDTNWRAKGEPERVFTVSQIKTPKTQEDEFFEIQSSTGTAFQRWVVRTVTLIKLVLKNVLSLLTRELRLSTLLMAIIWFTMAFSYYGLAV 412          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 340.502 bits (872), Expect = 9.223e-110
Identity = 188/463 (40.60%), Postives = 281/463 (60.69%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSE--VFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            T+++EQAVE  G G F + L+ ++G  + A++ME++LLS++ P +QCEW L   Q AL+TT+VF GF + S   G ++D YGR    L+V    SY   I+SFSPTY W + LR  +G GIGG +  F L+ EF+PS +R +VL   QVFW  GS  EV LAY +LP  GW W++ +S++P  +  +   F+PES R+ ++  K +K+   + K+  +N   L +G L+     ++ +I +L  ++Y  T L    +WFG T +YYG++L+++E    +  C   S TA  EH    +  ++ C CK+  SEDYK++LLSSFGEF  IP     +D +GR+ +MA S+ L    + LL  C   +  TVL+F +R   S  FN+ YIYT E  V+PT++RS   G CSS ARI A++ PFVAQV++   S+ + L ++ +V  +C +    LPIET GR M +
Sbjct:   31 TFSVEQAVEHMGFGRFHILLLFIMGSTTIAESMEIMLLSVISPTIQCEWRLQQWQVALVTTMVFFGFMLSSGPCGFLADRYGRWKVLLLVTIWSSYWSGISSFSPTYGWFVFLRFLMGCGIGGQSQGFVLMSEFMPSTARGRVLPMSQVFWVLGSLLEVVLAYLILPTLGWAWLIRISTIPSFVLLIAFKFIPESARYQVSAAKPDKALLTLAKIAKMNKTTLPQGTLVEPPAERRGNIWDLLDRQYLRTTLQTWPIWFGTTLTYYGLILVSSELLERNQMCGDDSVTAIEEHIA-FSEQESPCFCKQFKSEDYKTLLLSSFGEFLAIPFTTLTIDTLGRRRSMALSMILCGLLYYLLNICTTRMGLTVLLFFLRAVASTNFNIIYIYTVEVKVYPTNIRSLGLGSCSSTARIGAMIAPFVAQVIL-DISIPLALCLFGTVCVICSVLAFTLPIETMGREMKE 491          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 107.842 bits (268), Expect = 8.957e-25
Identity = 123/483 (25.47%), Postives = 211/483 (43.69%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLG-WFQLKLIVMV---GVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLT---TIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVG-FGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKG-------RLISSGKVQKFSIKNLFLQ-EYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPH----IWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            NTTT++   A    GL  W Q   +  V   G L A D          G  L  E+ L  E   LL     ++ +G  +G+   G VSD YGR+ + ++ I + +  G + +F+P Y   + +R   G F +G   + F    EF+ S  R  V +  Q+F++ G     G+AY++     WR++    ++P ++       LPESPR+L++  + E++  ++ K+ +VNG++L             +  K    SI +L    + R   ++L+I WF V   Y G+                A +T N                 +G + Y + L+    E     +   L+D +GR+  M  +  L+    L     +PH    +  T++  G  G T     VT +  +E++PT +R+ A   CSS + I  I+ PFV   L      +  +V++ ++A +    +  LP ET G  +P+
Sbjct:   93 NTTTWSDSNA--PCGLAPWGQGDEVPNVSFSGRLIACDHGWEFDTEKTGLTLVSEFDLVCENAWLLDLSQALLNVGLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYL---RTWRYLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEKAGNPSIADLMRSAKIRKYTVVLMIYWFVVGVVYQGL----------------AMSTGN-----------------IGDDVYLAFLMGGLAEIPGALMVIALIDRVGRRLPMCVAPGLSGLACLAT-ALVPHDIGWLNITLVTLGRLGLTMAYEMVTLV-NNELYPTHLRNMAMSTCSSLSGIGGIVAPFVLYRLYTIWRHLP-MVIFGTLAIIGGFVILLLP-ETNGLPLPE 533          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001436.1 (pep scaffold:Pmarinus_7.0:GL476665:296817:321845:1 gene:ENSPMAG00000001290.1 transcript:ENSPMAT00000001436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 3.835e-21
Identity = 69/247 (27.94%), Postives = 122/247 (49.39%), Query Frame = 1
Query:  559 TEYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASS-FTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVG-------------LSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGR 1257
            TE        E  ++  G G FQ    +++G+   AD +E+ +++ + P+ + +  ++   K  L T+V++G  MGS  WG ++D  GR+   L+ +++ S   F++SF   Y   I  R   GFGIGG     ++   EFL    R + L    + W  G  +   +A+ ++P YGW + +G             + ++P +   V + F+PESPR LL +GK +++  I+ ++   N    MK R
Sbjct:  143 TEREEMAQQYEAVMQECGHGRFQWTFYMVLGLALMADGVEVFVVAFVLPSAERDLCITDAGKGWLGTLVYLGMMMGSLVWGGLADQQGRRQCLLMALTVNSLFSFLSSFVWDYGTFIFCRFLDGFGIGGIIPIVYSYYAEFLAHDKRGEHLSWLCMTWMFGGIYASAMAWAIIPHYGWSFGMGSAYQFHSWRVFVIVCALPAVASIVCLTFMPESPRHLLEMGKHDEAWMILKRVHDTN----MKAR 385          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 68.1662 bits (165), Expect = 1.192e-12
Identity = 47/178 (26.40%), Postives = 88/178 (49.44%), Query Frame = 1
Query:  718 EWHLSSEQKALLT---TIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGA-ASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGK 1239
            +W L  E KAL     T+   G  +GS  +G +SD YGR+   L    L +  G   +++P++     +R  +G  + G   ++ +L  E+L    R     +    W+ G+   +GL  ++L   GW+ +  + + P+  C +   F+PESPR+LL  G+  ++ + ++    +NG+
Sbjct:  129 QWDLVCEHKALNHLSLTLFMAGVMLGSLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWLDQGHRTFAGTSGGFAWSTGN-MALGLLAYLL--RGWQQLQLVVTSPIYFCILTWWFIPESPRWLLVRGRAREAHRNLSLCARINGR 303          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007303.1 (pep scaffold:Pmarinus_7.0:GL479716:670:30774:1 gene:ENSPMAG00000006591.1 transcript:ENSPMAT00000007303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.921e-10
Identity = 63/247 (25.51%), Postives = 103/247 (41.70%), Query Frame = 1
Query:  922 FVGFGIGGAAS-SFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVG-------------LSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIIN--------------KMLTVNGKQLMKG-----RLISSGKV-----------QKFSI----KNLFLQEYRCTFLLLLILWFGVTFSYYGIV---------LLNAEFFNL---HNTCYQASTTANFEHRGNLTFHDN 1482
            F+   IGGAA   F+   EFL    R + L    +F   G  +   +A+ ++P YGW + +G             + ++P +   V + F+PESPRFLL +GK +++  ++               ++ TV   + +K       ++S  +V           Q  SI    +  F    R T L+L+ +W  ++F YYG+          L N E+  L   HN      TT NF     +  H+N
Sbjct:   14 FISRSIGGAAPIVFSYFGEFLSREKRGEHLSWLCMFGMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPAVSAVVALTFMPESPRFLLQMGKHDEAWMVLKQVHDTNMRARGHPERVFTVTQIKTLKQEDELVEMMSDTRVWYRRWPMRTGTQLHSICKTLRMCFAGPIRRTSLMLVAVWCTLSFGYYGLSVWFPEIIKQLQNEEYAKLLKIHNKQSVVDTTFNFSMANQV--HNN 258          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Match: ITR1 (Myo-inositol transporter; member of the sugar transporter superfamily; expression is repressed by inositol and choline via Opi1p and derepressed via Ino2p and Ino4p; relative distribution to the vacuole increases upon DNA replication stress; ITR1 has a paralog, ITR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002905])

HSP 1 Score: 62.7734 bits (151), Expect = 1.142e-10
Identity = 47/184 (25.54%), Postives = 90/184 (48.91%), Query Frame = 1
Query:  739 QKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILL-RCFVGFGIG-GAASSFTLLCEFLPSASRAKVLI--------AYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRL 1260
            +K ++T    +G  + S F G  +D +GRK   L+  +L+   G I   S    W + + R  +GFG+G G+  +   + E  P   R ++ +           V + CG+    GL Y      GWR +VGLS +P  +    + FLP++PR+ +  G L ++ +++ +  T   +++++ ++
Sbjct:  127 EKEIVTAATSLGALITSIFAGTAADIFGRKRC-LMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGA----GLNYV---NNGWRILVGLSLIPTAVQFTCLCFLPDTPRYYVMKGDLARATEVLKRSYTDTSEEIIERKV 302          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Match: CIN10 (Putative transporter; member of the sugar porter family; non-essential gene; overexpression results in elevated colony sectoring, an indicator of chromosomal instability [Source:SGD;Acc:S000002795])

HSP 1 Score: 61.6178 bits (148), Expect = 2.565e-10
Identity = 46/157 (29.30%), Postives = 75/157 (47.77%), Query Frame = 1
Query:  727 LSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTL-LCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLP-RYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKL 1191
            L+  QK L+T+   +G F GS     ++D YGR+ T  I  S+        + + T  ++I  R  VG  +G +A    L L E  PS  R  +L    +    G      +A  +      WR++  LS++P IL   ++ F+PESPR+ ++ G +
Sbjct:   77 LTDVQKELITSSTSVGSFFGSILAFPLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCVPLFLSEISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEIDNSWRYLFALSAIPAILFLSILDFIPESPRWSISKGDI 233          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Match: PHO84 (High-affinity inorganic phosphate (Pi) transporter; also low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p; cells overexpressing Pho84p accumulate heavy metals but do not develop symptoms of metal toxicity [Source:SGD;Acc:S000004592])

HSP 1 Score: 61.2326 bits (147), Expect = 3.493e-10
Identity = 107/465 (23.01%), Postives = 180/465 (38.71%), Query Frame = 1
Query:  592 QAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCE--WH--LSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTF---LIVISLISYNGFITSFSPTYIWVILL---RCFVGFGIGGAAS-SFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYG-----------------------WRWIVGLSSVPMILCAVLVLFLPESPRFLLNV-GKLE------------KSQKIINKMLTVNGKQLMKGRLIS-SGKVQKFSIKNL---FLQ-EYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFII-----P---INFFLVDLIGRKGTMXXXXXXXXX----XXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSS 1794
            ++++  G GW Q+K I + GV    D+ ++  ++ LG  +     WH  +    + LL     +G  +G F +G ++D  GRK  +   LI++ + +      + SP   +V +L   R  +G GIGG    S  +  EF  +  R  ++ A     A G      +A  ++  Y                        WR ++GL +V  + C    L +PESPR+ L+V  KLE            K     ++ + +NG +     + S      K S K+    F Q +Y    L     WF +  ++YG+ L +A    L    Y  S                          YK +  ++ G   +I     P   ++ F VD+IGRK    +   + +A         +K   H    + +        G    T+I   E FPT  RS+A G+ ++
Sbjct:   51 ESIDDEGFGWQQVKTISIAGVGFLTDSYDIFAIN-LGITMMSYVYWHGSMPGPSQTLLKVSTSVGTVIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILVAAYKGELEYANSGAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRYQLDVNAKLELAAAAQEQDGEKKIHDTSDEDMAINGLERASTAVESLDNHPPKASFKDFCRHFGQWKYGKILLGTAGSWFTLDVAFYGLSLNSAVI--LQTIGYAGSKNV-----------------------YKKLYDTAVGNLILICAGSLPGYWVSVFTVDIIGRKPIQLAGFIILTALFCVIGFAYHKLGDHGLLALYVICQFFQNFGPNTTTFIVPGECFPTRYRSTAHGISAA 489          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Match: ITR2 (Myo-inositol transporter; member of the sugar transporter superfamily; expressed constitutively; ITR2 has a paralog, ITR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005463])

HSP 1 Score: 58.151 bits (139), Expect = 2.784e-9
Identity = 43/163 (26.38%), Postives = 79/163 (48.47%), Query Frame = 1
Query:  739 QKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILL-RCFVGFGIG-GAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGL-AYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINK 1218
            +K L+T    +G  + S   G  +D +GR+   L+  +L+   G I   +    W +   R  +GFG+G G+  S   + E  P   R ++ +   ++   G     G  A     + GWR +VGLS +P +L      FLP++PR+ +  G L++++ ++ +
Sbjct:  150 EKELITAATSLGALITSVGAGTAADVFGRRPC-LMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRILVGLSLIPTVLQFSFFCFLPDTPRYYVMKGDLKRAKMVLKR 311          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Match: HXT13 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by non-fermentable carbon sources; induced in low glucose, repressed in high glucose; HXT13 has a paralog, HXT17, that arose from a segmental duplication [Source:SGD;Acc:S000000795])

HSP 1 Score: 55.8398 bits (133), Expect = 1.696e-8
Identity = 56/223 (25.11%), Postives = 102/223 (45.74%), Query Frame = 1
Query:  718 EWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSF---TLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAY---FVLPRYG----WRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQ---LMKGRLISSGKVQK-----------FSIKNLFLQE 1314
            E++LS+ +  LL  +  IG  +G   +  ++D  GR+   +IV+ L+   G I   S  + W       + +G+G    S     LL E  P+  R  ++  YQ+      TF + L Y   +   +Y     WR  +GL  +  ++  + +L +PESPR+L+   + E+++  I K+  V+ +    L +   I++G + +           FS+K   LQ 
Sbjct:  100 EYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVV-LVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQL----NMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALIIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQR 317          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO41352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N1])

HSP 1 Score: 329.331 bits (843), Expect = 1.416e-105
Identity = 190/466 (40.77%), Postives = 279/466 (59.87%), Query Frame = 1
Query:  562 EYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGK-VQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSE-VFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAM 1950
            E     Y++  AV+  G GWFQ+K+++++G  SAADA+EM+LLSIL P ++C + +S+ ++A +TT+VFIG  +GS  WG ++DN+GRK   ++V   I+Y G +++FSP Y W+I+LR  VG GIGGA  S TL+ EFLPS  RA  +     +W  GS F + +A  V+P YGWR+++ L S+PM L  +L  FLPES RF L  G  +K+   +++M   N   L  G L  + +  ++  I +L   E R T L+L  LWF V F+YYG+VL+ +E F       Q+ +       G     D  C CK L ++DY  M+ ++  E  I+ +N  L++ +GR+ T+A    LT+ F++LL+ C    W    +FG RGC SG+F   YIYT E V P    +   G CS+ ARI A++TPF+ QVL+ + S+   L VY++    C +   CLPIETKGR M
Sbjct:   13 ECGEDVYSVSDAVDHIGFGWFQIKIMLLLGYFSAADALEMMLLSILAPTIRCIFRISAWKEAWITTVVFIGMMVGSSTWGWIADNFGRKFVIVLVSIWIAYFGLLSAFSPHYYWIIVLRMVVGLGIGGAPQSATLMSEFLPSKYRAMCMCIQSPWWTLGSLFTICVAMLVMPVYGWRYLLALLSLPMFLFLLLSPFLPESCRFQLASGDRDKALATLHRMARANKATLPTGFLKDANQNAKRGRILDLLKPELRRTTLMLWFLWFNVAFTYYGVVLMTSELF-------QSDSAGG----GKCEVKDPHCGCKLLTTKDYTDMMWTTLAEIPIVLVNIVLLERLGRRRTLALLYGLTATFYMLLFICTKREWMVAFIFGARGCISGVFTAIYIYTPEVVLPYRGATLGLGTCSAVARIGAMITPFICQVLL-RASVDFALGVYAATGLSCVVIALCLPIETKGRLM 466          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO39285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI8])

HSP 1 Score: 248.054 bits (632), Expect = 2.528e-74
Identity = 173/483 (35.82%), Postives = 261/483 (54.04%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTI--VFIGFFMGSFFWGMVSDNYGRKTTFLIV-------ISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTL--------LCEFLPSASRAKVLI-------AYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRL-ISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAM 1950
            +Y +  AVE    G FQ +LI +VG    ADA+EM+LLSIL P ++C WHL+S ++A +TT   VF+   M S   G +  +  R    +++        S+IS   F+   S   I    +RC V     G A + +L        L + L  + R   L+       +  +FWA GSTF V +A  V+P  GWRW++ +  +P++L   +  +LPES RFLL  G+ E + +++  M  +N KQ+ +G L  +S   ++  + +LFL++   T +LL I+WF + F+YYGIVL   E F         ST       G  +   +  C+ LG EDY  M+ ++  EF  + I  F++D +GRK T A    +T+ FF LL  C   +  T+ +F +RG  SG F   Y+YT EV+PT  R+   G CS  AR+ A++TPFVAQVL+ + S+ + + VY  ++ +C I+   LPIETKGR M
Sbjct:   11 SYNLSDAVEWIRFGPFQARLIAIVGFFVIADALEMMLLSILAPTIRCTWHLNSLEEAFITTYIPVFV-LIMFSVQTGNIQKSRWRPKGTIVLNRMQGNTKSIISIYHFLLGLSLRDILGYSIRC-VTLVFWGEARTVSLYVIFDELSLRDILRCSVRCVTLVFWGTRKVSLYIFWAVGSTFTVAVAMAVMPTLGWRWLLAILCLPLLLFLAMSKWLPESCRFLLAAGEREGAIQVLRDMCEMNKKQMPQGELKDASQNAKRGRVADLFLKDQWKTTILLWIIWFNLAFAYYGIVLTTTELFQ------TISTEGKCASSGKHSSKADCGCQLLGVEDYVDMMWTTLAEFPGVIITMFIIDKLGRKYTAALEFVITAVFFFLLIICTDRLTMTIFIFIVRGAISGAFQTFYVYTPEVYPTVTRALGLGCCSGIARVGAMITPFVAQVLLKE-SVALSMGVYGGMSVICIIASLMLPIETKGREM 484          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO39287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ0])

HSP 1 Score: 202.216 bits (513), Expect = 4.610e-58
Identity = 137/437 (31.35%), Postives = 230/437 (52.63%), Query Frame = 1
Query:  664 ADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGS--TFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLIS-SGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFS----YYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCM-PHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAM 1950
            ADAME+ +LSIL P ++CEW LS  Q A++TT+VFI F +GS   G + DN+GRK   ++    ++Y G +++FSP+Y W++ LR  VGFG+GG   +  LL E+ P   R   +++  V WA GS  T  VG+ +  +P  GWR  V   + P+++  +L  ++PE   FL+  G+ ++++K++ +M  +   +L  G L   S +V    + +L   EYR T LLL+  ++    S    YYG+VLL  +     + C            G++ F        L + D+ ++L ++  E   + +   + D +GRK  + +   + S  +  L+ C    ++    +F IRG       V   YTSEV+PT+ R++  G+ +   RI  ++ P ++QVL   +SM   + V      +C ++   LPIET+ R +
Sbjct:    2 ADAMEITMLSILVPYVKCEWDLSIVQVAMITTVVFIMFLVGSPTLGWMGDNFGRKPMLIVSSVAVAYAGLLSAFSPSYPWLLFLRGIVGFGLGGKCLNAALLVEYSPIKHRGATVMSLGVAWAIGSFMTSLVGMVF--VPWLGWRSFVVAITFPLVVFLILSKWIPEFSHFLITSGEKDEARKVLQEMARIQKAELPIGELQGLSHEVALGRVGDLLTPEYRLTTLLLIYFYYFYLLSYRGIYYGLVLLTTQIMTSGSHC-----------PGSVKFKTKLYTILLSTNDFTTLLWTTSAELPAMILTLAMADKVGRKTLLTTYFVIASICYCFLFICAGSRVFLAFNLFIIRGLLLAGNEVLICYTSEVYPTAFRATGLGLMNGIGRIGGVIAPLISQVL-ADSSMNAAIGVLLLFTALCTVTCYFLPIETRQREL 424          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO46087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR13])

HSP 1 Score: 110.538 bits (275), Expect = 1.329e-25
Identity = 116/430 (26.98%), Postives = 190/430 (44.19%), Query Frame = 1
Query:  718 EWHLSSE---QKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAA-SSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKV---QKFSIKNLFLQE--YRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPH------IWATVL-MFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            EW L  E   +  L+ +++  G  +G+  +G ++D YGR+  +   ++ +   GF +SF+PT+     LR   GF IGG   S+F L  E +  + R    I  Q F+  G      +AY +     WR +  + S+P  +  +   ++PES R+L+  G++ +++ I+  +   NG  + K  L  +       ++   +LF      + TF+L+ I WF  T  YYG+ L         NT                        K L  + Y +  L S  EF       F V+  GR+ T+ + + L     +      P         ATV  M G  G T+  F + YIY++E+FPT VR+   G+CS  +RI  I  PFV  V +      + +V++   AF+  +    LP ET  R +P+ 
Sbjct:   80 EWDLVCENAYKADLVQSLLMSGTLLGALMFGALADKYGRRRVWHTTLTGLVVFGFASSFAPTFKIYATLRFLTGFCIGGEILSAFVLATELVGPSYRGFAGIMAQCFFTLGLLILPMVAYLI---QDWRTLSVVLSLPASVFILFFRYVPESARWLMIRGRVSEAENILLDIALKNGIAVPKSLLQVNHPFFVGSRYGFFDLFCTRKIVKQTFVLIFI-WFVNTLVYYGLSL---------NT------------------------KHLAGDIYMNFFLCSLMEFPAYLTCLFFVNWAGRRKTLFNYMVLAGLACMACMFVQPESSPADRTLATVFAMIGKFGITAS-FALIYIYSAEIFPTVVRNVGLGVCSMSSRIGGICAPFV--VFLGTYMRPLPMVIFGMCAFMAGLLSLMLP-ETHKRPLPET 468          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO27505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T928])

HSP 1 Score: 94.3597 bits (233), Expect = 6.542e-23
Identity = 56/128 (43.75%), Postives = 80/128 (62.50%), Query Frame = 1
Query: 1561 INFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGR 1944
            I  F++D +GRK T A    +T+ FF LL  C   +  T+ +F +RG  SG F   Y+YT EV+PT  R+   G CS  AR+ A++TPFVAQVL+ + S+ + + VY  ++ +C I+   LPIETKGR
Sbjct:    3 ITMFIIDKLGRKYTAALEFVITAVFFFLLIICTDRLTMTIFIFIVRGAISGAFQTFYVYTPEVYPTVTRALGLGCCSGIARVGAMITPFVAQVLLKE-SVALSMGVYGGMSVICIIASLMLPIETKGR 129          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:101156331])

HSP 1 Score: 353.599 bits (906), Expect = 1.633e-113
Identity = 189/463 (40.82%), Postives = 276/463 (59.61%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
               T+ +E AVE  G G FQ KL ++ G+   ADAMEM++LSIL P L CEW L S + ALLT+ VFIG  + S  WG +SD YGRKT   + +    + G +++F+P Y W+++LR  VGFGIGGA  S TL  EFLP  SRA  ++  ++FWA G+ FEV LA  V+P  GWRW++GLS++P+ + A+L  +LPES R+ +  G  +K+   + ++ T NG  +  G+LI++ +  +  IK+LF   +RCT +LL  +WF   FSYYG+VLL  E F     C +       E R NL       CK L S+DYK +L ++  EF  + +  + +D +GR+ TMA    + S   + LY C+  +   VL+F  R   +G F   Y+YT EV+PT+ R+   G  S  AR+ A++TPFVAQV++ + S+ + L VY     +  ++   LPIET GR + +
Sbjct:   62 TDDTFMVEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSLEVALLTSAVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTMFYGILSAFAPIYGWILVLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLGLSTIPLFIFAILCFWLPESARYDVLTGNQDKALATLKRIATENGVPMPLGKLIAARQEDRGKIKDLFSSHFRCTTVLLWFIWFANAFSYYGLVLLTTELFQEGGACGRNKQ----ELRCNLE------CKYLTSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRRTMALCFLIFSLALIPLYGCVGRVSMMVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-EYSVYLALSVYCCCCLLAAVASCALPIETTGRGLQE 513          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopb (synaptic vesicle 2-related protein [Source:NCBI gene;Acc:101161175])

HSP 1 Score: 347.436 bits (890), Expect = 5.573e-111
Identity = 195/458 (42.58%), Postives = 276/458 (60.26%), Query Frame = 1
Query:  586 IEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            ++ A+E  G G FQ K+ ++ G+   ADAMEM++LSILGP L C+W L S Q AL+T++VFIG   GS  WG VSD YGRK    + +    Y G +++F+P Y W+++LR FVGFGIGGA  S TL  EFLP  +R   ++    FWA G+ FEV LA +V+P  GWRW++GLS++PM +      +LPESPRF +  G+ EK+   + ++   NGK + +G L    +  +  +K+LF  +Y  T LLL  LWF   FSYYGIVLL  E F   + C + +  A  E R +L       CK L S+DYK +L ++  EF  + +    +D +GRK +MA   F+ S   L L+ C+  I  T+ +F  R   SG + V ++YT EV+PT  R+ A G  S+ ARI A++TPFVAQVL+ + S+ V L VY +   V  I+   LPIET GR + ++
Sbjct:   73 VDDALEAIGFGVFQWKISLITGLAWVADAMEMMILSILGPELHCDWSLPSYQVALITSVVFIGMGFGSPVWGNVSDKYGRKVGLTVCMCWTLYYGILSAFAPIYGWLLVLRGFVGFGIGGAPQSVTLYTEFLPVKARGICIVLIGAFWAIGAVFEVLLALWVMPTLGWRWLLGLSALPMAVFVCFCFWLPESPRFDVLAGRREKAMATLVRIAKDNGKAMPQGTLTIYKQTNRGQLKDLFSPQYWKTTLLLWFLWFANAFSYYGIVLLTTELFQAGDLCAE-TQGAKIEPRCSLE------CKYLSSDDYKDLLWTTLAEFPGLLVILLAIDYMGRKKSMALCFFMFSLCILPLFACIGRIALTIFIFICRAFISGGYQVVFVYTPEVYPTETRALAMGTSSAIARIGALITPFVAQVLL-RRSVYVTLGVYCACGLVAGIASLLLPIETLGRGLQES 522          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 299.286 bits (765), Expect = 3.570e-93
Identity = 168/465 (36.13%), Postives = 265/465 (56.99%), Query Frame = 1
Query:  568 NTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQN 1959
            +  T+T+E AVE  G G F + L V++G  +  +AME++LL+++ P ++CEW L   Q AL++TIVF+GF +     G ++D +GR           +Y   +TSF+P+Y W I LR  VG G+ G +  F L  EF+P+  RA +L    +FW  GS   + L   V+P  GWRW++ +S  P I+   L  F+PES R+ ++ G ++ + K + ++  +N   L +GRL+      + S + L    +R T LLL   WF  +F+YYG VL ++E    +  C    T A  EH+         C C   G  DY+++L+S  GE  ++P+N  L+++ GRK +++    L +  F++L  C   +  TVL+F +R   S  FNV YIYT+EV+PT  RS   G C+SF+RI  ++ PF+AQVL+ + S+++ L  ++    +C +    LPIET+GRA+ QN
Sbjct:   46 HDKTFTVEDAVEEIGFGRFHVLLFVIMGSANVVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQGFVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRAGLPEGRLVEPAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCV---TNAEREHQVKHRHQGGVCYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSK-SVVLALSPFAVACVICALGNFLLPIETRGRALLQN 506          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 291.967 bits (746), Expect = 2.914e-90
Identity = 165/458 (36.03%), Postives = 260/458 (56.77%), Query Frame = 1
Query:  577 TYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSC-CKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRA 1947
            T+T+E AVE  G G F + L V++G  +  +AME++LL+++ P ++CEW L   Q AL++TIVF+GF +     G ++D +GR           +Y   +TSF+P+Y W I LR  VG G+ G +  F L  EF+P+  RA +L    +FW  GS   + L   V+P  GWRW++ +S  P I+   L  F+PES R+ ++ G ++ + K + ++  +N   L +GRL+      + S + L    +R T LLL   WF  +F+YYG VL ++E    +  C    T A  EH+         C C   G  DY+++L+S  GE  ++P+N  L+++ GRK +++    L +  F++L  C   +  TVL+F +R   S  FNV YIYT+EV+PT  RS   G C+SF+RI  ++ PF+AQVL+ + S+++ L  ++    +C +    LPIET+G A
Sbjct:   52 TFTVEDAVEEIGFGRFHVLLFVIMGSANVVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQGFVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRAGLPEGRLVEPAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCV---TNAEREHQVKHRHQGGVCYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSK-SVVLALSPFAVACVICALGNFLLPIETRGHA 505          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: sv2a (synaptic vesicle glycoprotein 2A [Source:NCBI gene;Acc:101164923])

HSP 1 Score: 119.783 bits (299), Expect = 1.410e-27
Identity = 93/347 (26.80%), Postives = 158/347 (45.53%), Query Frame = 1
Query:  589 EQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAAS-SFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVG-------------LSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKG---RLISSGKVQ-------------------KFSIK-------------NLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANF--EHRGNLTFH 1476
            E  ++  G G FQ  L  ++G+   AD +E+ ++  + P+ + +  LS   K +L  IV++G  +G+F WG ++D  GR+ T LI +S+ S   F +SF   Y   +  R   G GIGG+    F+   EFL    R + L    +FW  G  +   +A+ ++P YGW + +G             + + P +     +  +PESPRF L  GK +++  I+ ++   N +   KG   R+ S   ++                   K+ IK              +F  EYR T  +++ +WF ++FSYYG+ +   +          AS T  F  E   ++TF+
Sbjct:  149 ESILQECGHGKFQWTLYFVLGLALMADGVEIFVVGFVLPSAEKDMCLSEPNKGMLGLIVYLGMMVGAFVWGGLADRIGRRQTLLISLSINSVFAFFSSFVQGYSSFLFCRLASGVGIGGSIPIVFSYYSEFLAQEKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAISALSTMPESPRFYLENGKHDEAWMILKQVHDTNMR--AKGCPERVFSVTTIKTVKPMDELVNMGDGAAWHAKWRIKLTTLFHQVWNNFLTIFNPEYRRTTYMMMAVWFSMSFSYYGLTVWFPDMIKYLQKQEYASRTKVFVKEKVEHMTFN 493          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000019460.1 (SMESG000019460.1)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 499/500 (99.80%), Postives = 500/500 (100.00%), Query Frame = 1
Query:  466 MEVECXXXXXXXXXXXXXXXXXXXXXXXXXXTEYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNFK 1965
            MEVECDDLNYPNNHNNMPDNNDNSNNKD+IDTEYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMASSLFLTSAFFLLLYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNFK
Sbjct:    1 MEVECDDLNYPNNHNNMPDNNDNSNNKDSIDTEYNTTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMASSLFLTSAFFLLLYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNFK 500          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000000088.1 (SMESG000000088.1)

HSP 1 Score: 284.648 bits (727), Expect = 5.207e-88
Identity = 164/465 (35.27%), Postives = 261/465 (56.13%), Query Frame = 1
Query:  574 TTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASS-FTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTT---ANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            ++ TIE A+   GLG F L L++ +G++ + D+MEML+L+ LGP L C W +S  + + LTT VF+G  +G+   G  SD +GRK T ++  S + Y G   + SPT  W+I+LRC +G  IGG   + ++LL E  P   R  + +  Q FWACGS     L + ++ +YGWR  + LS++P+I+  V + ++ ESPR+LL   +  K+ +IINK+  +N  +++    + +  V   S K+L    Y  T      +W     SYY  +L+      + + C Q   T    + +   N T  D+SCC E+  + YK+M +S+ GE  +IPI+  L++ +GRK T++  + + S     L  CM  +  + ++F IRG    ++NV +IY +EV+PTSVRS + GM SSF+RI AI++PF   +L  Q S   G ++ +    +  +    LP ETK R + Q
Sbjct:    3 SSETIESALSKIGLGKFHLILMLTLGLIHSCDSMEMLILAFLGPILSCHWRISVIEASFLTTAVFLGIIVGNSLLGKFSDRFGRKMTLILTNSCLLYFGLFCAASPTVYWIIILRCLIGVCIGGNNCNIYSLLSEMSPVQYRGTLQVLLQFFWACGSLIITLLCFLIVHKYGWRLFLSLSTIPVIIVLVSLFWIYESPRYLLLRNQKSKALEIINKIAVINHSEIITD--LCNQPVLTSSFKDLIHSNYLLTTFYTSFIWLNTGLSYYSTILIVPIIMGIPHQCLQNWKTFSQLSIQINVNKTV-DDSCCFEMNWDSYKNMFISTAGEIVVIPISIILINYVGRKRTLSIYMLVISIGTFCLNFCMSSLALSAVLFIIRGAVKSLYNVIFIYCAEVYPTSVRSLSLGMGSSFSRIGAIISPFFVNILFAQYSFFGGTMLLALTNAIGLVISFFLPYETKDRELFQ 464          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000000254.1 (SMESG000000254.1)

HSP 1 Score: 278.87 bits (712), Expect = 5.885e-86
Identity = 160/462 (34.63%), Postives = 264/462 (57.14%), Query Frame = 1
Query:  589 EQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASS-FTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKF---SIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTAN--FEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            ++A+    +G F   L++++G++ + DA EML+LS LGP L C W ++  +   L T+VFIG F GS  +G  SD YGRKT  L   S + + G ++  +PT  W+I++R F+G  IGG +SS ++LL E+ PS  R   ++  Q FW  GS F   + + ++PR  WR  + ++++P+    + ++++PESPR+LL   +  K  ++IN+M   N  +    R IS  K       S ++L    Y  T  L+ ++WF    +YYG++L+      + + C Q  +  +   +++ N+T  DNSCC ++ + DY++MLLS+ GE   +PI+   ++ +GRK T      +     L L  C+     ++L+F  RG      N  YIYT+EVFPTS+RS ATG C+S++RI  I++PF+  ++I Q S + G +++ ++ F+  I    LP ETK R + Q
Sbjct:    8 DEALNEIKIGKFHFILLLILGIIHSCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVFIGIFFGSPIFGKFSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMIIIRFFIGVFIGGNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRIFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSE----RRISDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTI-DNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 464          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000071239.1 (SMESG000071239.1)

HSP 1 Score: 249.98 bits (637), Expect = 7.504e-75
Identity = 161/464 (34.70%), Postives = 252/464 (54.31%), Query Frame = 1
Query:  583 TIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILLRCFVGFGIGGAASSFTLLC-EFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKF-----SIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            ++E+     G G FQ+ ++++ G+L A DAMEML+L  LG  L C W +++ Q+  LTT VFIG  +G    G +SD YGRKT  ++    + Y   +++F PT  W++ +R  +G  + G   S + L  E LP+  R   L+    FW  GS F   L+  ++P YGWR  + +S +P+     L L++PESPRFLL   +   S  I+N++   N   ++K  + +  K  K      S+ +     Y  T +L  ILW     SYY I++L      +   C +     + ++  ++T +DNSCC +L  E YK + +S+ GE   + I+ F+++++ RK  MA    +T   ++ L  C+ +   T L+F IRG    +FN+ YIYTSEVFPTS+RS A G+C   ARI  IL+PF+  +LI + S + G ++   +  + F  V  LP ETK R + Q
Sbjct:    7 SLEETFTRIGWGRFQILVVILCGILQAFDAMEMLVLVFLGQILSCTWQITTFQETFLTTSVFIGAMIGGITIGNLSDKYGRKTVLVMSSGCLIYFSMLSAFVPTIEWLMGIRLLIGVCLAGIMVSMSALASELLPTNYRGTALVIILGFWPIGSYFLTTLSMLIVPYYGWRVFLLVSIIPLFCSIPLFLWIPESPRFLLLSDRRSDSLAILNRISRFNKSYVIK-EIKTENKNSKNVSFCQSVTSFAHSNYLSTTILTNILWAISGISYYSIIILIPAVNVIPRHCLETIEGVSKDYNSSITDNDNSCCTDLNWESYKELYISTSGELLFLVISVFMMEILPRKVIMALLSSITGFGYIFLNLCLTNFGTTFLLFSIRGAIFTMFNLNYIYTSEVFPTSIRSLAMGVCYFSARIGCILSPFLVYMLIAKYSFVFGTLLLGGLNIMAFFLVLFLPYETKNRKLYQ 469          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000047712.1 (SMESG000047712.1)

HSP 1 Score: 240.35 bits (612), Expect = 3.061e-71
Identity = 160/467 (34.26%), Postives = 261/467 (55.89%), Query Frame = 1
Query:  571 TTTYTIEQAVETAGLGWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIVFIGFFMGSFFWGMVSDNYGRKTTFLIV-ISLISYNGFITSFSPTYIWVILLRCFVGFGIGG-AASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAYFVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIINKMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTFSYYGIVLLNAEFFNLHNTCYQAS---TTANFEHRGNLTFHDNSCCKELGSEDYKSMLLSSFGEFFIIPINFFLVDLIGRKGTMXXXXXXXXXXXXXXYKCMPHIWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAILTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQ 1956
            T   +IE A+   G+G F   L++++G++ + DAMEM++L  LGP L C W +++ +   LT  V  G  +G+  +G  SD YGRK T +I  I LI + GF++  SPT IW+ ++R  +GF IGG +AS + L+ E  P   R  +L  +Q FWA GS     +++ + P YGWR+++  + +P  +  + +L++PESPR+LL   K   S  ++NK+  +N   L+    I     +K S ++L    Y  + +++  + F V  +Y  ++L+   F ++ + C Q     +    + + N+   D+SCC ++    YK++L+S+ GE  I+PI   L++LIGRK T+A +  + S   L L  C+  +   +L+F IRG      +V  IY +E+FPTS+RS   G+C   ARI AIL+ F+  + I QTS I G V+   +  +  +    LP ETK R + Q
Sbjct:    2 TEVNSIEDAINEIGIGKFHFILLIIMGIIHSCDAMEMMILVFLGPFLSCTWRITAIESTFLTAAVIFGIMIGAVNFGKFSDEYGRKKTLIISNIGLIIF-GFLSVISPTIIWLTIIRFLIGFSIGGNSASQYALMSELTPINFRGTLLTCFQFFWALGSYLITIVSFLIFPLYGWRFVLVFALIPAFVILLSLLWVPESPRYLLLKNKKFASLDVLNKIAKMNNAHLITN--IKEMTFKKSSFRDLIHPNYLPSIIIICFMLFVVGLTYCSVLLIIPIFDSIPHRCLQDMKRFSEPLKDSKNNII--DDSCCFQMTWNTYKNLLISTTGELLILPIALILINLIGRKMTLAINSIVISFGILSLNLCLSSLSLNILLFFIRGSLMSFSSVGIIYATELFPTSIRSLGIGLCGFCARIGAILSAFLVNIFIAQTSFIGGTVILCILNAIVLVLSYLLPYETKNRKLFQ 463          
The following BLAST results are available for this feature:
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOP5.281e-11742.46SV2 related protein [Source:HGNC Symbol;Acc:HGNC:2... [more]
SVOPL1.709e-9435.36SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL6.824e-5833.73SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL6.824e-5833.73SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL8.504e-5333.55SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svop-14.298e-10240.38Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
svop-14.298e-10240.38Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
oct-25.613e-2225.43Organic Cation Transporter [Source:UniProtKB/TrEM... [more]
oct-21.525e-2124.46Organic Cation Transporter [Source:UniProtKB/TrEM... [more]
F45E10.21.620e-1721.89pep chromosome:WBcel235:II:11052140:11054578:-1 ge... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43242.709e-8535.53gene:FBgn0034956 transcript:FBtr0343347[more]
CG43242.709e-8535.53gene:FBgn0034956 transcript:FBtr0072197[more]
CG31686.071e-3625.88gene:FBgn0029896 transcript:FBtr0340268[more]
CG31686.071e-3625.88gene:FBgn0029896 transcript:FBtr0340266[more]
CG31686.071e-3625.88gene:FBgn0029896 transcript:FBtr0340267[more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa1.439e-10740.09SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
svopa1.791e-10740.09SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
svopl1.592e-9837.96SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl1.592e-9837.96SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl1.271e-9737.96SVOP-like [Source:NCBI gene;Acc:492766][more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOP1.295e-11442.03SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP4.262e-11441.81SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP5.348e-11442.24SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP5.282e-11241.81SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP5.287e-9939.74SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svop2.954e-11242.67SV2 related protein [Source:MGI Symbol;Acc:MGI:191... [more]
Svopl7.395e-9234.83SV2 related protein homolog (rat)-like [Source:MGI... [more]
Slc22a72.642e-2826.15solute carrier family 22 (organic anion transporte... [more]
Slc22a74.522e-2825.98solute carrier family 22 (organic anion transporte... [more]
Svop1.399e-2750.00SV2 related protein [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1JP63|SVOP_BOVIN1.114e-11642.46Synaptic vesicle 2-related protein OS=Bos taurus O... [more]
sp|Q8N4V2|SVOP_HUMAN2.536e-11642.46Synaptic vesicle 2-related protein OS=Homo sapiens... [more]
sp|Q5R5T8|SVOP_PONAB2.822e-11642.46Synaptic vesicle 2-related protein OS=Pongo abelii... [more]
sp|Q2XWK0|SVOP_XENLA9.342e-11641.81Synaptic vesicle 2-related protein OS=Xenopus laev... [more]
sp|Q9Z2I7|SVOP_RAT5.162e-11242.46Synaptic vesicle 2-related protein OS=Rattus norve... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GPA23.098e-14950.22MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267E6E21.651e-14850.11MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267E8812.233e-14850.00MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A3Q0KSV11.676e-14650.53Putative sugar transporter OS=Schistosoma mansoni ... [more]
A0A0X3PAK12.963e-14647.23MFS domain-containing protein OS=Schistocephalus s... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa4.965e-11341.16SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopa4.340e-11241.16SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopl4.005e-7535.14SVOP-like [Source:NCBI gene;Acc:492766][more]
sv2bb1.391e-3228.31synaptic vesicle glycoprotein 2B-like [Source:NCBI... [more]
sv2bb1.566e-3228.31synaptic vesicle glycoprotein 2B-like [Source:NCBI... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl9.223e-11040.60SVOP-like [Source:NCBI gene;Acc:492766][more]
oct28.957e-2525.47organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000001436.13.835e-2127.94pep scaffold:Pmarinus_7.0:GL476665:296817:321845:1... [more]
SLC22A71.192e-1226.40solute carrier family 22 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000007303.11.921e-1025.51pep scaffold:Pmarinus_7.0:GL479716:670:30774:1 gen... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ITR11.142e-1025.54Myo-inositol transporter; member of the sugar tran... [more]
CIN102.565e-1029.30Putative transporter; member of the sugar porter f... [more]
PHO843.493e-1023.01High-affinity inorganic phosphate (Pi) transporter... [more]
ITR22.784e-926.38Myo-inositol transporter; member of the sugar tran... [more]
HXT131.696e-825.11Putative transmembrane polyol transporter; support... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413521.416e-10540.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392852.528e-7435.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392874.610e-5831.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460871.329e-2526.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275056.542e-2343.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa1.633e-11340.82SV2 related protein [Source:NCBI gene;Acc:10115633... [more]
svopb5.573e-11142.58synaptic vesicle 2-related protein [Source:NCBI ge... [more]
svopl3.570e-9336.13SVOP like [Source:NCBI gene;Acc:101157836][more]
svopl2.914e-9036.03SVOP like [Source:NCBI gene;Acc:101157836][more]
sv2a1.410e-2726.80synaptic vesicle glycoprotein 2A [Source:NCBI gene... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019460.10.000e+099.80SMESG000019460.1[more]
SMESG000000088.15.207e-8835.27SMESG000000088.1[more]
SMESG000000254.15.885e-8634.63SMESG000000254.1[more]
SMESG000071239.17.504e-7534.70SMESG000071239.1[more]
SMESG000047712.13.061e-7134.26SMESG000047712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019041 ID=SMED30019041|Name=Synaptic vesicle 2-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2122bp
AGCATAACGTGAAGGTTAATTTTGATTCCATAAAAAGAATAAACCATGAA
AAGATCCAAACGCTACAATAGACATGAAAGCCTAATTTCATATTCAGTTC
TATCCTTACTGTCAAAATTATTTCAAATTGACAAGTGGAAGTCTTTGAAA
TATTGGAAGAGTCACCTGGACTATGATGATTCATGCTGGACATCGAAATT
TTTTTTGTCAGGACCAGCTACACAATACTTAGAACAAAAGATGGCTTTCT
TACAATTCTTGTATCATAAAATCAAATTTCTCAAAACTATGGTGGTTTTT
GGATGTGTCTCCAACGAGGGTGATGTTATGCTCCTTCATATTTTGGGCGG
TGTATCAAGCTCAATTCGAGTATCAGCAATATTCAGCTCCCTGCCATACC
TCTTAGAAGCCTTCTGAAGTGGTTGTCAGAGAATCTTGCCTAACACAAAG
AGTCGCAATTTGCTTATGGAAGTGGAATGTGACGATTTAAATTATCCAAA
CAATCACAATAATATGCCAGATAATAATGATAATAGTAATAATAAGGATA
ACATTGATACGGAGTACAATACTACGACTTATACGATTGAACAAGCAGTG
GAAACTGCAGGATTGGGATGGTTTCAGTTAAAGTTGATCGTCATGGTGGG
AGTTTTGTCGGCCGCCGATGCAATGGAAATGCTTCTTCTGTCGATATTGG
GTCCGGCATTGCAATGCGAATGGCATTTGTCATCAGAGCAAAAGGCTCTT
TTAACAACAATTGTTTTCATTGGCTTTTTCATGGGTTCTTTCTTTTGGGG
TATGGTATCAGATAATTATGGTCGTAAAACTACATTCCTTATTGTGATAT
CTTTAATTTCATATAATGGATTTATTACGTCTTTCAGCCCAACTTATATT
TGGGTGATACTGTTGAGATGCTTTGTAGGATTCGGCATCGGTGGAGCCGC
TAGCAGCTTTACATTGTTATGTGAATTCTTACCATCTGCCAGTCGAGCTA
AAGTTTTGATAGCATATCAGGTGTTTTGGGCCTGTGGTAGCACATTTGAA
GTAGGACTCGCATATTTTGTCCTGCCAAGGTATGGCTGGAGGTGGATTGT
TGGTCTATCATCAGTACCAATGATTTTATGTGCAGTACTAGTTTTGTTCC
TCCCAGAATCTCCTAGATTCTTATTAAACGTTGGAAAATTAGAAAAATCT
CAGAAAATCATCAACAAAATGCTCACAGTCAATGGTAAACAATTAATGAA
GGGAAGATTAATATCAAGTGGTAAAGTTCAGAAATTCAGTATCAAAAATT
TGTTTTTACAAGAATACCGTTGTACATTTCTTTTGCTCTTGATTCTTTGG
TTCGGTGTTACTTTCAGTTACTATGGAATTGTTTTACTGAATGCAGAGTT
TTTCAATCTTCACAACACTTGTTATCAAGCTTCTACGACTGCGAACTTTG
AGCATCGAGGCAATTTAACATTCCATGACAATTCTTGCTGCAAAGAATTA
GGAAGTGAAGATTACAAATCAATGCTGTTAAGTTCATTCGGTGAATTCTT
CATTATTCCAATCAATTTCTTTCTAGTGGATTTAATTGGCCGAAAAGGAA
CAATGGCCAGTTCTCTCTTTTTGACGTCAGCATTTTTTTTACTTTTATAC
AAATGCATGCCGCATATTTGGGCAACCGTTCTCATGTTCGGAATTCGTGG
CTGTACTTCTGGAATTTTCAATGTCACTTATATTTATACTTCAGAAGTAT
TTCCAACAAGTGTTCGGTCATCTGCGACAGGAATGTGTAGCTCATTTGCT
AGAATCGCAGCTATACTTACACCTTTCGTAGCTCAAGTTTTAATTCCTCA
AACATCAATGATTGTAGGACTCGTTGTCTATTCGTCAGTGGCTTTCGTTT
GTTTTATTTCCGTAGCTTGCTTGCCAATTGAAACAAAGGGTCGAGCAATG
CCGCAAAACTTTAAAGAAATAGAGATTGAAATGGAAACCAAATAATAAAT
CCCGATTTTTACGTGGACTTACGAAGTTCAATTGAATCACAGAGTAATAT
GTGCTATATAATTATTTTTCATGATGTATTTTTGTTGTGGATCTATTTTC
TCAAACACGTGCCTCTTTGATA
back to top

protein sequence of SMED30019041-orf-1

>SMED30019041-orf-1 ID=SMED30019041-orf-1|Name=SMED30019041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MKRSKRYNRHESLISYSVLSLLSKLFQIDKWKSLKYWKSHLDYDDSCWTS
KFFLSGPATQYLEQKMAFLQFLYHKIKFLKTMVVFGCVSNEGDVMLLHIL
GGVSSSIRVSAIFSSLPYLLEAF*
back to top

protein sequence of SMED30019041-orf-2

>SMED30019041-orf-2 ID=SMED30019041-orf-2|Name=SMED30019041-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=510bp
MEVECDDLNYPNNHNNMPDNNDNSNNKDNIDTEYNTTTYTIEQAVETAGL
GWFQLKLIVMVGVLSAADAMEMLLLSILGPALQCEWHLSSEQKALLTTIV
FIGFFMGSFFWGMVSDNYGRKTTFLIVISLISYNGFITSFSPTYIWVILL
RCFVGFGIGGAASSFTLLCEFLPSASRAKVLIAYQVFWACGSTFEVGLAY
FVLPRYGWRWIVGLSSVPMILCAVLVLFLPESPRFLLNVGKLEKSQKIIN
KMLTVNGKQLMKGRLISSGKVQKFSIKNLFLQEYRCTFLLLLILWFGVTF
SYYGIVLLNAEFFNLHNTCYQASTTANFEHRGNLTFHDNSCCKELGSEDY
KSMLLSSFGEFFIIPINFFLVDLIGRKGTMASSLFLTSAFFLLLYKCMPH
IWATVLMFGIRGCTSGIFNVTYIYTSEVFPTSVRSSATGMCSSFARIAAI
LTPFVAQVLIPQTSMIVGLVVYSSVAFVCFISVACLPIETKGRAMPQNFK
EIEIEMETK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 73..304
e-value: 1.2E-30
score: 106.7
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 54..492
e-value: 2.2E-72
score: 246.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 9..26
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..26
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 32..495
NoneNo IPR availablePANTHERPTHR24064:SF457TRANSPORTER SVOPL-RELATEDcoord: 32..495
NoneNo IPR availableCDDcd17372MFS_SVOP_likecoord: 59..486
e-value: 7.90806E-107
score: 321.406
NoneNo IPR availableTMHMMTMhelixcoord: 442..461
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 94..113
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 381..403
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 466..488
NoneNo IPR availableTMHMMTMhelixcoord: 352..374
NoneNo IPR availableTMHMMTMhelixcoord: 153..175
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 353..489
e-value: 7.9E-13
score: 48.0
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 57..491
score: 33.071
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 43..496