cytochrome P450 3A29

Overview
Namecytochrome P450 3A29
Smed IDSMED30019040
Length (bp)1909
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytochrome P450 3A29 (SMED30019040) t-SNE clustered cells

Violin plots show distribution of expression levels for cytochrome P450 3A29 (SMED30019040) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytochrome P450 3A29 (SMED30019040) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytochrome P450 3A29 (SMED30019040) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019040

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019040SMESG000060689.1 PL06016A2C01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30019040SMESG000060689.1 dd_Smed_v4_3106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019040SMESG000060689.1 dd_Smed_v4_3106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30019040SMESG000060689.1 SMED30019040smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019040SMESG000060689.1 SMED30019040smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytochrome P450 3A29 vs. Ensembl Human
Match: CYP3A4 (cytochrome P450 family 3 subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:2637])

HSP 1 Score: 241.891 bits (616), Expect = 6.752e-72
Identity = 157/534 (29.40%), Postives = 276/534 (51.69%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP P    GN++ Y    F    ++  K++GKV+ +++G  P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ +A  + WKRLR+ ++P F+  K++ M P++ +     V  L    +     + +++     +MD+I   +FGV+ D   N   PF+ + KK L+   L     ++      + P L+ +LE  N     R     +R ++ ++ E+R + ++K R D LQ++ID++                                         +S + ++ K L+  E++AQ+ +F+FAGYET+S+ LSFI++ L+ +PDVQ KL +EI  +   + +K+  +   YD + ++ YL+ ++ ETLR +P A   + R+C K       NG++IP+G  V+   +A+H D   WT  +P  F PERF + N   +      +P+ + PFG+GPRNCIG RFA+M ++  L + +  F     ++T+ PLKL +G  + P   V + ++ R+ 
Sbjct:   35 KLGIPGPTPLPFLGNILSYHKG-FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIT-----VFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQ-----------------------------------------NSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAV---LPNKAPPT---YDTVLQMEYLDMVVNETLRLFPIAMR-LERVCKKDVEI---NGMFIPKGVVVMIPSYALHRDPKYWT--EPEKFLPERFSKKNKDNI------DPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDG 498          
BLAST of cytochrome P450 3A29 vs. Ensembl Human
Match: CYP3A5 (cytochrome P450 family 3 subfamily A member 5 [Source:HGNC Symbol;Acc:HGNC:2638])

HSP 1 Score: 239.58 bits (610), Expect = 4.931e-71
Identity = 158/534 (29.59%), Postives = 273/534 (51.12%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            +  IPGP P  L GN++ YR    ++   +  K++GK++  +EG  P + I DPD+++ V+VK+ +S F  R+       P    K ++ LA  + WKR+R+ ++P F+  K++ MFP++ +     V  L    +K    + +++     +MD+I   +FGV+ D   N   PF+ S KKFLK   L  L  +++L      P L  + EA N     +  +  +  ++ ++ ++R    +K R D LQ++ID++                                         +S + ++ K L+  E+ AQ+ +F+FAGYET+S+ LSF L+ L+ +PDVQ KL +EI  +   + +K+  +   YDA+ ++ YL+ ++ ETLR +P A   + R C K       NG++IP+G+ V+   +A+H+D   WT  +P  F PERF +   +        +P+ + PFG GPRNCIG RFA+M ++  L + +  F     ++T+ PLKL     + P   + + +  R+ 
Sbjct:   35 RLGIPGPTPLPLLGNVLSYRQG-LWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSL----GPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKG-KPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILF-----PFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQ-----------------------------------------NSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAV---LPNKAPPT---YDAVVQMEYLDMVVNETLRLFPVA-IRLERTCKKDVEI---NGVFIPKGSMVVIPTYALHHDPKYWT--EPEEFRPERFSKKKDSI-------DPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDG 497          
BLAST of cytochrome P450 3A29 vs. Ensembl Human
Match: CYP3A7 (cytochrome P450 family 3 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2640])

HSP 1 Score: 233.802 bits (595), Expect = 8.214e-69
Identity = 153/534 (28.65%), Postives = 272/534 (50.94%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP P    GN + +R   ++   ++  K++ KV+  ++   P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ +A  + WKR+R+ ++P F+  K++ M P++ +     V  L    +     + ++      +MD+I   +FGV  D   N   PF+ + KK L+   L     ++     ++ P L  +LEA N     R  +  +  ++ Q+ E R K ++K R D LQ++ID++                                         +S   +T K L+  E++AQ+ +F+FAGYET+S+ LSFI++ L+ +PDVQ K+ +EI  +   + +K+  +   YD + +L YL+ ++ ETLR +P A   + R+C K       NG++IP+G  V+   + +H+D   WT  +P  F PERF + N   ++      P+ + PFG+GPRNCIG RFA++ ++  L + +  F     ++T+ PLKL++G  + P   + + ++ R+ 
Sbjct:   35 KLGIPGPTPLPFLGNALSFRKG-YWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSI-----KVFPFLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQ-----------------------------------------NSKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTV---LPNKAPPT---YDTVLQLEYLDMVVNETLRLFPVAMR-LERVCKKDVEI---NGMFIPKGVVVMIPSYVLHHDPKYWT--EPEKFLPERFSKKNKDNID------PYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRLGGLLQPEKPIVLKVESRDG 498          
BLAST of cytochrome P450 3A29 vs. Ensembl Human
Match: CYP3A4 (cytochrome P450 family 3 subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:2637])

HSP 1 Score: 230.72 bits (587), Expect = 2.800e-67
Identity = 161/559 (28.80%), Postives = 280/559 (50.09%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERF----LQSN--------GTELEFIGPP-------------NPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP P    GN++ Y    F    ++  K++GKV+ +++G  P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ +A  + WKRLR+ ++P F+  K++ M P++ +     V  L    +     + +++     +MD+I   +FGV+ D   N   PF+ + KK L+   L     ++      + P L+ +LE  N     R     +R ++ ++ E+R + ++K R D LQ++ID++                                         +S + ++ K L+  E++AQ+ +F+FAGYET+S+ LSFI++ L+ +PDVQ KL +EI  +   + +K+  +   YD + ++ YL+ ++ ETLR +P A   + R+C K       NG++IP+G  V+   +A+H D   WT  +P  F PER     LQS+        G +L   G               +P+ + PFG+GPRNCIG RFA+M ++  L + +  F     ++T+ PLKL +G  + P   V + ++ R+ 
Sbjct:   35 KLGIPGPTPLPFLGNILSYHKG-FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIT-----VFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQ-----------------------------------------NSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAV---LPNKAPPT---YDTVLQMEYLDMVVNETLRLFPIAMR-LERVCKKDVEI---NGMFIPKGVVVMIPSYALHRDPKYWT--EPEKFLPERLEKRKLQSSTIPTTYDEGHQLCPYGSSVSKIFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDG 529          
BLAST of cytochrome P450 3A29 vs. Ensembl Human
Match: CYP3A7 (cytochrome P450 family 3 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2640])

HSP 1 Score: 229.565 bits (584), Expect = 3.113e-67
Identity = 151/519 (29.09%), Postives = 264/519 (50.87%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATI 1680
            K  IPGP P    GN + +R   ++   ++  K++ KV+  ++   P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ +A  + WKR+R+ ++P F+  K++ M P++ +     V  L    +     + ++      +MD+I   +FGV  D   N   PF+ + KK L+   L     ++     ++ P L  +LEA N     R  +  +  ++ Q+ E R K ++K R D LQ++ID++                                         +S   +T K L+  E++AQ+ +F+FAGYET+S+ LSFI++ L+ +PDVQ K+ +EI  +   + +K+  +   YD + +L YL+ ++ ETLR +P A   + R+C K       NG++IP+G  V+   + +H+D   WT  +P  F PERF + N   +      +P+ + PFG+GPRNCIG RFA++ ++  L + +  F     ++T+ PLKL+ G  +
Sbjct:   35 KLGIPGPTPLPFLGNALSFRKG-YWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSI-----KVFPFLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQ-----------------------------------------NSKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTV---LPNKAPPT---YDTVLQLEYLDMVVNETLRLFPVAMR-LERVCKKDVEI---NGMFIPKGVVVMIPSYVLHHDPKYWT--EPEKFLPERFSKKNKDNI------DPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLL 483          
BLAST of cytochrome P450 3A29 vs. Ensembl Celegans
Match: cyp-13A2 (Putative cytochrome P450 CYP13A2 [Source:UniProtKB/Swiss-Prot;Acc:Q27518])

HSP 1 Score: 231.106 bits (588), Expect = 3.930e-68
Identity = 158/501 (31.54%), Postives = 260/501 (51.90%), Query Frame = 1
Query:  211 LIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRF--------DLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSREL-YDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            L +W K++GKV+ Y +G    +V+ DP ++ E+ VKQF NF+GRKL P+Q NP+++++V +  A+G RWKRLRT  + +FS+A +++M   V++S    +  + E+     + I++  + Q  TMD+I + A G  TD     N P +      ++E+   + K  ++L      P+  ++ +   + P  R+   K+ S +  V+ AR    E+          D + + +DA                +D+   + AE++ D            S    K +K L+ +EV+ Q  LFL  G++T++ +LS++ + L+V P +Q+K+ +EI+R          G+ E+ ++ LGRL Y++ +I E LR YP AS    R C+K   T   NG+ I  G +V  + +++HYD ++W   D   F PER+  S    LE  G     A+LPFG GPR CIG R A+M  +  L   +  +   +  KT  PLKL   AT SP
Sbjct:   59 LGEWTKKYGKVYGYTDGTQRTLVVADPAMVHEIFVKQFDNFYGRKLNPIQGNPEKEQRVHLLAAQGYRWKRLRTISSQSFSNASLKKMKRTVEDSALELLRHI-EKQTAGGEQIDMLRFYQEYTMDVIGRFAMG-QTDSMMFKN-PIV----NVVREIFCGSRKN-LMLICQVFPPIGQFIRDLTFKFP--RIPAFKLYSIMQDVVAARIAQREREKGAESGEPQDFIDLFLDAR---------------SDDVDFS-AEAREDF-----------SKRNLKITKELSADEVVGQCFLFLIGGFDTTALSLSYVTYLLAVNPKIQEKVIEEIAR--------EFGTSEVEFEKLGRLKYMDCVIKEALRLYPLASISNSRKCMK---TTTVNGVKIEAGVYVQMDTWSLHYDPELWGE-DVKEFKPERW--STDEPLEHKG-----AYLPFGLGPRQCIGMRLAIMEQKILLTHLLKNYTFETGNKTRIPLKLVGSATTSP 503          
BLAST of cytochrome P450 3A29 vs. Ensembl Celegans
Match: cyp-13A3 (Putative cytochrome P450 CYP13A3 [Source:UniProtKB/Swiss-Prot;Acc:Q27517])

HSP 1 Score: 228.024 bits (580), Expect = 7.394e-67
Identity = 170/543 (31.31%), Postives = 263/543 (48.43%), Query Frame = 1
Query:  136 NIPGPPPNFLFG--NLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEAR---RKCSEKRF--------DLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
             I GP     FG  N  +     +   L  W KE+G ++ + +G    +V+ DP+ + EV VKQF NF+ RK  P+Q +PD+D ++ +  ++G RWKRLRT  +P FS+  +R++F  V+ES+A  +  L E+G      I+I EY Q  TMDII K A G          +P++  ++           +  ++  +  I P    +   F  +      +  +  TL   +  R   R   EK          D + + +D +       D D L    D T    A SQ                   K  K LT +E+I Q  +FL AGY+T++ +LS+  + L+ +P++Q KL +E+ R   +  D  +     +D L +L Y+  +I ETLR YP AS V +R C+KS       G+ I +GT V  + + +HYD   W   + + F PER+ +S   +    G     A+LPFG GPR CIG R A M  +  L Q + ++ + +T +T  PLKL   AT +P N V++ LK R+S
Sbjct:   30 GIKGPRGLPFFGIINAFQSYEKPWILRLGDWTKEYGPMYGFTDGVEKTLVVSDPEFVHEVFVKQFDNFYARKQNPLQGDPDKDPRIHLVTSQGHRWKRLRTLASPTFSNKSLRKIFSTVEESVAEMMRHL-EKGTAGGKTIDILEYYQEFTMDIIGKIAMGQSGSMM--FENPWLDKIRAIF------NTRGNIIFIICGIVPFTGSIFRWFFSKVPTAQTVTSLMHTLEIALTKRVEQRAADEKAGIESSGEPQDFIDLFLDVQA------DTDFL---EDETKNGFARSQIV-----------------KVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLARHPEIQKKLQEEVDR---ECPDPEV----TFDQLSKLKYMECVIKETLRLYPLASIVHNRKCMKSTTVL---GMKIEEGTNVQADTWTLHYDPKFWGE-NANEFKPERW-ESGDEQAVAKG-----AYLPFGLGPRICIGMRLAYMEEKMLLAQILKKYSLETTFETHIPLKLVGIATTAPTN-VHLKLKPRHS 519          
BLAST of cytochrome P450 3A29 vs. Ensembl Celegans
Match: cyp-13A7 (Putative cytochrome P450 CYP13A7 [Source:UniProtKB/Swiss-Prot;Acc:Q27519])

HSP 1 Score: 221.09 bits (562), Expect = 2.445e-64
Identity = 164/513 (31.97%), Postives = 258/513 (50.29%), Query Frame = 1
Query:  217 KWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKP-VLVYLLEAFNQRPGQRVELMKIRSTLVQVIEAR---RKCSEKRF--------DLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
            +W K++G V+   EG    +VI DP+ + EV VKQF NF+GRKL  +Q +P+++++V +  A+G RWKRLRT  +P FS+  +R++   V+ES+   V  L E+   +   +++ EY Q  TMDII K A G +        +P +  +K   KE   +      V  ++ I P V + L   F + P  ++    I+S L + +  R   R+  EK          D + + +DA                       + E++ D             S   K  K LT +E+I Q  +FL AGY+T++ +LS+  + L+ +P++Q KL +E+ R   +  D  +     +D L +L YL  ++ E LR YP AS V +R CLK+       G+ I  GT +  + +++H+D  +W   D + F PER+   +G EL F        +LPFG GPR CIG R AMM ++  L   +  +   +T +T  PLKL   ATI+P + V + LK R
Sbjct:   59 EWTKKYGPVYGITEGVEKTLVISDPEFVHEVFVKQFDNFYGRKLTAIQGDPNKNKRVPLVAAQGHRWKRLRTLASPTFSNKSLRKIMGTVEESVTELVRSL-EKASAEGKTLDMLEYYQEFTMDIIGKMAMGQEKSLM--FRNPMLDKVKTIFKEGRNN------VFMISGIFPFVGIALRNIFAKFPSLQMA-TDIQSILEKALNKRLEQREADEKAGIEPSGEPQDFIDLFLDA----------------RSTVDFFEGEAEQDFA----------KSEVLKVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDR---ECPDPEV----TFDQLSKLKYLECVVKEALRLYPLASLVHNRKCLKTTNVL---GMEIEAGTNINVDTWSLHHDPKVWGD-DVNEFKPERW--ESGDELFFAKG----GYLPFGMGPRICIGMRLAMMEMKMLLTNILKNYTFETTPETVIPLKLVGTATIAP-SSVLLKLKSR 517          
BLAST of cytochrome P450 3A29 vs. Ensembl Celegans
Match: cyp-13A4 (Putative cytochrome P450 CYP13A4 [Source:UniProtKB/Swiss-Prot;Acc:Q27513])

HSP 1 Score: 220.705 bits (561), Expect = 3.824e-64
Identity = 155/543 (28.55%), Postives = 272/543 (50.09%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEYRN--NTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEAR--RKCSEKRF---------DLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
             + GP     FG ++++ +  N     L +W K++G ++   EG    +V+ +P+ + EV VKQF NF+GRK  P+Q +P+++++  + LA+G RWKRLRT  +P FS+  +R++   V+E++   +  L+E    K   +++ +Y Q  T+DII + A G          +P +  +K+  K+         +   +A + P+   L+     +  +      I +T+ + +  R  ++ ++K+          D + + +DA           N+  + + ++L  A+S+                   K  K LT +E+I Q  +FL AGY+T++ +LS+  + L+ +P++Q KL +E+ R   +  D  +     +D + +L Y+  ++ E LR YP AS V +R C+K        G+ I +GT V  + + +HYD  +W   D   F PER+    G EL +        +LPFG GPR CIG R AMM  +  L   + ++   ++ +TE PLKL   ATI+P N V + L  R+S
Sbjct:   30 GVKGPRGFPFFGVILKFHDYENPGLLKLGEWTKKYGSIYGITEGVEKTLVVSNPEFVHEVFVKQFDNFYGRKTNPIQGDPNKNKRAHLVLAQGHRWKRLRTLASPTFSNKSLRKIMSTVEETVVELMRHLDE-ASAKGKAVDLLDYYQEFTLDIIGRIAMGQTESLM--FRNPMLPKVKEIFKK------GGKMPFLIAGVFPIAGTLMRQLFMKFPKFSPAFGIMNTMEKALNKRLEQRAADKKAGIEPSGEPQDFIDLFLDARA---------NVDFIEEESTLGFAKSEVL-----------------KVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDR---ECPDPEV----TFDQISKLKYMECVVKEALRMYPLASLVHNRKCMKKTNVL---GVEIDEGTNVQVDTWTLHYDPKVWGD-DASEFKPERW--ETGDELFYAKG----GYLPFGMGPRICIGMRLAMMEEKLLLTHILKKYTFDTSTETEIPLKLVGSATIAPRN-VMLKLTPRHS 519          
BLAST of cytochrome P450 3A29 vs. Ensembl Celegans
Match: cyp-13A12 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O17807])

HSP 1 Score: 218.394 bits (555), Expect = 2.510e-63
Identity = 159/529 (30.06%), Postives = 260/529 (49.15%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEY--RNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLST-LKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRF-------DLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            +  I GP    + G+ +E     N  Y  L +W K++GKV+   EG +  +VI DPDL+QEV VKQ+ NF GRKL P+Q +P++D++V++F ++G RWKRLRT  +P FS+  +R++   V+E     +  + +  D     I++ ++ Q  T+D+I + A G  TD Q   N P +  ++    E      L  ++   +  I  ++++ L    + P   V +++  S  V+     R   EK         D + + +DA+               +D+  L   E  T                  K ++ LTTEE++ Q  +FL AG++T++ +LS+    L+ +P VQ KL +EI R   +  D  +     +D L +L Y+  +I ETLR YP  +    R C+++  T + N   I +GT ++ + + +H DK IW   D   F PER+   +G E  +        ++PFG GPR CIG R A M  +  L   + ++ +    KT+ PLKL    T  P
Sbjct:   28 RRGIAGPSGYPILGSALEMLSSENPPYLQLKEWTKQYGKVYGITEGLSRTLVISDPDLVQEVFVKQYDNFFGRKLNPIQGDPNKDKRVNLFSSQGHRWKRLRTISSPTFSNNSLRKLKTTVEECAVELLRHIEQHTDGG-QPIDLLDFYQEFTLDVIGRIAMG-QTDSQMFKN-PLLPYVRAVFGEPRKGLFLSGSLAPWIGPILRMVMFSLPNIVKNPA--VHVIRHTSNAVEQRVKLRMADEKAGIDPGEPQDFIDLFLDAK---------------SDDVELENNEDFTKAGV--------------KVTRQLTTEEIVGQCFVFLIAGFDTTALSLSYSSFLLATHPKVQKKLQEEIDR---ECADPEV----TFDQLSKLKYMECVIKETLRMYPLGALANSRCCMRA--TKIGN-YEIDEGTNILCDTWTLHSDKSIWGE-DAEEFKPERW--ESGDEHFY----QKGGYIPFGLGPRQCIGMRLAYMEEKLLLSHILRKYTLEVCNKTQIPLKLIGSRTTQP 505          
BLAST of cytochrome P450 3A29 vs. Ensembl Fly
Match: Cyp6a2 (gene:FBgn0000473 transcript:FBtr0086133)

HSP 1 Score: 189.119 bits (479), Expect = 1.722e-52
Identity = 154/544 (28.31%), Postives = 237/544 (43.57%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNT-----FYELLIKWQKE-FGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNER--GDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELM-----KIRSTLVQ-VIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLK-VGATISPINGVNIVLKK 1716
            +  +P   P+ L+GN++ +R N      FY+   K++K  F  V  YF    P   I D  L + +++K FSNF  R  F      D+     +F   GK+WK +R  + P F+  KM+ MFP V +    FV  + E+    +    + I+E + R T D+I  CAFG++ +        F    +K   +M    L    V +  ++   L             R+ +M     +    LV   I  R + + KR D + +LI+ +  G   LD   +    D                                      E+ AQ  +F  AG+ETSS+ +S+ L+ L+   D+QD+L  EI  + E+ E +       Y+++  + YLN +I ETLR Y      + R  L          L I +GT VI    A H D+D++   +P TF PERF        E +       WLPFG GPRNCIG RF  M  R  L Q + RF+VS  + TE PLK   +   +  + G+ + +++
Sbjct:   28 RRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYRKSGFPFVGFYFLH-KPAAFIVDTQLAKNILIKDFSNFADRGQF--HNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRL-------------RMRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMD------------------------------------IGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLT-----YESIKAMTYLNQVISETLRLYTLVPH-LERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYP--NPETFDPERF------SPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLKYSPMSIVLGTVGGIYLRVER 505          
BLAST of cytochrome P450 3A29 vs. Ensembl Fly
Match: Cyp6a23 (gene:FBgn0033978 transcript:FBtr0087452)

HSP 1 Score: 181.8 bits (460), Expect = 6.150e-50
Identity = 143/539 (26.53%), Postives = 248/539 (46.01%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEYRNN-----TFYELLIKWQKE---FGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPM---VDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGAT-ISPINGVNIVLKK 1716
             IP   P+ ++GN+ ++         F +   K+++    F   + +F   T + VI D +L++ V++K F++F  R +F      D+    ++F   G++W+ LR  + P F+  KM+ MFP+   V E +    +     G+ +   + I + + R T D+I  CAFG++ +   N N  F+   K+ + E     L   ++    ++   L   L        Q VE     S +   I+ R + +EKR D +  LI+       + +++      D  S N                                 E++AQA +F  AG+ETSST + F L+ L++  D+QD+L  EI+ +  K  ++       Y+ +  + YL  ++ ETLR YP  + +  RM  +++ +      +I +GT V+     IHYD +I+   +P  F PERF        E I       WLPFG GPRNCIG RF +M     L   +  ++ S + +T+ P+K  V +  +S  NG+++ ++K
Sbjct:   30 GIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRSVYPFAGFYFFF---TRSAVITDLELVKRVLIKDFNHFENRGIF--YNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQ--VLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNV------QDVEDFYT-SIVRNTIDYRLRTNEKRHDFMDSLIE-------MYEKEQAGNTEDGLSFN---------------------------------EILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFT-----YEGIKEMKYLEQVVMETLRKYPVLAHLT-RMT-QTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYP--EPEKFKPERFTD------EAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEK 499          
BLAST of cytochrome P450 3A29 vs. Ensembl Fly
Match: Cyp6a8 (gene:FBgn0013772 transcript:FBtr0087455)

HSP 1 Score: 180.644 bits (457), Expect = 1.807e-49
Identity = 149/517 (28.82%), Postives = 233/517 (45.07%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEY-RNNTFYELLIKWQKEFGKV------FVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLV-QVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPL 1656
            +  IP   P+ + GN+ E  +    +E+      +F +       F +F+ P   V+  D +L +++++K FSNF  + +F  +K  D+     +F   G +W+ LR  ++  F+  KM+ M+P V      F+  ++E+  K    + I++ + R T+D+I  CAFG+  +   +    F+   K+ L +    TL    + +     P L   L      P     + +  S +V + +  R K   KR D + MLI+ +                     NQ E                +       + LT EEV+AQA +F  AG+ETSS+ + F L+ L+  PD+QDK+  E+  + E+  D++      Y+    L YLN ++ ETLR Y      + RM  K           I  G  VI    AIH+D  I+   +P  F PERF     +  E  G P+  AWLPFG GPRNCIG RF  M  R  L   +  F+ S+  KT NPL
Sbjct:   31 RRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRESKAPFVGFFFFQSPAAFVI--DLELAKQILIKDFSNFSNKGIFYNEK--DDPISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKN-SVLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSY----PKLARKLGMVRTAP----HIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELK---------------------NQKE---------------MTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQ-HDQNF----TYECTKDLKYLNQVLDETLRLYTIVPN-LDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYP--EPFEFRPERF-----SPEESAGRPS-VAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPL 484          
BLAST of cytochrome P450 3A29 vs. Ensembl Fly
Match: Cyp6a17 (gene:FBgn0015714 transcript:FBtr0345527)

HSP 1 Score: 177.948 bits (450), Expect = 1.594e-48
Identity = 151/542 (27.86%), Postives = 242/542 (44.65%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEYRNN-----TFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKF---------DCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKV-GATISPINGVNIVLKK 1716
             IP    + LFGN+ ++ N       F +   K++        +F   T   V+ D +LL+ V++K F++F  R +F      D+    ++F   G++W+ LR  + P F+  KM+ MFP+V         K+ E  DK F           + + + + R T D+I  CAFG++ +   +    F+   K+ + E     +    +    ++   L   L   N +  +      +R T    I+ R +  EKR D +                D+L  M  N     +E                          LT  E++AQA +F  AG+ETSST + F L+ L+   DVQDKL +EI  +  K  +K       Y+ +  + YL  ++ ETLR YP  + +  RM   ++ +      +I +GT V+     IHYD DI+   +P  F PERF     T+ E    P+   WLPFG GPRNCIG RF MM     L   +  ++ S + +T+ P+K+ V    IS  NG+++ ++K
Sbjct:   29 GIPHDEVHPLFGNIKDWPNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVF--YNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIV--------VKVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKL---NIQEAEDFYTKIVRET----IDYRLRTKEKRNDFM----------------DSLIEMYKNEQSGNSEDG------------------------LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGK-HNKEF----TYEGIKEMKYLEQVVMETLRKYPVLAHLT-RMT-DTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYP--EPEIFKPERF-----TDEEIAARPSC-TWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLKVEK 498          
BLAST of cytochrome P450 3A29 vs. Ensembl Fly
Match: Cyp6a17 (gene:FBgn0015714 transcript:FBtr0087451)

HSP 1 Score: 177.948 bits (450), Expect = 1.594e-48
Identity = 151/542 (27.86%), Postives = 242/542 (44.65%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEYRNN-----TFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKF---------DCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKV-GATISPINGVNIVLKK 1716
             IP    + LFGN+ ++ N       F +   K++        +F   T   V+ D +LL+ V++K F++F  R +F      D+    ++F   G++W+ LR  + P F+  KM+ MFP+V         K+ E  DK F           + + + + R T D+I  CAFG++ +   +    F+   K+ + E     +    +    ++   L   L   N +  +      +R T    I+ R +  EKR D +                D+L  M  N     +E                          LT  E++AQA +F  AG+ETSST + F L+ L+   DVQDKL +EI  +  K  +K       Y+ +  + YL  ++ ETLR YP  + +  RM   ++ +      +I +GT V+     IHYD DI+   +P  F PERF     T+ E    P+   WLPFG GPRNCIG RF MM     L   +  ++ S + +T+ P+K+ V    IS  NG+++ ++K
Sbjct:   29 GIPHDEVHPLFGNIKDWPNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVF--YNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIV--------VKVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKL---NIQEAEDFYTKIVRET----IDYRLRTKEKRNDFM----------------DSLIEMYKNEQSGNSEDG------------------------LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGK-HNKEF----TYEGIKEMKYLEQVVMETLRKYPVLAHLT-RMT-DTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYP--EPEIFKPERF-----TDEEIAARPSC-TWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLKVEK 498          
BLAST of cytochrome P450 3A29 vs. Ensembl Zebrafish
Match: tbxas1 (thromboxane A synthase 1 (platelet) [Source:ZFIN;Acc:ZDB-GENE-030131-8805])

HSP 1 Score: 235.343 bits (599), Expect = 3.760e-69
Identity = 168/548 (30.66%), Postives = 272/548 (49.64%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAF--------NQRPGQ-RVELMKIRSTLVQ-VIEARRKCS--EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRL---HEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQG-TFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            +  I  P P    GNL+ +RN  F++       ++G++  Y+ G    V+I DPD+L++VMVK+F+ F  R        P  D   S+ + +G++WKR+R+ + P FS AKM+ M P+++ +  + +  L    + + +  NI +     TMD+I   AFG   D Q N + PF+               +A+     +  +P++++ + AF           P + R E+    +  +Q +I+ R   S  ++R D LQ+++D      K L  ++   +ND       E   D  +          S QK+    +T +E++ Q+ +FL AGYETSS  L+F  + L+V+P+ Q KL +E+      HE ++         Y  +  L YL+ +I E+LR YP A     R+    E   + NG ++P+G +  IP  F +HYD + WT  +P  F PERF        E     +PF +LPFGAGPR+C+G R A + I+  L     RF V + E TE PL+LK   T+ P NGV + + +R +
Sbjct:   45 RCGIKHPKPLPFIGNLMMFRNG-FFKSQADLINKYGRICGYYIGRRSTVIIADPDMLRQVMVKEFNKFPNRMTARGITKPMSD---SLIMLKGEQWKRVRSILTPTFSAAKMKEMVPLINTATETLLRNLKSHAESE-NSFNIHKCFGCFTMDVIASVAFGTQVDSQNNPDDPFV--------------HQASKFFAFSFFRPIMIFFM-AFPFLLRLLAGLLPNKSRDEMNSFFTQCIQKMIKQRDDLSPEQRRKDFLQLMLDVRT-NKKFLSVEHFDVVND-----ADEEAYDGHENSPANESTKRSQQKRM---MTEDEIVGQSFIFLVAGYETSSNTLAFTCYLLAVHPECQKKLQEEVDEFFSRHETVD---------YANVQELKYLDMVICESLRLYPPA----FRVARDVEEDTVLNGQFLPKGASLEIPTGF-LHYDPEHWT--EPTKFIPERFTP------EAKARRHPFVYLPFGAGPRSCVGMRLAQLEIKVALVHIFRRFNVLACEDTEIPLELKSHTTLGPKNGVMVKITEREN 541          
BLAST of cytochrome P450 3A29 vs. Ensembl Zebrafish
Match: cyp3a65 (cytochrome P450, family 3, subfamily A, polypeptide 65 [Source:ZFIN;Acc:ZDB-GENE-050604-1])

HSP 1 Score: 221.476 bits (563), Expect = 3.113e-64
Identity = 154/538 (28.62%), Postives = 275/538 (51.12%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEA--FNQRPGQRVE-----LMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
            K  IPGP     FG ++ Y++  F+   +   +++G+++  ++G  P + I D  +++ V++K+ +S F  R+ F +  N    + VS  +A    W+R+R+ ++P+F+  +++ MF ++ +     V+ + +   K+ +  +I+E+    +MD++   AF VD D   N   PF+ ++KK LK   L+ L       L    P +  +LE   F   P    +     L KI+S       A+   ++KR D LQ+++D++  G K                                     S+ + T K L+  E+++Q+ +F+FAGYETSS+ LSF+ ++L+  P+   KL +EI    E   +++      Y+ L  + YL+A + E+LR YP A+  + R+C K   T   NGL IP+   V+   +A+H D D W+  +P +F PERF + N   ++      P+ ++PFG GPRNCIG RFA + ++  + + + RF VS  ++T+ PL+L     +SP + + + L+ R
Sbjct:   31 KLGIPGPKTIPFFGTMLRYKDG-FHVFDMDCFEKYGRIWGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRRNFRL--NGALYDAVS--IAEDDDWRRIRSVLSPSFTSGRLKEMFGIMKKHSHILVDSMGKTA-KRGESADIKEFFGAYSMDVVTSTAFSVDIDSLNNPKDPFVTNIKKMLKFDLLNPL-----FLLIAFFPFMAPVLEKMDFALFPTSVTDFFYAALQKIKSDRDTKTVAKDN-TKKRVDFLQLMVDSQT-GVK-----------------------------------HKSDGEHTEKGLSDHEILSQSMIFIFAGYETSSSTLSFLFYNLATNPETMKKLQEEID---ETFPNQAPVD---YETLMSMDYLDAALSESLRLYPVAAR-LERVCKK---TVEINGLLIPKDLVVMVPTYALHRDPDYWS--EPESFKPERFTKGNKESID------PYMYMPFGLGPRNCIGMRFAQVTMKLAIVEILQRFDVSVCDETQVPLELGFNGLLSPKDPIKLKLQPR 502          
BLAST of cytochrome P450 3A29 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 216.083 bits (549), Expect = 2.224e-62
Identity = 145/512 (28.32%), Postives = 259/512 (50.59%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKL 1662
            K  IPGP P   FG  + Y    F+   ++  K++GKV+  ++G  P +++ D ++++ +MVK+ +S F  R+   +       + +S    + +RWKR+R T++P F+  +++ +FP+       F+  + +R  ++   + I+E +   ++D++   +F VD D   N + PF+ ++K FLK     +L + ++L L  + P +  LL         R  +M    T ++ I+   K S  R D L+++I  ++P  +  D  +  P+                                  K LT  E+++Q+ +F+  GYET+ST LSF+LH+L+  PD  +KL +EI +      +  + +   YDAL ++ YL   I E++R  P A   + R+C K   T   NG+ IP+ T V    + ++ D  +W S  P  F PERF   N +E         +A++PFG GPRNCIG RFA+M+++  + + +  F + + ++T+ PL+L
Sbjct:   34 KLGIPGPRPWPFFGTFLSYTKG-FFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREVNVDLAGPLADGISA--VKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKRDHEQ--PVKIKEVVAPYSLDVVTSSSFSVDIDSINNPDDPFVTNIKNFLK----FSLFSPLILFLT-LFPSIANLLGKMGISVFSR-SIMNFFYTALRKIKDEHKDSNGRVDFLRLMIQNQIPDDQAKDTTSEQPV----------------------------------KGLTDHEILSQSFIFILGGYETTSTTLSFLLHNLATNPDCLEKLVEEIDK------NFPLDTPISYDALMKMDYLEMSINESMRLLPTAPR-LERVCKK---TVELNGITIPKDTLVAIPTYVLNRDPQLWDS--PQEFRPERFSPENKSEFL------QYAFMPFGLGPRNCIGMRFALMIVKLLVVKLLQNFSLETCKETQIPLEL 482          
BLAST of cytochrome P450 3A29 vs. Ensembl Zebrafish
Match: cyp3c4 (cytochrome P450, family 3, subfamily C, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-060929-96])

HSP 1 Score: 202.216 bits (513), Expect = 3.533e-57
Identity = 145/515 (28.16%), Postives = 263/515 (51.07%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNF-HGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKV 1668
            K  IPGP P    G L+ Y         ++  K++GKV+  ++G  P +++ D ++++ V+VK+ +SNF + RK       P  D    + + + +RWKR+R+T++P F+  +++ +FP+       F+  + ++  ++   + I+E +   ++D+I   +F VD D   N   PF++++KKF+ + N+      ++L      P L   L+        +  +    S L ++ +   K SE R D L++++  ++P  +I D D                                   ++ +K LT  E+++Q+ +F+  GYET+ST L+F+L++L+  PD  +KL +EI +      +  + +   YDAL R+ YL   I E++R  P A     R+   ++ T + NGL IP+GT V    + + +D DIW S  P  F PERF   N +E         +A++PFG GPRNCIG R+A+M+++  + + +  F V + ++T+ PL++ V
Sbjct:   34 KLGIPGPRPWPFVGTLLSYAKG-LCNFDMECAKKYGKVWGIYDGRLPILMVTDLEVIKVVLVKECYSNFINRRKRTTGLAGPFSD---GIIMVKDERWKRMRSTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKKDPEQ--PVKIKEVVAPYSLDVITSSSFSVDIDSINNPEDPFVINVKKFI-QFNMFNPLLLLILLF----PSLAIPLKKMGVTLFSKSAMDFFYSVLKKIKDDHNKESEGRVDFLKLMLQNQIPDDQIQDSDT---------------------------------SEQPAKGLTDHEILSQSLVFILGGYETTSTTLTFLLYNLATNPDCLEKLVEEIDK------NFPLDTPITYDALMRMDYLEMAINESMRLLPTAP----RLERSAKKTVVINGLTIPEGTLVGIPTYVLSHDPDIWES--PGEFRPERFSPENKSEFL------QYAFIPFGLGPRNCIGMRYAVMIMKLFVVKLLQNFSVETCKETQIPLEINV 486          
BLAST of cytochrome P450 3A29 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 201.445 bits (511), Expect = 4.162e-57
Identity = 145/513 (28.27%), Postives = 259/513 (50.49%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQ-KNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKL 1662
            K  IPGP P   FG  + Y    F+   ++  K++GKV+  ++G  P +++ D ++++ +MVK+ +S F  R+   +    P  D    +   + +RWKR+R T++P F+  +++ +FP+       F+  + ++GD +   + I+E +   ++D++   AF VD D   N + PF+ ++K FLK  NL  L   ++     I  +L  +  +   +P        +R      I+   K S  R D  +++I  E+P  ++ D          T+  Q E                        K LT  E+++Q+ +F+  GYET+ST L+F+L++L++ PD  +KL ++I +      +  + +   YDAL ++ YL   I E++R  P A   + R+C K   T   NG+ IP+ T +    + ++ D  +W S  PH F PERF   N +E         +A++PFG GPRNCIG R+A+M+++  + + +  F V + ++T+ PL+L
Sbjct:   13 KLGIPGPRPWPFFGTFLSYTKG-FFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREINVDLAGPLAD---GITAVKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNM-QKGDHE-QPVKIKEVMASYSLDVVTSSAFSVDIDSINNPDDPFVTNIKNFLK-FNLFGLFVLLLTVFPSIANLLGKMGLSMFSKPTVDFFYKALRK-----IKEEHKDSNGRVDFFRLMIQNEIPDDQVKD----------TTSEQPE------------------------KGLTDHEILSQSFIFIMGGYETTSTTLTFLLYNLAINPDCLEKLVEKIDK------NFPLDTPISYDALMKIDYLEMSINESMRLLPTAPR-LERVCKK---TVEMNGITIPKDTMITIPTYVLNQDPQLWDS--PHEFRPERFSPENKSEFL------QYAFMPFGLGPRNCIGMRYALMIVKLLVVKLLQNFSVETCKETQIPLEL 461          
BLAST of cytochrome P450 3A29 vs. Ensembl Xenopus
Match: ENSXETT00000012846.1 (cytochrome P450 3A8-like [Source:NCBI gene;Acc:100487846])

HSP 1 Score: 235.343 bits (599), Expect = 2.798e-69
Identity = 156/525 (29.71%), Postives = 271/525 (51.62%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSE-KRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGV 1698
            +Y IPGP P    G  +  R+    E  +K  K++G V+ +++GP P + I DP +++ +MVK+ ++NF  R+ F +        K S+ +++ ++WKR+RT ++P F+  K+++MFP++       V  ++++ D K + ++++      +MD I   +F V+ D   N N PF+ + +        S  K   ++T+  + P LV LL+  N        L   +  +  + + R+K +   R D LQ+++DA+                     N+ ES                  +K   K L+  E++AQ+ +F+ AGYET+ST L F+ ++++ YPDVQ KL +EI+ L   + +K+  +   YDAL ++ Y++ +I ETLR  P  +  I R+C K   T   NG+ IP G  ++  +FA+H + +IW   +P  F PERF + N    +      P+ +LPFG GPRNCIG RFA++ I+  L   +  F++ + + T  PLK+     + P   +
Sbjct:   35 RYGIPGPTPIPFIGTFLGNRHG-LMEFDMKCFKKYGNVWGFYDGPQPVLAILDPVIIKSIMVKECYTNFTNRRDFGLSG----PLKSSVLMSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNK-EPLDMKSIFGSYSMDTILSTSFSVNVDSMNNPNDPFVTNARNLF---TFSFFKPLFLITI--LCPFLVPLLDKMNFCFLSSKFLKFFKDAVASIKKKRQKGAHMDRVDFLQLMVDAQS--------------------NEGESV--------------PEEEKHRHKELSDTEILAQSLIFIMAGYETTSTTLMFLTYNIARYPDVQRKLEEEINTL---LPNKAPPT---YDALMKMEYMDMVINETLRLLP-PAIRIDRVCKK---TMEINGVTIPAGVVIVVPLFALHLNPEIWP--EPEEFQPERFSKENQKNQD------PYNFLPFGVGPRNCIGMRFALVNIKLALTILLQNFKLETCKDTPVPLKVCTRGNLKPTKPI 496          
BLAST of cytochrome P450 3A29 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 229.565 bits (584), Expect = 4.142e-67
Identity = 154/521 (29.56%), Postives = 266/521 (51.06%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS-EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            +Y IPGP P    G  +  R     E  ++  K++GKV+  +EG  P + I DP +++ +M+K+ +SNF  R+   +        K S+ +++ ++WKR+RT ++P F+  K+++MFP++       V  ++++ D K + ++++      +MDI+   +F V+ D   N N PF+ + +   K    + L    +L      P LV LL+  N        L   +  +  + + R+K + E R DLLQ+++DA+                     N+ ES                  +K   K L+  E++AQ+ +F+ AGYET+ST L F+ ++++ +PDVQ KL +EI  L   + +K+  +   YDAL ++ Y++ +I ETLR +P  +  I R+C K   T   NG+ IP G  ++  +F +H + +IW   +P  F PERF + N    +      P+ +LPFG GPRNCIG RFA++ ++  L   +  F+  + + T  PLK+     + P
Sbjct:   35 RYGIPGPTPIPFIGTFLGNRKG-LMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMIKECYSNFTNRRDLGLTG----PLKSSVLVSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFKFSFFNPLFLIAILC-----PFLVPLLDKMNFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDLLQLMVDAQS--------------------NEGESV--------------PEEEKHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDAL---LPNKAPPT---YDALMKMEYMDMVINETLRMFP-PAIRIDRVCKK---TMEINGVTIPAGVVIVVPLFVLHLNPEIWP--EPEEFQPERFSKENQKNQD------PYNFLPFGVGPRNCIGMRFALVNMKLVLTILLQNFRFETCKDTPVPLKICTDGYLKP 492          
BLAST of cytochrome P450 3A29 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 227.639 bits (579), Expect = 1.448e-66
Identity = 156/522 (29.89%), Postives = 272/522 (52.11%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIK-PVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS-EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            +Y IPGP P    G  +  R+    E  ++  K++GKV+  +EG  P + I DP +++ +MVK+ ++NF  R+ F +        K S+ +++ ++WKR+RT ++P F+  K+++MFP+++      V  ++++ + K + ++++      +MDI+   +F V+ D   N N PF+ + +      NL T      L L  I  P LV LL+  N        L   +  +  + + R+K + E R D LQ+++DA+               N+  S+ + E                    K   K L+  E++AQ+ +F+ AGYET+ST L F+ ++++ +PDVQ KL +EI  L   + +K+  +   YDAL ++ Y++ +I E+LR +P  +  I R+C K   T   NG+ IP G  ++  +FA+H + +IW   +P  F PERF + N    +      P+ +LPFG GPRNCIG RFA++ ++  L   +  F++ + + T  PLK+     + P
Sbjct:   27 RYGIPGPTPIPFIGTFLGNRHG-LMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSG----PLKSSVLISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNAR------NLFTFSFFNPLFLISILCPFLVPLLDKMNFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDFLQLMVDAQS--------------NEGKSVPEEE--------------------KHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDAL---LPNKAPPT---YDALMKMEYMDMVINESLRMFP-PAIRIDRVCKK---TMEINGVTIPAGVVIVVPLFALHLNPEIWP--EPEEFQPERFSKENQKNQD------PYNFLPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDTPVPLKICTKGYLKP 484          
BLAST of cytochrome P450 3A29 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 221.861 bits (564), Expect = 2.272e-64
Identity = 152/508 (29.92%), Postives = 266/508 (52.36%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIK-PVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS-EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKT 1644
            +Y IPGP P    G  +  R+    E  ++  K++GKV+  +EG  P + I DP +++ +MVK+ ++NF  R+ F +        K S+ +++ ++WKR+RT ++P F+  K+++MFP+++      V  ++++ + K + ++++      +MDI+   +F V+ D   N N PF+ + +      NL T      L L  I  P LV LL+  N        L   +  +  + + R+K + E R D LQ+++DA+               N+  S+ + E                    K   K L+  E++AQ+ +F+ AGYET+ST L F+ ++++ +PDVQ KL +EI  L   + +K+  +   YDAL ++ Y++ +I E+LR +P  +  I R+C K   T   NG+ IP G  ++  +FA+H + +IW   +P  F PERF + N    +      P+ +LPFG GPRNCIG RFA++ ++  L   +  F++ + + T
Sbjct:   27 RYGIPGPTPIPFIGTFLGNRHG-LMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSG----PLKSSVLISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNAR------NLFTFSFFNPLFLISILCPFLVPLLDKMNFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDFLQLMVDAQS--------------NEGKSVPEEE--------------------KHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDAL---LPNKAPPT---YDALMKMEYMDMVINESLRMFP-PAIRIDRVCKK---TMEINGVTIPAGVVIVVPLFALHLNPEIWP--EPEEFQPERFSKENQKNQD------PYNFLPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDT 470          
BLAST of cytochrome P450 3A29 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 219.55 bits (558), Expect = 1.407e-63
Identity = 150/521 (28.79%), Postives = 260/521 (49.90%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS-EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            +Y IPGP P    G  +  R  +              ++V +EG  P + I DP +++ +M+K+ +SNF  R+   +        K S+ +++ ++WKR+RT ++P F+  K+++MFP++       V  ++++ D K + ++++      +MDI+   +F V+ D   N N PF+ + +   K    + L    +L      P LV LL+  N        L   +  +  + + R+K + E R DLLQ+++DA+                     N+ ES                  +K   K L+  E++AQ+ +F+ AGYET+ST L F+ ++++ +PDVQ KL +EI  L   + +K+  +   YDAL ++ Y++ +I ETLR +P  +  I R+C K   T   NG+ IP G  ++  +F +H + +IW   +P  F PERF + N    +      P+ +LPFG GPRNCIG RFA++ ++  L   +  F+  + + T  PLK+     + P
Sbjct:   35 RYGIPGPTPIPFIGTFLGNRKVSI-------------LYVIYEGQKPLLAIVDPVIIKSIMIKECYSNFTNRRDLGLTG----PLKSSVLVSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFKFSFFNPLFLIAILC-----PFLVPLLDKMNFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDLLQLMVDAQS--------------------NEGESV--------------PEEEKHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDAL---LPNKAPPT---YDALMKMEYMDMVINETLRMFP-PAIRIDRVCKK---TMEINGVTIPAGVVIVVPLFVLHLNPEIWP--EPEEFQPERFSKENQKNQD------PYNFLPFGVGPRNCIGMRFALVNMKLVLTILLQNFRFETCKDTPVPLKICTDGYLKP 480          
BLAST of cytochrome P450 3A29 vs. Ensembl Mouse
Match: Cyp3a13 (cytochrome P450, family 3, subfamily a, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88610])

HSP 1 Score: 246.514 bits (628), Expect = 1.102e-73
Identity = 163/533 (30.58%), Postives = 274/533 (51.41%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            K  IPGP P    G ++ Y+   F+E  I+  K++GK++  ++G  P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ ++  + WKR+R  ++P F+  +++ MFP++++     V  + + G  +    ++++     +MD+I   +FGV+ D   N   PF+  +KK LK      L  +V L      P L  + +A N     R  +    +++ ++ E R K  EK R D LQ++I+++                                         +   K++ K L+  E++AQ+ +F+FAGYET+S+ALSF L+ L+++PDVQ KL  EI      + +K+  +   YD L ++ YL+ ++ ETLR YP A   + R+C         NGL+IP+GT V+   FA+H D   W   +P  F PERF + N   +      NP+ +LPFG+GPRNCIG RFA++ ++  L + +  F V   ++TE PLKL     + P N + + +  R+
Sbjct:   35 KLGIPGPKPLPFLGTILAYQKG-FWECDIQCHKKYGKMWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRF----GPVGILKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQ-GLGEGKPTSMKDIFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVTLF-----PFLTPVFDALNVSLFPRDVISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQ-----------------------------------------NYKTKESHKALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEID---AALPNKAPAT---YDTLLQMEYLDMVVNETLRLYPIAGR-LERVCKTDVEI---NGLFIPKGTVVMIPTFALHKDPKYWP--EPEEFRPERFSKKNQDSI------NPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPENPLLLKVVSRD 497          
BLAST of cytochrome P450 3A29 vs. Ensembl Mouse
Match: Cyp3a11 (cytochrome P450, family 3, subfamily a, polypeptide 11 [Source:MGI Symbol;Acc:MGI:88609])

HSP 1 Score: 233.802 bits (595), Expect = 6.149e-69
Identity = 159/523 (30.40%), Postives = 263/523 (50.29%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFN--QRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            K  IPGP P    G ++ Y     ++  ++  K++GK +  F+G TP + + DP+ ++ V+VK+ FS F  R+ F     P      ++ +++   WKR R  ++P F+  K++ MFP++++     V  L ++  KK   + +++ L   +MD+I   +FGV+ D   N   PF+   KK L+      L  +VVL      P L  + E  N    P   +E  K    + ++ E+R    +K R D LQ+++++                                          +S  K + K L+  E+ AQ+ +F+FAGYET+S+ LSF LHSL+ +PD+Q KL  EI    E + +K+  +   YD +  + YL+ ++ ETLR YP A+  + R+C K       NG+YIP+G+ V+   +A+H+D   W+  +P  F PERF + N       G  +P+ +LPFG GPRNC+G RFA+M ++  L + +  F     ++T+ PLKL     + P
Sbjct:   35 KQGIPGPKPLPFLGTVLNYYKG-LWKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDF----GPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKA-KKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLF-----PFLTPVYEMLNICMFPKDSIEFFK--KFVDRMKESRLDSKQKHRVDFLQLMMNSH----------------------------------------NNSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEID---EALPNKAPPT---YDTVMEMEYLDMVLNETLRLYPIANR-LERVCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHWS--EPEEFQPERFSKENK------GSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQP 486          
BLAST of cytochrome P450 3A29 vs. Ensembl Mouse
Match: Tbxas1 (thromboxane A synthase 1, platelet [Source:MGI Symbol;Acc:MGI:98497])

HSP 1 Score: 228.409 bits (581), Expect = 1.260e-66
Identity = 159/534 (29.78%), Postives = 262/534 (49.06%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARR---KCSEKRFDLLQMLIDAEVPGTKILDED-NLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
            K  I  P P+   GNL+ +R   F+E  ++ ++ +G +  Y+ G   +VVI +PD++++V+V+ FSNF  R    ++     D   S+ L R +RW+ +R  +  +FS  K+  M P++ ++    V  L      + D  NIQ      T+D++   AFG   D Q +   PF+   ++      +      ++L+   I   L  +L   N     R EL    +TL++ + A R      E+R D LQM++DA+     +  E  ++ P + ++S    E                  +   TSKP T +E++ QA LFL AG+E  +  LSFI + L+ +PD Q++L +E+     K       + E +     LPYL+ +I ETLR YP A           E      G  IP GT +   V A+H+D + W   +P TF PERF      +        PF +LPFGAGPR+C+G R  ++V++ T+ Q +++F+  ++ +T+ PL+L+  + + P NGV I +  R
Sbjct:   41 KLGIRHPKPSPFVGNLMFFRQG-FWESQLELRERYGPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGLEPKMVAD---SVLLLRDRRWEEVRGALMSSFSPEKLDEMTPLISQACELLVAHLKRYAASR-DAFNIQRCYCCYTIDVVASVAFGTQVDSQNSPEDPFVQHCRR-ASTFCIPRPLLVLILSFPSIMVPLARILPNKN-----RDELNGFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQ-------------RCHPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHP-----APEYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVL----GQRIPAGTVLEIAVGALHHDPEHWP--NPETFDPERFTAEARLQR------RPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEASPETQVPLQLESKSALGPKNGVYIKIVSR 533          
BLAST of cytochrome P450 3A29 vs. Ensembl Mouse
Match: Cyp3a41a (cytochrome P450, family 3, subfamily a, polypeptide 41A [Source:MGI Symbol;Acc:MGI:1858451])

HSP 1 Score: 223.016 bits (567), Expect = 6.058e-65
Identity = 154/523 (29.45%), Postives = 258/523 (49.33%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFN--QRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            K  IPGP P    G ++ Y     ++  ++  +++GK +  F+G  P  VI DP++++ V+VK+ FS F  R+ F     P      ++ +++ + WKR R  ++P F+  K++ MFP++++     V  L +  +K    + +++ L   ++D+I   +FGV+ D   N   PF+   K  L+      L  +VVL      P L  + E  N    P   +E  K    + ++ E+R    +K R D LQ++++A                                          +S  K + K L+  E+ AQ+ +F+FAGYET+S+ LSF L+ L+ +PD+Q KL +EI    E + +K+  +   YD +  + YL+ ++ ETLR YP  +  + R C K       NG+YIP+G+ V+   +A+H+D   W   +P  F PERF + N       G  +P+ ++PFG GPRNCIG RFA M ++  L + +  F     ++T+ PLKL     + P
Sbjct:   35 KQGIPGPKPLPFLGTVLNYYKG-LWKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREF----GPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKG-KPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLF-----PFLTPVYEMLNICMFPKDSIEFFK--KFVNRMKESRLDSKQKHRVDFLQLMMNAH----------------------------------------NNSKDKDSHKALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEID---ETLPNKAPPT---YDTVMEMEYLDMVLNETLRLYPIGNR-LERFCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHWP--EPEEFQPERFSKENK------GSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQP 486          
BLAST of cytochrome P450 3A29 vs. Ensembl Mouse
Match: Cyp3a41b (cytochrome P450, family 3, subfamily a, polypeptide 41B [Source:MGI Symbol;Acc:MGI:3714859])

HSP 1 Score: 223.016 bits (567), Expect = 6.058e-65
Identity = 154/523 (29.45%), Postives = 258/523 (49.33%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFN--QRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            K  IPGP P    G ++ Y     ++  ++  +++GK +  F+G  P  VI DP++++ V+VK+ FS F  R+ F     P      ++ +++ + WKR R  ++P F+  K++ MFP++++     V  L +  +K    + +++ L   ++D+I   +FGV+ D   N   PF+   K  L+      L  +VVL      P L  + E  N    P   +E  K    + ++ E+R    +K R D LQ++++A                                          +S  K + K L+  E+ AQ+ +F+FAGYET+S+ LSF L+ L+ +PD+Q KL +EI    E + +K+  +   YD +  + YL+ ++ ETLR YP  +  + R C K       NG+YIP+G+ V+   +A+H+D   W   +P  F PERF + N       G  +P+ ++PFG GPRNCIG RFA M ++  L + +  F     ++T+ PLKL     + P
Sbjct:   35 KQGIPGPKPLPFLGTVLNYYKG-LWKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREF----GPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKG-KPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLF-----PFLTPVYEMLNICMFPKDSIEFFK--KFVNRMKESRLDSKQKHRVDFLQLMMNAH----------------------------------------NNSKDKDSHKALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEID---ETLPNKAPPT---YDTVMEMEYLDMVLNETLRLYPIGNR-LERFCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHWP--EPEEFQPERFSKENK------GSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQP 486          
BLAST of cytochrome P450 3A29 vs. UniProt/SwissProt
Match: sp|P24463|CP3AC_CANLF (Cytochrome P450 3A12 OS=Canis lupus familiaris OX=9615 GN=CYP3A12 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.160e-74
Identity = 165/536 (30.78%), Postives = 276/536 (51.49%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSREL--YDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP P    G  + YRN  FY   +K   ++G+++ +++G  P + I DPD+++ V+VK+ +S F  R+       P    K ++ L+  + WKR+RT ++P F+  K++ MFP++ +     VN L +  +K    IN+++     +MD+I   +FGV+ D   +   PF+ + KK LK   L     +++L      P L  + E  N     +      R ++ ++ E+R K  +K R D LQ++I+++                                         +S +  T K L+  E++AQ+ +F+FAGYET+ST+LSF+++ L+ +PDVQ KL +EI        D +  ++ L  YDAL ++ YL+ ++ ETLR YP A   + R+C K       +G++IP+GT V+   F +H D+ +W   +P  F PERF + N   +      NP+ +LPFG GPRNCIG RFA+M ++  L + +  F     ++T+ PLKL     I P   + + ++ R+ 
Sbjct:   35 KLGIPGPTPLPFVGTALGYRNG-FYVFDMKCFSKYGRMWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRTL----GPVGFMKSAISLSEDEEWKRMRTLLSPTFTTGKLKEMFPIIGQYGDVLVNNLRKEAEKG-KAINLKDVFGAYSMDVITSTSFGVNIDSLNHPQDPFVENTKKLLKFDFLDPFFFSILLF-----PFLTPVFEILNIWLFPKKVTDFFRKSVERMKESRLKDKQKHRVDFLQLMINSQ-----------------------------------------NSKEMDTHKALSDLELVAQSIIFIFAGYETTSTSLSFLMYELATHPDVQQKLQEEI--------DATFPNKALPTYDALVQMEYLDMVLNETLRLYPIAGR-LERVCKKDVEI---SGVFIPKGTVVMVPTFTLHRDQSLWP--EPEEFRPERFSRKNKDSI------NPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSFKPCKETQIPLKLNAQGIIQPEKPIVLKVEPRDG 498          
BLAST of cytochrome P450 3A29 vs. UniProt/SwissProt
Match: sp|P11707|CP3A6_RABIT (Cytochrome P450 3A6 OS=Oryctolagus cuniculus OX=9986 GN=CYP3A6 PE=2 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 7.184e-74
Identity = 163/537 (30.35%), Postives = 277/537 (51.58%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKR-FDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS*FR 1734
            K  IPGP P    G ++EYR    ++  I+ +K++GK++  F+G  P +VI DPD+++ V+VK+ +S F  R+ F     P    K ++ ++  + WKR+RT ++P F+  K++ M P++ +     V  L +  +K    ++++E     +MD+I   +FGV+ D   N   PF+ ++++ LK      L  ++ L      P L  + EA +     +  +  +++++ ++ + R K  +KR  D LQ++I+++                                         +S +  + K L   EV+AQ+ + LFAGYET+S+ LSFI+H L+ +PDVQ KL +EI  L   + +K + +   YD L ++ YL+ ++ ETLR YP A   + R+C K       NG +IP+GT V+   +A+H D   WT  +P  F PERF + N   +      NP+ + PFGAGPRNC+G RFA+M I+  L + +  F     ++T+ PLKL     + P   + + +  R+   R
Sbjct:   33 KMGIPGPTPLPFIGTILEYRKG-IWDFDIECRKKYGKMWGLFDGRQPLMVITDPDMIKTVLVKECYSVFTNRRSF----GPVGFMKKAVSISEDEDWKRVRTLLSPTFTSGKLKEMLPIIAQYGDVLVKNLRQEAEKG-KPVDLKEIFGAYSMDVITGTSFGVNIDSLRNPQDPFVKNVRRLLKFSFFDPLLLSITLF-----PFLTPIFEALHISMFPKDVMDFLKTSVEKIKDDRLKDKQKRRVDFLQLMINSQ-----------------------------------------NSKEIDSHKALDDIEVVAQSIIILFAGYETTSSTLSFIMHLLATHPDVQQKLQEEIDTL---LPNKELAT---YDTLVKMEYLDMVVNETLRLYPIAGR-LERVCKKDVDI---NGTFIPKGTIVMMPTYALHRDPQHWT--EPDEFRPERFSKKNKDNI------NPYIYHPFGAGPRNCLGMRFALMNIKLALVRLMQNFSFKLCKETQVPLKLGKQGLLQPEKPIVLKVVSRDGIIR 499          
BLAST of cytochrome P450 3A29 vs. UniProt/SwissProt
Match: sp|O18993|CP3AL_CALJA (Cytochrome P450 3A21 OS=Callithrix jacchus OX=9483 GN=CYP3A21 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 9.124e-74
Identity = 159/519 (30.64%), Postives = 273/519 (52.60%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATI 1680
            K  IPGP P    G ++ YR   F++  ++  K++GK++  ++G  P + I DP++++ V+VK+ +S F  R+ F     P    K ++ +A+   WKR+R+ ++P F+  K++ M P++ +     V  L    +K    IN+++     +MD+I   +FGV+ D   N   PF+ S KK L+   L     ++      I P L  +LEA N     R     +R ++ ++ E+R K + K R D LQ++ID++                                         +S + ++ K L+  E++AQ+ +F+FAGYET+S+ LSFI++ L+ +PDVQ KL +EI  +   + +K+  +   YD + ++ YL+ ++ ETLR +P A   + R+C K       NG++IP+G  V+   +A+HYD   WT  +P  F PERF ++N   ++      P+ + PFG GPRNCIG RFA+M ++  L + +  F     ++T+ PLKL++G  +
Sbjct:   35 KLGIPGPTPLPFLGTVLYYRQG-FWKFDMECYKKYGKMWGIYDGRQPVLAITDPNIIKTVLVKECYSVFTNRRPF----GPVGFMKSAISIAQDDEWKRIRSLLSPTFTSGKLKEMVPIIAQYGEVLVRNLRREAEKG-KPINMKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKLLRFDFLDPFFLSIT-----IFPFLTPILEALNISMFPRDSTSFLRKSIKRIKESRLKDTHKHRVDFLQLMIDSQ-----------------------------------------NSKETESDKALSDLELVAQSIIFIFAGYETTSSTLSFIMYELATHPDVQQKLQEEIDAV---LPNKAPAT---YDTVLQMEYLDMVVNETLRLFPLAMR-LERVCKKDVEI---NGVFIPKGVVVMIPSYALHYDPKYWT--EPEKFLPERFSKNNKDNID------PYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLGGLL 483          
BLAST of cytochrome P450 3A29 vs. UniProt/SwissProt
Match: sp|P51538|CP3A9_RAT (Cytochrome P450 3A9 OS=Rattus norvegicus OX=10116 GN=Cyp3a9 PE=2 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 2.914e-73
Identity = 162/521 (31.09%), Postives = 267/521 (51.25%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            K  IPGP P    G ++ YR   F+E      K++GK++  ++G  P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ ++  + WKR+R  ++P F+  K++ MFP++++     V  + + G ++    ++++     +MD+I   +FGV+ D   N   PF+  +KK LK      L  +V L      P L  L EA N     R  +   ++++ ++ E R K  EK R D LQ++I+++                                         +S  K + K L+  E++AQ+ +F+FAGYET+S+ALSF+L+ L+++PD+Q KL  EI      + +K+  +   YD L ++ YL+ ++ ETLR YP A   + R+C         NG++IP+GT V+   FA+H D   W   +P  F PERF + N   +      NP+ +LPFG GPRNCIG RFA+M ++  L + +  F     ++T+ PLKL     + P
Sbjct:   35 KLGIPGPKPLPFLGTILAYRKG-FWEFDKYCHKKYGKLWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRNF----GPVGILKKAISISEDEEWKRIRALLSPTFTSGKLKEMFPIINQYTDMLVRNMRQ-GSEEGKPTSMKDIFGAYSMDVITATSFGVNVDSLNNPQDPFVEKVKKLLKFDIFDPLFLSVTLF-----PFLTPLFEALNVSMFPRDVIDFFKTSVERMKENRMKEKEKQRMDFLQLMINSQ-----------------------------------------NSKVKDSHKALSDVEIVAQSVIFIFAGYETTSSALSFVLYLLAIHPDIQKKLQDEID---AALPNKAHAT---YDTLLQMEYLDMVVNETLRLYPIAGR-LERVCKTDVEI---NGVFIPKGTVVMIPTFALHKDPHYWP--EPEEFRPERFSKKNQDNI------NPYMYLPFGNGPRNCIGMRFALMNMKVALFRVLQNFSFQPCKETQIPLKLSKQGLLQP 485          
BLAST of cytochrome P450 3A29 vs. UniProt/SwissProt
Match: sp|Q64464|CP3AD_MOUSE (Cytochrome P450 3A13 OS=Mus musculus OX=10090 GN=Cyp3a13 PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 7.707e-73
Identity = 163/533 (30.58%), Postives = 274/533 (51.41%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEK-RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            K  IPGP P    G ++ Y+   F+E  I+  K++GK++  ++G  P + I DPD+++ V+VK+ +S F  R+ F     P    K ++ ++  + WKR+R  ++P F+  +++ MFP++++     V  + + G  +    ++++     +MD+I   +FGV+ D   N   PF+  +KK LK      L  +V L      P L  + +A N     R  +    +++ ++ E R K  EK R D LQ++I+++                                         +   K++ K L+  E++AQ+ +F+FAGYET+S+ALSF L+ L+++PDVQ KL  EI      + +K+  +   YD L ++ YL+ ++ ETLR YP A   + R+C         NGL+IP+GT V+   FA+H D   W   +P  F PERF + N   +      NP+ +LPFG+GPRNCIG RFA++ ++  L + +  F V   ++TE PLKL     + P N + + +  R+
Sbjct:   35 KLGIPGPKPLPFLGTILAYQKG-FWECDIQCHKKYGKMWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRF----GPVGILKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQ-GLGEGKPTSMKDIFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVTLF-----PFLTPVFDALNVSLFPRDVISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQ-----------------------------------------NYKTKESHKALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEID---AALPNKAPAT---YDTLLQMEYLDMVVNETLRLYPIAGR-LERVCKTDVEI---NGLFIPKGTVVMIPTFALHKDPKYWP--EPEEFRPERFSKKNQDSI------NPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPENPLLLKVVSRD 497          
BLAST of cytochrome P450 3A29 vs. TrEMBL
Match: A0A1S3JCI6 (cytochrome P450 3A29 OS=Lingula unguis OX=7574 GN=LOC106172070 PE=3 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 2.816e-103
Identity = 196/554 (35.38%), Postives = 296/554 (53.43%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERG--DKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLK-----AAVVLTLAEIKPVLVYLLEAF--NQRPGQRVELMKIRSTLVQVIEARRKCSE-KRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXX-----------XXXXXXXXXXXSSNQKKTS---KPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSREL--YDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
             + GPPPN L GNL EY      E + K  K++GK +  FEGP P V+  D +LL+EV +K+FS+FHGRKLFP+Q +P++   +SM  A G RWKRLR   NP FS +KM++M P+++E++ SF+    E+    K FD   I +  Q LTM++I  CAFG+  +   +  HPF+++ + F  ++   ++K      A+   L  +   ++Y+ + +  N+  G      ++R    + I+ R+   + +R DLLQ++IDA + G K     +    N   S   A+ Q                          +   KTS     L+ EE++ Q  +F+ AGYET+STAL +  H L++ P+VQ +L  EI        D+ +G  +   Y+ + +LPYL  +  E LR +P A+T I+R C++       NGL+IP G  V  +V +IH D ++W   DP  F PERF   N          +P AWLPFGAGPRNC+G RFA++  +  L + +  F +    +TE PLK    AT  P+NGV + L KR
Sbjct:   31 GLDGPPPNLLLGNLGEYGGGNIAEGIAKLTKKYGKTYGIFEGPVPCVITTDLELLKEVFIKRFSSFHGRKLFPVQPDPEDAHGISMVTAVGPRWKRLRMITNPTFSVSKMKQMSPLINEAVTSFLKTCEEKAKEGKPFD---IYKEYQGLTMEVIASCAFGLQINTIQDKEHPFLLAGRDFFNKLGKDSMKFYMMIPAIFPILRRLFYAMLYMAQCYMPNEPSG------RLRKFARETIQLRKSDPKYRRMDLLQLMIDATLAGNKEQVSRSNSSENGELSFGGAKEQEGTNGLAGVDGEMNGVQGTAGDVANGTGNLKTSPQKSGLSKEEIVEQCLVFIIAGYETTSTALGYCSHELALNPEVQKRLQAEI--------DEQLGDEDHINYETIQKLPYLEMVFCEALRLHPIATTFINRRCMEP---CTVNGLHIPAGLSVQADVLSIHADPEVWGPTDPAVFEPERFSPENKATR------HPMAWLPFGAGPRNCVGMRFAILEAKIALARVLKHFTIERCAETEVPLKKVERATTVPMNGVTVKLVKR 558          
BLAST of cytochrome P450 3A29 vs. TrEMBL
Match: K1PQG2 (Putative cytochrome P450 CYP13A5 (Fragment) OS=Crassostrea gigas OX=29159 GN=CGI_10011604 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 6.367e-103
Identity = 192/543 (35.36%), Postives = 299/543 (55.06%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNER--GDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYL---------LEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP PNFLFGNL+ +     ++   +W +E+GK F YFEGPTP +V  D +LLQ+V VKQF  FH RK+FP+Q +PD DE V MF ARG+RW+RLR+ +NPAFS  KMR M P+++  I   ++ +++    D+ FD     E  QRLT+D I  C FG++T+   N +   I + +  +++    T K  ++  L  I P L  L           +FN        +  + S++ ++I  ++K    + +LL++++ +E       D D +    D   ++Q ++                       + LT EE++AQ  LFL AGYET+ST L++I++ +SV P+ Q +L +EI  L  +  D        YD + ++ YL+ +  ETLR YP ASTV+ R C++S      NG+ IP+G  V  NV+++HY+++ W   D   F PERF +   +E       +P AW+PFG+GPR C+G R A +  + T+ + + ++    +E  E P++   GATI P +GVN+    R+S
Sbjct:   12 KMGIPGPKPNFLFGNLLAFWRMPLFKKYQEWYREYGKTFGYFEGPTPVLVTADVELLQQVFVKQFKKFHARKVFPVQVDPDSDENVHMFFARGERWRRLRSIVNPAFSSTKMRTMTPLINHRIDQLLDIVDDHNVNDRSFDSY---ELFQRLTLDTIADCGFGMNTNALINNDDECIKNCRGVIRD----TTKRPILFMLGFIFPALHRLWITIYNFMHFVSFN-------PVFCLESSMRKIIRNQKKQKPSKSNLLELMLTSEFNP----DADEI----DVGDVDQRDNVV-------------------KRRLLTNEELVAQCLLFLLAGYETTSTTLAYIMYEMSVNPEAQKRLQEEIDELFPENADNPS-----YDQIQKMEYLDMVWCETLRKYPLASTVVARQCMESCTV---NGIDIPKGMLVQANVWSVHYNQEHWVE-DTQRFIPERFTEQRKSER------HPLAWMPFGSGPRTCVGLRLAQLEGKMTIIRMLKKYSFVPSETQEIPIQCVEGATILPKDGVNVRAVMRSS 498          
BLAST of cytochrome P450 3A29 vs. TrEMBL
Match: A0A210QVL0 (Cytochrome P450 3A24 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17576 PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 7.273e-101
Identity = 195/542 (35.98%), Postives = 294/542 (54.24%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKP------VLVY-LLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEV-PGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKS---EGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            +  IPGP P+FLFGNL+ +   +FY    +W +E+GK F YFEGPT  +V  + +LL EV VKQF  FH RK+FP+Q +PD DE V MF ARG+RW+RLR+ INPAFS  KMR M PM++  I   +  ++  G  + D  ++ +  QRLTMD I +C  G++     N +  ++   +K + +    T K  ++  L  I P      + +Y LL   +  P   +E M     + ++++ R+   E + DLL +++++E  P T I + D                               ++++    + LTTEE+ AQ+ LFL AGYET+ST L++I + ++V P+VQ KL +EI R      D        Y+A+ R+ YL+ +  ETLR  P ASTV+ R C+++   EG  L+ G+ I        NV+A+HY+ ++W   DP  F PERF              NP AW+PFG+GPR C+G R A +  +  + +   ++ V  +EK   PLK   GATI P +GV+I + +RN
Sbjct:   30 RMGIPGPGPHFLFGNLLSFFRKSFYIKYQEWYREYGKTFGYFEGPTAVLVTTNLELLHEVFVKQFKKFHARKVFPVQVDPDRDENVHMFFARGERWRRLRSIINPAFSTTKMRNMTPMINTRIDHLMEVVDTYGRNR-DDFDVYDVFQRLTMDTIAQCGLGLENSSLKNPDDCWLKHSRKVITD----TTKRPLLFLLGFIFPKFHELWITIYKLLGYLSFNPVFWLEKM-----VKEIVDRRKDSQETKVDLLHLMLNSEYDPATGIEELD-------------------------------ATDKVVRKRLLTTEELTAQSLLFLLAGYETTSTTLAYIFYEMAVNPEVQAKLQEEIDRYFPDQADNPS-----YEAIQRMEYLDMVWCETLRKCPLASTVVARECMENCTIEGVKLTKGMLIH------ANVWALHYNAELWGE-DPDQFVPERFTAERKKM------RNPMAWMPFGSGPRTCVGLRLAQLQGKMAMIRLFKKYTVVPSEKLSIPLKYVEGATIIPKDGVSIRVIRRN 512          
BLAST of cytochrome P450 3A29 vs. TrEMBL
Match: A0A2C9K0E7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075045 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 8.172e-99
Identity = 193/545 (35.41%), Postives = 290/545 (53.21%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDK-KFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKP-------VLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS-EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEI----SRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP PNFLFGNL+E++    Y+   +W++++G  + Y+EGPTP +V  D ++L+EV VKQF+NFH RKL+P+Q +PD+DE V MF ARG+RWKRLR  +NPAFS AK+R+M P V+E I   ++ + +  +K     + + +  +RLT+D I +C  G+D +   N + P +   K  + +    T+K   +  L  + P        L   L      P   +E       + +V+  RR  + E R DL+Q ++DA+     + D +N                            + S+  KK  K +T EE+++ A LFL AGYET+ST L+++   LS  P VQ +L  EI     R +  IE         YD L +L YL+ +I+ETLR YP ASTV  R C++         + IP G  V  N++ +HYD   W   DP +F+P RF+     +       +  AW+PFG GPR C G RFA++ ++  + + +  F    ++K   PL LK GATI P  GV++  ++R S
Sbjct:    6 KMGIPGPEPNFLFGNLLEFQKVPLYKKHQEWKQKYGTTYGYYEGPTPVLVTSDVNILEEVFVKQFNNFHARKLWPVQVDPDKDEDVHMFFARGRRWKRLRGVVNPAFSAAKIRKMTPTVNECINHLLDVMRDTANKTSHKTVELLDIFRRLTLDTILRCEVGIDQNSLKNPDDPILNHCKGVIND----TVKTPWLFLLGFLFPSLHCVWITLYKFLHNIKCNPAFWLE-----DRMREVVSMRRTLTNEHRNDLMQQMLDAQFASDSVKDLEN-------------------------EASKISNPYKKFLKSMTNEEIVSHALLFLLAGYETTSTTLAYLFFELSQNPHVQQRLRLEIMAVLPRGYHTIE---------YDDLKQLTYLDYVIWETLRKYPLASTVTARQCMRDCTV---GNMQIPMGMLVHANLWDVHYDPTHWGE-DPQSFNPLRFMPEQRRKR------HATAWMPFGGGPRACAGIRFALLQLKMVVSKVLRDFDFYPSDKLIVPLPLKQGATILPAEGVHLSARRRGS 497          
BLAST of cytochrome P450 3A29 vs. TrEMBL
Match: A0A2C9K0E0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075045 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.413e-98
Identity = 193/545 (35.41%), Postives = 290/545 (53.21%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDK-KFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKP-------VLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS-EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEI----SRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            K  IPGP PNFLFGNL+E++    Y+   +W++++G  + Y+EGPTP +V  D ++L+EV VKQF+NFH RKL+P+Q +PD+DE V MF ARG+RWKRLR  +NPAFS AK+R+M P V+E I   ++ + +  +K     + + +  +RLT+D I +C  G+D +   N + P +   K  + +    T+K   +  L  + P        L   L      P   +E       + +V+  RR  + E R DL+Q ++DA+     + D +N                            + S+  KK  K +T EE+++ A LFL AGYET+ST L+++   LS  P VQ +L  EI     R +  IE         YD L +L YL+ +I+ETLR YP ASTV  R C++         + IP G  V  N++ +HYD   W   DP +F+P RF+     +       +  AW+PFG GPR C G RFA++ ++  + + +  F    ++K   PL LK GATI P  GV++  ++R S
Sbjct:   31 KMGIPGPEPNFLFGNLLEFQKVPLYKKHQEWKQKYGTTYGYYEGPTPVLVTSDVNILEEVFVKQFNNFHARKLWPVQVDPDKDEDVHMFFARGRRWKRLRGVVNPAFSAAKIRKMTPTVNECINHLLDVMRDTANKTSHKTVELLDIFRRLTLDTILRCEVGIDQNSLKNPDDPILNHCKGVIND----TVKTPWLFLLGFLFPSLHCVWITLYKFLHNIKCNPAFWLE-----DRMREVVSMRRTLTNEHRNDLMQQMLDAQFASDSVKDLEN-------------------------EASKISNPYKKFLKSMTNEEIVSHALLFLLAGYETTSTTLAYLFFELSQNPHVQQRLRLEIMAVLPRGYHTIE---------YDDLKQLTYLDYVIWETLRKYPLASTVTARQCMRDCTV---GNMQIPMGMLVHANLWDVHYDPTHWGE-DPQSFNPLRFMPEQRRK------RHATAWMPFGGGPRACAGIRFALLQLKMVVSKVLRDFDFYPSDKLIVPLPLKQGATILPAEGVHLSARRRGS 522          
BLAST of cytochrome P450 3A29 vs. Ensembl Cavefish
Match: ENSAMXT00000056570.1 (cytochrome P450 3A56-like [Source:NCBI gene;Acc:103031560])

HSP 1 Score: 241.121 bits (614), Expect = 8.948e-72
Identity = 158/541 (29.21%), Postives = 278/541 (51.39%), Query Frame = 1
Query:  139 IPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEA--FNQRPGQRVELMKIRSTLVQVIEARRKCS--EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS*FRPRSQ 1746
            IPGP P  +FGNL+EYR   F+   ++  +++GK++ +FEG    + I D  +++ ++VK+ ++ F  R+ F +     +    ++F+ + + WKR+R  ++P+F+  +++ MF ++     + V  L E+  K  + + ++E     +MD+I   AF VD D   N + PF+ ++KK L     S L       LA + P L+ LLE   F+  P    +   +    ++ I+A RK    + R D+LQ+++D++  G +                 Q E                     +  K LT  E+++Q+ +F+FAGYETSS+ LSF  ++++  P+   KL QEI +           +   YDA+  + YL+A + E++R +P +   + R+C   + T   NGL IPQGT ++  VF +H D + W   DP TF+PERF + N   ++      P+ ++PFG+GPRNCIG RFA + ++  + + + RF V + +  + PLKL     ++P + + +    R +  R  +Q
Sbjct:   38 IPGPKPLPVFGNLLEYRKG-FHVFDMECYRKYGKIWGFFEGRDRVLCIVDKSIVKSILVKECYTYFTNRRDFGLNGELYD----ALFITKDEDWKRIRNHLSPSFTSGRLKEMFGIIQTHANTLVKNL-EKSSKNTEGVAVKEVFGAYSMDVITSTAFSVDIDSMNNPDDPFVTNIKKLLDFDVFSPL-----FLLAGLFPFLIPLLEKMKFSIFPAAVADFFFVS---LKKIKAERKAKNHKSRVDILQLMVDSQTEGEQ-----------------QGE---------------------EMKKGLTDHEILSQSMIFIFAGYETSSSTLSFFFYNIATNPETMKKLQQEIDQTFPN------NAPVQYDAVMNMEYLDAALNESMRLFP-SVARLERVC---KETIEINGLTIPQGTSIMIPVFPLHRDPEYWP--DPSTFNPERFTKGNKENID------PYVYMPFGSGPRNCIGMRFAQLAMKLAIVEILQRFNVINPDPDQVPLKLGTNIFLAPKDPIKLKFPPRANPSRTTTQ 508          
BLAST of cytochrome P450 3A29 vs. Ensembl Cavefish
Match: cyp3a65 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103031034])

HSP 1 Score: 226.868 bits (577), Expect = 1.642e-66
Identity = 156/530 (29.43%), Postives = 273/530 (51.51%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSE--KRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSREL--YDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNI 1704
            +  +PGP P    G ++EY+   F    ++  K++GKV+  ++   P + I D ++L+ +++K+ +S F  R+ F +   P  D   ++ +     WKR+R+ ++P+F+  +++ MF ++     + V  L  +  K+ +  +I+E     +MD++   AF VD D   N + PF+ ++KK LK   L+ L  AV L    I PVL  +   F         +M      ++ I+++R  S+  KR D LQ++ID++                                     +E+   + K     LT  E+++Q+ +F+FAGYET+S+ LSF  ++++  P+   KL QEI        D++  +  L  YDA+  + YL+A + E+LR YP A+  + R+C K+      N L IPQ T V+  VF +H D + W   +P TF PERF + N   ++      PF ++PFG+GPRNCIG RFA++ I+  + + + RF V  +E+T+ PL+L +   ++P + + +
Sbjct:   35 RIGVPGPKPLPFIGTMLEYKQG-FQNFDLECFKKYGKVWGIYDARQPVLCIMDREILKTILIKECYSLFTNRRNFRLN-GPLYD---AVSIIEDDDWKRIRSVLSPSFTSGRLKEMFGIMKTHSHTLVQNLG-KTSKRGEAADIKEIFGAYSMDVVTSTAFSVDIDSLNNPDDPFVTNIKKMLKFDFLNPLFVAVAL-FPFIAPVLEKMNFCFFPP-----AVMDFFYAALKKIKSQRVSSDNKKRVDFLQLMIDSQ------------------------------------KSEKVEHHDKGAIHGLTDHEILSQSMIFIFAGYETTSSTLSFFFYNIATNPETMKKLQQEI--------DQTFPNESLIQYDAVMNMDYLDAALSESLRLYPPAAR-LERVCKKTVEI---NRLTIPQNTVVLAPVFPLHRDPEYWP--EPDTFKPERFTKGNKENID------PFVYMPFGSGPRNCIGMRFALVTIKLAIVEILQRFDVILSEETKVPLELGISGLLAPKDPIKL 496          
BLAST of cytochrome P450 3A29 vs. Ensembl Cavefish
Match: ENSAMXT00000012911.2 (cytochrome P450 3A56-like [Source:NCBI gene;Acc:103031560])

HSP 1 Score: 225.713 bits (574), Expect = 6.966e-66
Identity = 151/523 (28.87%), Postives = 267/523 (51.05%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFN-QRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSREL--YDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISP 1686
            K  IPGP P  LFG ++EYR   F+   ++  +++GK++  F+G  P + I D  +++ ++VK+ ++ F  R+   +     +    ++F+ + + WKR+R  ++P+F+  +++ MF ++     + V  L +   +K + I +++     +MD+I   AF VD D   N   PF+ ++KK L    LS      +  +A + P  + LLE        Q V    + S      E   K  + R D+LQ+++D++        ED+           Q E                     +  K L+  E+++Q+  F+FAGYETSS+ LSF  ++++  P+   KL +EI        D++  ++    YDA+  + YL A + E++R +P  +  + R+C   + T   NGL IPQGT ++  VF +H D + W+  DP TF+PERF + N   ++      P+ ++PFG+GPRNCIG RFA++ ++  + + + RF V + +  + PLKL +   +SP
Sbjct:   35 KLGIPGPKPLPLFGTMLEYRKG-FHAFDMECYRKYGKIWGIFDGREPVLSIADQTIVKSILVKECYTYFTNRRDVGLNGELYD----ALFVTKDEDWKRIRNHLSPSFTSGRLKEMFGIMKTHTNTLVKNLEK--SRKNEGIAVKDVFGAYSMDVITSTAFSVDIDSMNNPKDPFVTNIKKMLDIDFLSP-----IFIVAMVFPFALPLLEKMKISFFSQSVSDFFLGSLKKIKTEREAKNHKSRVDILQLMVDSQT-------EDD----------QQGE---------------------EMKKGLSDHEILSQSMSFIFAGYETSSSTLSFFFYNIATNPETMKKLQREI--------DQTFPNKTPVNYDAVMNMEYLEAALNESMRLFPVVAR-LERVC---KETIEINGLTIPQGTSIMIPVFPLHRDPEYWS--DPSTFNPERFTKGNKENVD------PYVYMPFGSGPRNCIGMRFALLAMKLAIVEILQRFDVINPDPNQVPLKLGIHPFLSP 487          
BLAST of cytochrome P450 3A29 vs. Ensembl Cavefish
Match: tbxas1 (thromboxane A synthase 1 (platelet) [Source:ZFIN;Acc:ZDB-GENE-030131-8805])

HSP 1 Score: 204.527 bits (519), Expect = 2.072e-58
Identity = 149/531 (28.06%), Postives = 249/531 (46.89%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICK-CAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
            +  I  P P   FGN++ +R+  F++       ++G+V  Y+ G  P VV+ DPD+L++VMVK+F  F  R        P  +   S+ + R +RWKR+R+ + P+FS AKM+ M P+++ +  + +N L    +   +  +I  Y   L    + +  +F +    +  +N  FI  ++K +K+ +             E+ P         NQR                           R D LQ+++D      + +  +N   +N      + + Q  EE  +   +   +  + +  + +T +E++ QA LFL AGYETSS  L+F  + L++ PD Q+KL +E+     +      GS + Y  +  L YL+ ++ E LR YP       R     E   + NG ++P+G  +  +   +H+D   W   +P  F PERF        E     +PF +LPFGAGPR+C+G R A + IR  L     +F V + E T+ PL+LK   T+ P NG+ + + KR
Sbjct:   19 RCGIRHPKPIPFFGNMMLFRHG-FFDAHRDLINQYGRVCGYYLGRRPVVVVADPDMLRQVMVKEFQKFPNRMKLRAATKPMTE---SVLMLRNERWKRVRSILTPSFSAAKMKEMVPLINTATETLLNNLKSYAESG-ESFDIHRYDCTLAFPFLIRPLSFIIPNKSRDEMNGFFISCIQKIIKQRD-------------ELPP---------NQR---------------------------RRDFLQLMLDVRS-SKECVSLENFDVVNHADEQAEEQPQVAEEAANGPGSSGDAPKRPQQKRMMTEDEIVGQAFLFLLAGYETSSNTLAFACYLLAINPDCQEKLQREVDDFFTRH-----GSAD-YTNVQELKYLDMVVCEALRLYPPG----FRFARDVEEDCVINGQFLPKGATLDISAGFLHHDPQYWP--EPEKFIPERFTP------EAKASRHPFVYLPFGAGPRSCVGMRLAQLEIRMALVNIFKKFNVVACEDTKVPLQLKSSTTLGPKNGIFVKITKR 476          
BLAST of cytochrome P450 3A29 vs. Ensembl Cavefish
Match: ENSAMXT00000055169.1 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103030124])

HSP 1 Score: 197.593 bits (501), Expect = 1.430e-55
Identity = 144/514 (28.02%), Postives = 258/514 (50.19%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVS--MFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKL 1662
            K  IPGP P   FG  + Y    FY+   +  K++GKV+  F+G  P +++ D ++++ +MVK  +S F  R+    + N D     +  + + + ++WKR+R +++P F+  K++ +FP+ ++    F+  L +R       + +++     +MD++   +F VD D   N + PF   +KKF      S L   +VL  +        +L         + ++    ++L ++ +     + KR D +Q++I  ++                  S +QAE                SS++++  K LT  E+++Q+ +F+  GYET+ST L+F+L++L+  PD  +KL +EI  +         G+   YDAL +L YL  +I E++R +P A   + R+C K   T   NG+ IP+ T V    + +H D  +W S  P  F PERF   N          +P+ ++PFG GPRNC+G RFA+M+++  + + +  F V + ++T+ PL+L
Sbjct:   34 KLGIPGPKPWPFFGTFLSYTKG-FYKFDTECYKKYGKVWGIFDGRLPILMVSDYEMIKSIMVKDCYSVFTNRR----ETNKDLAGPFADGISIVKDEKWKRIRASVSPFFTSGKLKEIFPIAEKYGDRFIENLKKRSPD--GPVKVKDVFAPFSMDVVASASFSVDIDSINNPDDPFGAHIKKFFNFSFFSPLFLFLVLFPSAAG-----ILGKMGFSMFAKSDMEFFYTSLKKLKDQHNNMNHKRVDFMQLMIQGQI------------------SDHQAE----------------SSSEEQPIKGLTDHEILSQSFIFMLGGYETTSTTLTFLLYNLATNPDCLNKLMKEIDEMFPH------GAPVTYDALMKLEYLEMVINESMRLFPTAPR-LERVCKK---TVELNGITIPKDTLVTIPAYVLHRDPQLWES--PEEFRPERFSPENNI--------DPYLFMPFGLGPRNCVGMRFALMIMKLVVVKLLQNFNVETCKETQIPLQL 481          
BLAST of cytochrome P450 3A29 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010515.1 (pep scaffold:Pmarinus_7.0:GL494623:61763:74387:-1 gene:ENSPMAG00000009504.1 transcript:ENSPMAT00000010515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 3.090e-52
Identity = 145/521 (27.83%), Postives = 246/521 (47.22%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICK---------CAF-GVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKL 1662
            K  +PGP P    G  + Y    F E      K++G+++  ++G  P +V+ D  +L+ V+VK    F   +       P ++   +M +A  ++WKR+R  ++P FS  K+++M P++     S V  L E+       ++++E      + + CK         CA  G   +  ++ +   ++        +NL+T          E+ P L +L  +F  +         +R + V +    +K ++ R D LQ+++D ++  +    ++   P +D                                K LT  E+ AQA LFL AGYET+STA++F+ + L+  PDVQ K+ QEI R    + + ++ S   Y+ L ++ YL+ ++ ETLR YP  S    R+C K   T + N L IP+G  V   ++ +HYD   W   +P  F PERF +      E     +P+ +LPFG GPRNCIG RFA+M ++  +C+ + R+   +  +T  P KL
Sbjct:   30 KMGVPGPTPLPFLGTFLHYHQG-FKEFDQNSFKKYGRIWGTYDGRLPLLVVADTSILKTVLVKDSLEFFTNRRNIGLNGPFKE---AMSIANDEKWKRIRNVLSPTFSGGKIKQMCPLIVRCADSLVKNLREKCQSG-KLVDLKE------LHVSCKLRISLPKSLCALIGKYGNFTSDTSRQMVLCFTG----INLTTP------IFPELVPPLEFLGLSFFPKKASSFFTTIVRQSDVNI----KKNNKGRVDFLQLMVDVQLSKSM---QNGANPHSD--------------------------------KYLTDSELEAQAILFLLAGYETTSTAITFVAYCLACNPDVQTKVQQEIDRF---LPNDTLPS---YEILKQMEYLDMVVSETLRMYPPTSRT-DRVCKK---TTVVNDLVIPKGVVVTVPLWVLHYDPQYWD--EPEEFRPERFSK------EAKEARDPYCYLPFGQGPRNCIGMRFALMSMKIVVCRILQRYSFHACNETTIPPKL 472          
BLAST of cytochrome P450 3A29 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004192.1 (pep scaffold:Pmarinus_7.0:GL501190:14217:30704:1 gene:ENSPMAG00000003752.1 transcript:ENSPMAT00000004192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 4.906e-49
Identity = 151/544 (27.76%), Postives = 256/544 (47.06%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNE---------RGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKK-FLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCS----EKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKT--------------ENPLKLKVGA 1674
            K  +PGP P  L G    Y    F E   +  +++G+V+  ++G  P +++ D ++L++++VK    +F  R+ F +   P +D    + +A  + WKR+R  + PAFS  K+++M P++       V  L+E           D+KF    I ++L+           FG     +   + P   +LK  FL E   S L A ++     I P+    +  F+++       +     +VQ ++ +R+      + R D LQ +++A+              +++NTS                            ++ LT  E+ +QA LFL AGY+ +ST+++F+ + L+  PDVQ K+ QEI  +   + D   G    Y+ L ++ YL+ ++ ETLR Y  +S+   R+C K   T + N L IP+G  V   ++ +HYD   W   +PH F PERF +      E     +P+ +LPFG GPRNCIG RFA+M ++  +C+ + R+   +  +T              E PLK+KV A
Sbjct:   35 KMGVPGPTPFPLVGTFHHYLKG-FREFDAESFRKYGRVWGIYDGRVPVLMVTDTNMLKQILVKDCLESFTNRRKFGLS-GPIKD---VLLIAEDEHWKRIRNVLTPAFSGGKIKQMCPLIQRCAEVLVQNLHEPCQLEQPVDLKDEKFGS-GILDHLE------FEGEGFGEIVKQKVFPHDPVPKALKYIFLCE--FSPLFAVILFFPFLISPLERLGVTLFDKKA------IHFFHKIVQQMKNKRQKGLNDMQGRVDFLQQMVNAQ--------------LSENTS--------------------------NGNEDLTDGELESQAVLFLMAGYDNTSTSITFLAYCLACNPDVQTKVQQEIDTI---LPD---GKLPDYETLKQMEYLDMVVCETLRMYS-SSSRTDRVCKK---TTVVNDLVIPKGVVVTVPLWVLHYDPQYWD--EPHEFRPERFTK------EAKEARDPYCYLPFGHGPRNCIGMRFALMSVKIAVCRILQRYSFQTCSETTIPPQFNKNTFLQLEKPLKVKVVA 500          
BLAST of cytochrome P450 3A29 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010493.1 (pep scaffold:Pmarinus_7.0:GL494623:34025:53335:-1 gene:ENSPMAG00000009498.1 transcript:ENSPMAT00000010493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 4.805e-48
Identity = 135/521 (25.91%), Postives = 245/521 (47.02%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNF--HGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLE--AFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATI 1680
            K  +PGP P  LFG  + Y +  F     +  + +G+V+  ++G  P +++ D ++L++++VK    F  + RK+       +E     +     ++WKR+R  ++P FS  K+++M+P++       V  L+E+       +++++      ++     A+ +          P ++S  K +  +N+  ++     +L+ + PV V L E    +  P +     K      +   +    ++ R D LQ+++DA++  T                                     +     + K LT  E+ AQA LFL AG+ET+STA++F+ + L+  PDVQ K+ QEI    E + D    S   Y+ L  + YL+ ++ ET+R YP A+  + R+C +   T   + L IP+   +  + + +HYD   W   +P+ F PERF +      E     +P+ +LPFG GPRNCIG RFA+M ++  +C+ + R+      +T  P KL  G+ +
Sbjct:   35 KMGVPGPTPLPLFGTFLHY-SKGFRAFDEESFQRYGRVWGIYDGRLPVLMVADTNMLKQILVKDCLEFFTNHRKI-----GLNELFGEGLSTVDDEQWKRIRNILSPTFSSGKIKQMYPLILRCADVLVKNLHEKCQSG-KSVDLKQGNGEWRLETNRVTAYKIFIALVKRPPPPLLLSRSKMI-NINIYNVQR---FSLSALFPVFVPLFEYMGLSLFPKKICIFFKNIVQQFKTDISMNYSTKGRVDFLQLMVDAQLSET-----------------------------------VQNGANPHSEKYLTDSELEAQAILFLLAGFETTSTAITFVAYCLACNPDVQTKVQQEID---EFLPDDKAPS---YEILNEMEYLDMVVSETMRMYPPAAR-LDRVCKR---TTTVDNLVIPKDVVITVSTWVLHYDPQHWE--EPNEFRPERFTK------EAKEARDPYCYLPFGQGPRNCIGMRFALMSVKIAVCRILQRYSFQMCSETTIPPKLAKGSIL 491          
BLAST of cytochrome P450 3A29 vs. Ensembl Sea Lamprey
Match: cyp4t8 (cytochrome P450, family 4, subfamily T, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-031219-3])

HSP 1 Score: 138.658 bits (348), Expect = 2.661e-35
Identity = 123/517 (23.79%), Postives = 226/517 (43.71%), Query Frame = 1
Query:  142 PGPPPNFLFGNLIEYRNNT-FYELLIKWQKEFGKVFVYFEGPTPNVV-IGDPDLLQEVMVKQ--FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEA---FNQRPGQR----VELMKIRSTLVQVIEARRKCSEKR-FDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPL 1656
            PGP  ++L+GN+  + ++    +  +K+ KE+      + GPT + + +  PD  + V+       +     L P   N        + +  G +W R R  + P F    ++    ++ +S AS ++K  ER  +K   + +   +  L +  I KCAF  + +CQT   + ++ ++        L+ L        A     + YL  A   F +  G       ++++ R   +++   + K  +KR  D L +L+ +        D D                                       + L+ EE+  + +  +FAG++T+++ LS++LH+L+  P  Q+    E +R+       +  S+  +D +  LPY   +I E+LR YP   ++I ++   ++   L +G  +P G  V  ++F IH +++ W   DP  F P RF Q N          +P+A++PF AGPRNCI Q FA+  +R T+   + RF++ S      PL
Sbjct:   42 PGPGRHWLYGNVHCFPDDERALQNELKFSKEYSFATPLWFGPTVSYLSMTHPDYARAVLTTSEPKDDVAYEFLIPWIGN-------GLLVLSGPKWFRNRRLLTPGFHYEILKPYIAIIGQSTASMLDKW-ERLTEKQPTLEVFGDISLLMLHSILKCAFSYEGNCQTEAGNSYVRAV------YELTDLVHRRFRNFALHNKWVYYLTPAGRRFQKAKGHAHKHTEDVIRRRRETLKLEAQQDKTQQKRNLDFLDILLSSR-------DADG--------------------------------------QSLSDEEIRTEVDTIMFAGHDTTASGLSWVLHALASNPHHQEVCRDEAARV------LAGRSQPEWDDISNLPYTTMVIKESLRLYPPVPSIIRKL---TQPLKLPHGHVLPAGMRVCVSIFCIHRNEEFWK--DPEVFDPLRFSQENSAHR------HPYAFIPFSAGPRNCIDQNFALNELRVTVAMILSRFRIHSASPPAWPL 482          
BLAST of cytochrome P450 3A29 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000063.1 (pep scaffold:Pmarinus_7.0:GL478178:2662:7225:1 gene:ENSPMAG00000000058.1 transcript:ENSPMAT00000000063.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 6.891e-32
Identity = 83/298 (27.85%), Postives = 139/298 (46.64%), Query Frame = 1
Query:  829 EARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            E R+     R D LQ ++DA++  + + +   + P                                   K LT  E+++QA +FL AGYET++  L++I ++L+V+ DVQDKL +EI        D ++     Y     LP+   ++ E+LR YP A  +     +  E      G+ +P+GT +   VF IH   + W   DP  F PERF +    +       + + +LPFGAGPRNCIG RFA++ ++  +   + RF   +  +T+ P ++ +   + P   + +   +RN
Sbjct:   37 ERRKGEHTDRVDFLQTMVDAQISDSVMDEHGGIIPY----------------------------------KALTDSEILSQAMVFLLAGYETTAVTLTYIAYNLAVHVDVQDKLLEEI--------DATLPPEAPYCYRILLPH---VVSESLRLYPPAGRLERIAKMDVE----LGGIPVPKGTVIGIPVFVIHRHSEHWD--DPTAFRPERFSKEAREQR------DQYCYLPFGAGPRNCIGMRFALINVKIAIVSLLRRFTFVTCPETKIPAEIGIRGLLEPKEPIILKFAERN 277          
BLAST of cytochrome P450 3A29 vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 79.7221 bits (195), Expect = 3.649e-16
Identity = 62/231 (26.84%), Postives = 110/231 (47.62%), Query Frame = 1
Query: 1039 KPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQ-SNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPL--KLKVGATISPINGVNIVLKKRN 1722
            +  T +E+      FLFA  + SS+   ++   ++  PDV  K+ +E       + +  + +    D + ++ Y N +I ETLR+ P    V+    +  +   +S     P+G  +IP ++   +D +++   +P  F PER+++ S  +E +         WL FG GP  C+GQ + M+   A L +F      +    T  PL  K+KV ATI P + + +  KKR+
Sbjct:  319 REFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREE----QLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRP---PVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYE--NPDEFIPERWVEGSKASEAKK-------NWLVFGCGPHVCLGQTYVMITFAALLGKFAL---YTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKRD 530          
BLAST of cytochrome P450 3A29 vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 73.1738 bits (178), Expect = 4.111e-14
Identity = 61/212 (28.77%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 1078 LFLFAGYETSSTALSFILHSLSVYP-DVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIW-TSVDPHTFSPERFLQSNGTELEFIG-----PPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPIN 1692
            + L AG+E      +  L+ L+ Y  + Q+KL +E++ + +               L  LP LNA ++E +R YP  ST+I+R   K+    L   + IP+G +V  N F   +D   W T+ D   F PER+    G+++E I        N  A   F  G R C+G++ A+  +R +L + + +F+ S   + E   KL     + P+N
Sbjct:  289 IILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDP------------KGLADLPLLNAFLFEVVRMYPPLSTIINRCTTKT--CKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTAD--DFKPERW----GSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEE--KLTPAGPLCPLN 478          
BLAST of cytochrome P450 3A29 vs. Ensembl Yeast
Match: ERG11 (Lanosterol 14-alpha-demethylase; catalyzes C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in ergosterol biosynthesis pathway; transcriptionally down-regulated when ergosterol is in excess; member of cytochrome P450 family; associated and coordinately regulated with the P450 reductase Ncp1p; human CYP51A1 functionally complements the lethality of the erg11 null mutation [Source:SGD;Acc:S000001049])

HSP 1 Score: 68.1662 bits (165), Expect = 1.582e-12
Identity = 74/245 (30.20%), Postives = 113/245 (46.12%), Query Frame = 1
Query: 1045 LTTEEVIAQANLF---LFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSREL-YDALGRLPYLNALIYETLRFY-PFASTVIHRMCLKSEGTHLSNGLY-IPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQ------SNGTELEF------IGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTE-KTENPLKLKVGATISPINGVNIVLKKRN 1722
            +T +E+   ANL    L  G  TS+   ++IL  L+  PDVQ +L++E  R+ +       G +EL YD L  +P LN  I ETLR + P  S  + R  +K    H+ N  Y IP G  V+ +    H   + + +   H F+  R+ +      S G E+++       G  +P+  LPFG G   CIG+ FA   +   +  F+   +    E KT  P       T+ P     I+ +KRN
Sbjct:  299 MTDQEI---ANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDG------GKKELTYDLLQEMPLLNQTIKETLRMHHPLHS--LFRKVMKD--MHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNA--HQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPY--LPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTL-PTGPAKIIWEKRN 525          
BLAST of cytochrome P450 3A29 vs. Ensembl Nematostella
Match: EDO36023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJV6])

HSP 1 Score: 228.024 bits (580), Expect = 2.629e-67
Identity = 158/533 (29.64%), Postives = 260/533 (48.78%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNL---IEYRNNTFY-ELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKC-SEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
             IPGP P    GNL    E +++T+  E L+K    +G++  Y+ G    +++ DP++ ++++VK+F  F  R +    + P  D+  ++   +   W+RLR TI P FS  K++++ P+++ES    V KL E   K    +++     + TM+ I   AFG+D   QTN N  F+ + ++     +L  + A +   L  I  ++V  L    Q    +   M I     Q+I+ RR+  S+ R DLL++L+ AE       D+D                                    +    L+ +E++AQ   F+ AGYET+S  ++F  + L++ PD QD+L +EI  +       ++G    YD +  + YL  ++ E LR YP       R C +S      NG + P+G  V+  VFA+H D +IW   +P  F PERF        E     +P+A LPFG GPRNCIG RFA++  +  L   +  +++    +TE P++L+   TISP +G+ + + KR
Sbjct:   44 GIPGPKPWPFIGNLPILYEKKHDTYAQEYLVK---TYGRLCGYYMGTRAAILVADPEMAKQILVKEFDKFVNRPIVQSAQTPPTDK--TLLSLQDDDWRRLRHTITPTFSAVKLKQVLPLINESCRILVEKLGE-ACKDGKSVDVLRSYGKFTMETIVTTAFGIDCQTQTNPNDQFVPNAQRLFGGQSLFRMLAVLFPYLQPIVSLMVKQLGLGKQTETGK-SAMFIVDAARQIIKHRRETGSQGRKDLLEILLSAET-----TDDDG-----------------------------------RRKNKLSDDEIVAQCFTFILAGYETTSNTMAFTSYLLALNPDKQDRLIEEIDEVA-----ATVGDNFDYDTVLGMEYLEMVVQEALRLYP-PGFRFGRTCNQSCTI---NGQFFPKGCIVLIPVFAMHRDPEIWP--EPEKFQPERFTA------EAKQARHPYAHLPFGGGPRNCIGMRFALLEAKMALVYILRYYRLERCPETEVPVQLQGTITISPKHGIYLKITKR 512          
BLAST of cytochrome P450 3A29 vs. Ensembl Nematostella
Match: EDO46449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ80])

HSP 1 Score: 226.483 bits (576), Expect = 3.411e-67
Identity = 154/533 (28.89%), Postives = 265/533 (49.72%), Query Frame = 1
Query:  139 IPGPPPNFLFGNLIEY--RNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGR-KLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARR-KCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYP--FASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
            IPGP      G LI+             ++ + +G+V+  +   +P +VI DPD+L+EV+VK+F +FH R   FPM +  D      MF A G+ W R+RTT++P FS  KM+ + P+++ S    ++KL +  +K  +  N+    Q LTMD I +  FG+++  Q N + P  V+ +  L+      +  AVV  +   KP+       F     + VE+ +      +VI A++ + +  R D+L ++++A +              +D T                              K +T  E+IAQ  +F+ AGYE +++AL+FI ++L+  PD+Q+KL QEI  +     D+ +     YD L  L YL+ ++ ETLR YP    +  + + C+         G    +G  ++ +V+++H+D ++W   +P  F+PERF        E     NP A+LPF AGPRNC+G RF++M ++  L + + ++  + T+ T+ P  LK G+ ++    + + +K R
Sbjct:    1 IPGPNHLPFIGTLIDTIKHGGDIRLQFAEYSRTYGRVYGLYLFGSPTIVINDPDILKEVLVKEFHSFHDRPAFFPMPEPFDS----MMFFAEGETWHRVRTTVSPIFSAHKMKMVLPLMNNSCDIMMSKLQQAAEKG-EPFNMYRMGQSLTMDFILRIVFGIESSVQHNYDDPAFVAARSALEASTFQKIAGAVVGMMP--KPIKKMFSRVFFSHTKELVEMTE------KVIAAKKTQENSTRKDILDLMLEAMI--------------DDETK----------------------------KKRMTEAEIIAQCLIFMIAGYEGTNSALTFICYNLATNPDIQEKLQQEIDSVWTD-ADQVLS----YDILNELSYLDMVVSETLRMYPPGMLTRAVTQDCV-------IQGRRFRKGNAILMDVYSLHHDPELWP--EPERFNPERFTA------EAKQSRNPCAYLPFSAGPRNCVGMRFSLMELKLALTRILKKYSFAVTQNTKIPPTLKAGSALTCGGEMMLGVKAR 458          
BLAST of cytochrome P450 3A29 vs. Ensembl Nematostella
Match: EDO30263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A1])

HSP 1 Score: 225.713 bits (574), Expect = 1.581e-66
Identity = 157/523 (30.02%), Postives = 259/523 (49.52%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEY-RNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIK-PVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGV 1698
            NIPGP P    GNL +  R    +   ++  +E+GKVF +  G TP +V+GDP++L+ VMVK+F NF  R  F + ++   +    MF A   +WKR+R+T+ P F+  K+R+M P + ES  + ++K+ +  D   + ++I     ++T+++I   AFG+D++ Q N N+ F    K+  K      L+  ++L  A +   +  +L+   N +    ++L K      +++  R   +  R D + +++ A  P                                              S+ L+  E+IAQ+  FL AG+ETSS ALS   + L++ P+VQ++L  EI    E   DKS      ++    L YL+ ++ E LR +P     +H M  +     + NG+ IP G  V    +++H+D D W   +P  F PERF    G   E     +PF ++PFGAGPRNCIG RFA+  ++  L Q + +++   +  T+ PL L  GAT+ P +G+
Sbjct:   43 NIPGPTPLPYIGNLRDIQRLGGIHVAPVRLMQEYGKVFAWSVGRTPAIVVGDPEILKHVMVKEFQNFRNR--FLLFRDTRSEMLHGMFSATDDKWKRIRSTLTPTFTSGKLRQMNPKIRESCDTLMDKIGKVADTG-ESVDILGMFCQMTLEVILSTAFGIDSEVQKNPNNTFSDKAKEIFKSPTF--LRMFLMLPFASVFFKIFRFLIHNNNMK--YFIDLSK------EILSKRHDKTFNRKDFVDLMLSAVNP--------------------------------------------DGSRKLSDPEIIAQSVTFLLAGHETSSNALSATAYYLALNPEVQERLRLEIRMAAETNSDKSP-----HELANDLEYLDCVVNEVLRLHP----PVHTMNRECAQACVINGITIPAGMDVTIPFYSLHHDPDAWP--EPDKFDPERF---RGPAKE---SRHPFQFIPFGAGPRNCIGMRFALNEVKLVLFQILSKYKFVRSPDTQVPLVLIPGATLIPRDGI 491          
BLAST of cytochrome P450 3A29 vs. Ensembl Nematostella
Match: EDO33558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX7])

HSP 1 Score: 220.32 bits (560), Expect = 9.541e-65
Identity = 160/507 (31.56%), Postives = 256/507 (50.49%), Query Frame = 1
Query:  136 NIPGP---PPNFLFGNLIEYRN---NTFYELLIKWQKEFGKVFVYF-EGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGK--RWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAA-VVLTLAEIKPVLVYLLEAF-NQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQ 1623
            ++PGP   P      +LI ++    N F E    + K++G+++  F  G  P+V++GDPD+++ +MVK+FS+F  R + P             F+ R K  +W R+RT+++PAFS  KM+ M P+++ S    +NKL +  D       + ++ Q LTMD I K AFG+ ++ QTN + P   + +K     ++ST  A  V+L L  + P   Y+   F +   G   ++MKI + +++V +       K  D+L +++ A                N+NTS                             K L+  EV+AQ+ +FL AGYET++  LSF+ +SL+  PDVQ+KL +EI  +    E+  + S   YD +  LPYL+ +I ETLR YP    V  R C +     +  G    +G  +  + +++H+D + WT  DP  F PERF +      E     +P+++LPFG GP NCIG RFA M I+  L + + +F 
Sbjct:   47 DLPGPTALPFIAHLHDLIRHKGQMQNQFQE----YYKKYGRLYAMFLVGKKPSVIVGDPDIVKNIMVKEFSSFQDRPVEPFNS----------FMTRAKYDKWHRIRTSLSPAFSAHKMKLMVPLINSSCDVLINKLTKIADSG-TSFFVHKFHQGLTMDTILKTAFGIHSEAQTNYDDPAFTAARK-----SMSTSPARRVMLFLIFLMPFRKYIFRWFPSLLIGNFDDIMKITTKMIEVKKVNPHKEAK--DMLDLMLSAAA--------------NENTS-----------------------------KKLSDMEVLAQSLIFLIAGYETTNITLSFVAYSLATNPDVQEKLQREIDSVWT--EEDQMPS---YDTVHNLPYLDMVISETLRLYP-PGFVASRECTQD---CVIKGYRFRKGLSIFIDAYSMHHDPEFWT--DPERFDPERFSR------ECKQSRDPYSYLPFGHGPHNCIGMRFAQMEIKLALVRVLRKFS 471          
BLAST of cytochrome P450 3A29 vs. Ensembl Nematostella
Match: EDO33559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX8])

HSP 1 Score: 218.779 bits (556), Expect = 3.350e-64
Identity = 158/512 (30.86%), Postives = 264/512 (51.56%), Query Frame = 1
Query:  136 NIPGP---PPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYF-EGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLN---ERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAF-NQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERF-LQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKT 1644
            ++PGP   P      +LI ++     +   +++K++G+++  F  G  P VV+ DP++++ +MVK+FS+F  R  F M++    D    M  A+ ++W R+R T++PAFS  KM+ M P+++ S    +NKL    E G+  F      ++ Q LTMD I K AFG+ ++ QTN + P   + K   K ++ ST +  V++TL  + P   Y+ +AF +   G    L+++   +V+V ++      K  D+L +++ A                N+NTS                             K L+  EV+AQ+ +FL AGYET++  LSF+ +SL+  P+VQ+KL +EI  +    E+  + S   YD +  LPYL+ +I ETLR YP    V  R C +     +  G    +G  +  + +++H+D + WT  DP  F PERF  ++N +        +P+++LPFG GP NC+G RFA M ++  L + + +F   +T  T
Sbjct:    7 DLPGPTALPFIAHLHDLIRHKGQILKQFQ-EYRKKYGRLYAMFLVGKKPCVVVADPEIVKHIMVKEFSSFRDRPSFVMEQPEPFDSM--MTSAKYEKWHRIRNTLSPAFSAHKMKLMVPLINSSCDVLINKLTKVAESGESFF----THKFHQGLTMDTILKTAFGIQSEAQTNYDDP---AFKAARKSLSTSTTRR-VIVTLLFLMPFKNYIFKAFPSLVIGNFEGLLEMTKMIVEVKKSNLHNEAK--DMLDLMLSAAA--------------NENTS-----------------------------KKLSDMEVLAQSLIFLIAGYETTNITLSFVAYSLATNPEVQEKLQREIDSVW--TEEDEMPS---YDTVHNLPYLDMVISETLRLYP-PGFVASRECTQD---CVIKGYRFRKGLPIFIDAYSMHHDPEFWT--DPERFDPERFSSEANQSR-------DPYSYLPFGHGPHNCVGMRFAQMEMKLALVRVLKKFSYVATADT 444          
BLAST of cytochrome P450 3A29 vs. Ensembl Medaka
Match: tbxas1 (thromboxane A synthase 1 [Source:NCBI gene;Acc:101158441])

HSP 1 Score: 239.58 bits (610), Expect = 9.501e-71
Identity = 165/538 (30.67%), Postives = 264/538 (49.07%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMK--IRSTLVQVIEARRKC--SEKRFDLLQMLIDAEVPG-TKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQG-TFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            +Y I  P P   FGNL  +R   F++ L    K  G+V  Y+ G  P VVI DPDLL++VMVK FS+F  R        P  D    +   + +RW+R+R+ + P+FS AKM+ M P+++      +  L    +      +I       TMD+I   AF    D Q   + PF+   + F        +    +   + + PV  ++       P +R + M       + ++I+ R +    ++R D LQ+++DA        LD+ +     D T  N   + +D+E +  E     S+ ++   K +T +EV+ QA +FL AGYET+S+ L F  + L+V+P+ Q K+ QE+ +   + E         Y  +  L Y++ ++ ETLR YP       R   + E   + NG+ +P+G T  IP  F +HYD + W+  +P  F PERF        E     +PF +LPFG+GPRNC+G R A + I+  L      F V +  +T+ PL+LK  +T+ P NG+ + + KR +
Sbjct:   45 RYGIKHPKPVPFFGNLFLFREG-FFKPLNDLIKTHGRVCGYYLGRKPVVVIADPDLLRQVMVKDFSSFPNRMTLRFATKPMVD---CLLALKDERWRRVRSILTPSFSAAKMKEMVPLINTVTEVLMKNLTTHAESG-QAFDIHRCFGFFTMDVIASVAFATQVDSQNKPDDPFVHHAQMFFTFSFFRPMMMFFIAFPSLMAPVARFI-------PNKRRDEMSNFFIHNIQKIIKQREEQPPDQRRRDFLQLMLDARTAKECASLDQFDTSNHGDETLTNPKAASSDQESSRSEE----SALRRPQKKMMTEDEVVGQAFIFLLAGYETTSSTLGFTCYLLAVHPECQHKVQQEVDQFFSRHESPD------YTNIQELKYMDMVVSETLRLYPPG----FRFAREVEEDCVVNGVRLPKGATLEIPAGF-LHYDPEYWS--EPEKFIPERFTA------EAKASRHPFVYLPFGSGPRNCVGMRLAQLEIKMALAHLFRSFSVVACSETKVPLELKSSSTLGPKNGIFVKITKREA 547          
BLAST of cytochrome P450 3A29 vs. Ensembl Medaka
Match: cyp3a (cytochrome P450, family 3, subfamily A [Source:NCBI gene;Acc:101155406])

HSP 1 Score: 217.238 bits (552), Expect = 6.440e-63
Identity = 154/547 (28.15%), Postives = 276/547 (50.46%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIR----------STLVQVIEARRKCSEK--RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRE--LYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            +  IPGP P   FG ++ YR   F     + +K++GK +  ++G  P + I DP  ++ V+VK+ +S F  R+ F +   P  D   S+F A   +WKR+R+ ++P+F+  +++ MF ++    A+ VN + ++ DK  + +N++++    +MD++   AF VD D   N + PF+ ++KK LK   L+ L                +LL AF    G  +E M++            + +Q I++  K +++  R D LQ++ID++               N+   L                            K L+  E+++QA +F+FAGYET+S++L+F+ ++L+  P+V  KL +EI        D +  ++    Y  L  + YL++++ E+LR YP A+    R+   ++ T   NGL IP+   V+   + I  D ++W   +P  F PERF + N    +      P+ ++PFGAGPRNCIG RFA++ ++  L + + ++  S  ++TE P +L +   I+P   + + L  R++
Sbjct:   35 RLGIPGPKPVPFFGTMLAYRKG-FPIFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFHLN-GPMYD---SVFNAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLVNSMKKKADKD-EPLNLKDHFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPL----------------FLLVAFFPFLGPIMEKMELSFFPASAFDFFYSALQKIKSDHKNNKQKSRIDFLQLMIDSQ--------------KNNQNGLQD--------------------------KGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEI--------DATFPNKAPIQYAPLLEMEYLDSVVNESLRLYPIAA----RLERVAKATVEVNGLVIPKDMVVMVPTWPIQRDPELWP--EPEKFKPERFSKENKETFD------PYTYMPFGAGPRNCIGMRFALVSMKLALVEILQQYSFSVCKETEIPFELDIQGLIAPKRPIFLKLVPRSA 499          
BLAST of cytochrome P450 3A29 vs. Ensembl Medaka
Match: cyp3a40 (cytochrome P450 3A40 [Source:NCBI gene;Acc:100125817])

HSP 1 Score: 217.238 bits (552), Expect = 7.788e-63
Identity = 150/539 (27.83%), Postives = 275/539 (51.02%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAF--NQRPGQRVELMKIRSTLVQVIEARRKCSEK--RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRE--LYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            +  IPGP P   FG ++ YR   F+    + +K++GK +  ++G  P + I DP  ++ V+VK+ +S F  R+ F +   P  D   ++ +A   +WKR+R+ ++P+F+  +++ MF ++    A+ +  + ++ DK  + + ++EY    +MD++   AF VD D   N + PF+ ++KK LK   L+ L  AV        P L  +LE F  +  P     +M      ++ I+A  + +++  R D LQ++ID++               N+   L                            K L+  E+++QA +F+FAGYET+S++L+F+ ++L+  P+V  KL +EI        D +  ++    Y  L  + YL+ ++ E+LR YP A+    R+   ++ T   NGL IP+   V+   + +H D ++W   +P  F PERF + N    +      P+ ++PFGAGPRNCIG RFA+++++  + + +  +  S  ++TE P ++ V   ++P   + + L  R++
Sbjct:   35 RLGIPGPKPVPFFGTMLAYRKG-FFNFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFRLN-GPLYD---AVSIAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLIQSMKKKVDKD-EPLEMKEYFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLAVAFF-----PFLGPILEKFEFSLFPSS---VMDFFFAALRKIKANHENNKQKSRIDFLQLMIDSQ--------------KNNQNGLQD--------------------------KGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEI--------DATFPNKAPVQYVPLMEMEYLDCVVNESLRLYPIAA----RLERVAKATVEVNGLVIPKDMVVMVPTWPLHRDPELWP--EPEKFKPERFSKENKDTFD------PYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEVPFEMDVQGFLAPKRPIQLKLTPRSA 499          
BLAST of cytochrome P450 3A29 vs. Ensembl Medaka
Match: cyp3a40 (cytochrome P450 3A40 [Source:NCBI gene;Acc:100125817])

HSP 1 Score: 216.853 bits (551), Expect = 1.069e-62
Identity = 152/539 (28.20%), Postives = 277/539 (51.39%), Query Frame = 1
Query:  130 KYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAF--NQRPGQRVELMKIRSTLVQVIEARRKCSEK--RFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRE--LYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            +  IPGP P   FG ++ YR   F+    + +K++GK +  ++G  P + I DP  ++ V+VK+ +S F  R+ F +   P  D   ++ +A   +WKR+R+ ++P+F+  +++ MF ++    A+ +  + ++ DK  + + ++EY    +MD++   AF VD D   N + PF+ ++KK LK   L+ L  AV        P L  +LE F  +  P     +M      ++ I+A  + +++  R D LQ++ID++               N+   L                            K L+  E+++QA +F+FAGYET+S++L+F+ ++L+  P+V  KL +EI        D +  ++    Y  L  + YL+ ++ E+LR YP A+    R+   ++ T   NGL IP+   V+   + +H D ++W   +P  F PERF + N    +      P+ ++PFGAGPRNCIG RFA+++++  + + +  +  S  ++TE P +LK+G  ++P   + + L  R++
Sbjct:   35 RLGIPGPKPVPFFGTMLAYRKG-FFNFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFRLN-GPLYD---AVSIAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLIQSMKKKVDKD-EPLEMKEYFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLAVAFF-----PFLGPILEKFEFSLFPSS---VMDFFFAALRKIKANHENNKQKSRIDFLQLMIDSQ--------------KNNQNGLQD--------------------------KGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEI--------DATFPNKAPVQYVPLMEMEYLDCVVNESLRLYPIAA----RLERVAKATVEVNGLVIPKDMVVMVPTWPLHRDPELWP--EPEKFKPERFSKENKDTFD------PYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEFPFELKMG-FLAPKRPIQLKLTPRSA 498          
BLAST of cytochrome P450 3A29 vs. Ensembl Medaka
Match: ENSORLT00000004982.2 (cytochrome P450 3A30 [Source:NCBI gene;Acc:101157802])

HSP 1 Score: 216.083 bits (549), Expect = 2.704e-62
Identity = 153/513 (29.82%), Postives = 260/513 (50.68%), Query Frame = 1
Query:  136 NIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQ-FSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFN--QRPGQRVELMKIRSTLVQVIEARRKCSE-KRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKL 1662
             I GP P    GNL++ +   F+E   + Q ++G V+  FEG  P +++ DP++++ VMVK+ +S F  R+ F     P  +   S   A+ ++WKR+R++++P F+  +++++F +V       V KL E    K   I+I++++   T+D++   +F VD DC  N + P  V  +K  +   L T+       L  I P    LL+ F     P   VE       +++ ++ + K  +  R D LQ+LI++E+P  +I                                    ++Q++ SK LT  E+++QA  F+  GY+T+STALS+I + L+   D    L +EI    +K  + SI     Y+ L  L YL+ +I E+LR YP A     R+  + + T  + G  +P+G  V   V+ +H D   W+S  P  F PERF + N  EL      NP+A++PFG GPRNC+G RFA+++++  + + + R+ V + + T  P++ 
Sbjct:   52 GISGPMPMPYVGNLLQ-QGKGFFEFDHECQTKYGDVWGVFEGRQPILMVADPEIIKTVMVKECYSAFTNRRNFFEGDGPLTEAVAS---AKDEKWKRIRSSLSPCFTSGRLKQVFSIVSRYADRLVEKLGETYLNK--AIDIRQFVAPYTLDVVASASFSVDPDCINNPDDPINVQAQKATRFNFLPTI-------LQSIIPFGGRLLKLFKIETLPSANVEFF---IDIIRNLKDQHKTGKMNRPDFLQVLIESEMPDAEI-----------------------------------KNSQQQPSKGLTETEILSQALGFIVGGYDTTSTALSYIFYCLATNTDAMHTLQKEIDSNLQK--NSSIS----YEDLNGLEYLDQVINESLRLYPVAP----RLDRECKMTVETQGFTVPEGMIVGIPVYLLHKDPRFWSS--PELFRPERFSKENEGEL------NPYAYMPFGLGPRNCVGMRFAVLMMKMIIVRLLQRYSVETCKYTLIPMQF 495          
BLAST of cytochrome P450 3A29 vs. Planmine SMEST
Match: SMESG000060689.1 (SMESG000060689.1)

HSP 1 Score: 1070.84 bits (2768), Expect = 0.000e+0
Identity = 558/559 (99.82%), Postives = 559/559 (100.00%), Query Frame = 1
Query:   49 MLIFVSXXXXXXXXXXXXXXXXXXXXXKYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 1725
            MLIFVSLLLTFLSLFYFYRRRRFASFAKYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTN+NHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESQTDEEKTDEEITEQTSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS
Sbjct:    1 MLIFVSLLLTFLSLFYFYRRRRFASFAKYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNINHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESQTDEEKTDEEITEQTSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRNS 559          
BLAST of cytochrome P450 3A29 vs. Planmine SMEST
Match: SMESG000060680.1 (SMESG000060680.1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 330/557 (59.25%), Postives = 426/557 (76.48%), Query Frame = 1
Query:   49 MLIFVSXXXXXXXXXXXXXXXXXXXXXKYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 1719
            M IF+SL++   +LFY YRRR+ + F++YNI GPPPNF+FGNLIEYR+  FYEL  KW++++GKVFVYFEGPTPNVVIGDPDLLQ+V+VKQFSNFHGRKLFP QKNPDEDEK SMF ARGKRWKRLR+TINPAFSD+KMRRM P++++SI   + KL+E   K  + I I + +QRLTMDIICKC FG++T+CQ NVN PFIVSLK FL   N S+LK A++LT  EIK + +Y++E FN    Q++  +KIRSTL+Q+I AR+K SEKRFDLLQ+L+D+EV   K++DE            N  ES    +  DE+  +      K  SK LTTEEVI  A LF+FAGY+TSS A+S+ILHSL+V  D Q+KL  EI  + +++E+K++ S E YD++ +LPYLNA+IYETLRFYPF ST+++RMCLKSEGTHLSNG YIP+ T +I NV ++H+DKD+W   DPH F PERFLQ NG E EF+ P NP  WLPFG GPRNCIG+R A+M+I+ TL   +++F+++ ++ TENPL+LK+G TI P NGVN+ +++R
Sbjct:    1 MFIFISLVVFLFTLFYVYRRRKISLFSQYNIRGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSINVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDE------------NAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFKELEEKNLNSLEFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 545          
BLAST of cytochrome P450 3A29 vs. Planmine SMEST
Match: SMESG000013752.1 (SMESG000013752.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.085e-59
Identity = 150/529 (28.36%), Postives = 263/529 (49.72%), Query Frame = 1
Query:  145 GPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYI---PQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            GPPP   FGN  +   +  YEL I  + ++GK++ ++ G  P  ++ D +LL+++++K    F  R    +  N    +K+ + L +GK W+R+R  ++P F+  K+R+M P++ + I     +L   G  + D I++++    LTMD+I +  FG+  D QTN N+PFI++ KK  K  +L      ++L   EI P+       +     Q +      S L + ++ R+K  E+  D L  ++ A     ++ D D            Q E                       S+ LT  E+IAQ+ LFL AGYET++T+L+++ + L+  P+ Q ++++EI ++    E+ S      Y+ +  LP+L A I E+LR  P AS V  R+C +      S+   I       F +P ++AIH D +IW   +P+ F   RF   +            ++++PFG GPRNC+G RFA++ ++  L   + +F++    +T + +K K  A   P+  + + + KR+
Sbjct:   38 GPPPLPFFGNFFDIIRHGLYELDIINRDKYGKIYPFYFGGIPISIVSDEELLKQILIKDAKCFTDR--LDIGSNGKIGQKMLIIL-KGKSWERVRNLVSPTFTSGKLRKMSPLMKDCIDLLDKRL--AGIPENDPIDVKDVFGALTMDMIARTMFGMHIDSQTNPNNPFIINAKKLFK-FSLFNPMLILILFFPEITPIFRKFFPNWEFLGRQTMNFF--VSNLNKAMDERKKSPEQYNDFLTEMMKAH---KEVNDSDP----------EQLEIL--------------------DSRSLTNSEIIAQSFLFLLAGYETTATSLTYVAYFLAKNPEAQQEVYREIIKVFGTDEEIS------YEKISNLPFLEAAINESLRICPPASRV-DRVCTEDVVLVTSDNKQINAKKGDVFTVP-IYAIHMDPEIWP--EPYKFDLSRFDNESKKTRSI------YSFMPFGMGPRNCVGMRFAVLEMKMALVNLLKQFELVPCAETLDVIKFKKTAFGGPVKPIILKIVKRS 509          
BLAST of cytochrome P450 3A29 vs. Planmine SMEST
Match: SMESG000013783.1 (SMESG000013783.1)

HSP 1 Score: 204.527 bits (519), Expect = 3.117e-58
Identity = 147/534 (27.53%), Postives = 263/534 (49.25%), Query Frame = 1
Query:  145 GPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKL-NERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGS-RELY-DALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYI--PQGTFVIPNVFAIHYDKDIW---TSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            GPPP    GNL++ +   F+      ++++GK++  + G +P  V+GD +LL+++M+K+F  F  R     +    +     + + +GK W+R+R  I P F+  K+R+M P++ + I     ++ N   D     I+I+E+   LTMD+I +  FG+  D QTN N+ F+++ K+       S   + V++ L   K  +++                  R  L +     ++  +   D +QM ID     T           ND  +L +A  +  E  +         S++   SK L+ +E++AQ+ +FL AGYET++T L+F+ + L+  PD Q  L+ EI         + +GS RE+  D L  +P L+A++ E+LR  P A  V  R+C +      S+   +   +G  +   ++A+H D  IW      D H F P+R  ++NG           ++++PFG GPRNC+G RFA++ ++  +   +  F++   ++T   L  K+   +SPI+ + + + KR 
Sbjct:   42 GPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFR---SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTP---IDIKEFFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLF---TFSLFNSFVIIFLMFPKLGILF------------------RKILPKWEFFGKESFQFFIDNMQMAIDERAKSTD--------KYNDFLALMKAHKKETENDS--------ESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIM--------ECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRV-DRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDR-KKTNGQ----------YSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISGLLSPISPILLKIVKRG 512          
BLAST of cytochrome P450 3A29 vs. Planmine SMEST
Match: SMESG000013783.1 (SMESG000013783.1)

HSP 1 Score: 202.601 bits (514), Expect = 2.554e-57
Identity = 148/551 (26.86%), Postives = 264/551 (47.91%), Query Frame = 1
Query:  145 GPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKL-NERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESXXXXXXXXXXXXXXXSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGS-RELY-DALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYI--PQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPP--------------------NPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKRN 1722
            GPPP    GNL++ +   F+      ++++GK++  + G +P  V+GD +LL+++M+K+F  F  R     +    +     + + +GK W+R+R  I P F+  K+R+M P++ + I     ++ N   D     I+I+E+   LTMD+I +  FG+  D QTN N+ F+++ K+       S   + V++ L   K  +++                  R  L +     ++  +   D +QM ID     T           ND  +L +A  +  E  +         S++   SK L+ +E++AQ+ +FL AGYET++T L+F+ + L+  PD Q  L+ EI         + +GS RE+  D L  +P L+A++ E+LR  P A  V  R+C +      S+   +   +G  +   ++A+H D  IW         PE+F     ++  FIGPP                      ++++PFG GPRNC+G RFA++ ++  +   +  F++   ++T   L  K+   +SPI+ + + + KR 
Sbjct:   42 GPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRS---KRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTP---IDIKEFFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLF---TFSLFNSFVIIFLMFPKLGILF------------------RKILPKWEFFGKESFQFFIDNMQMAIDERAKSTD--------KYNDFLALMKAHKKETENDS--------ESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIM--------ECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRV-DRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPD-------PEKFDYHRLSDHLFIGPPISILEFDYILRFDPDRKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISGLLSPISPILLKIVKRG 533          
The following BLAST results are available for this feature:
BLAST of cytochrome P450 3A29 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP3A46.752e-7229.40cytochrome P450 family 3 subfamily A member 4 [Sou... [more]
CYP3A54.931e-7129.59cytochrome P450 family 3 subfamily A member 5 [Sou... [more]
CYP3A78.214e-6928.65cytochrome P450 family 3 subfamily A member 7 [Sou... [more]
CYP3A42.800e-6728.80cytochrome P450 family 3 subfamily A member 4 [Sou... [more]
CYP3A73.113e-6729.09cytochrome P450 family 3 subfamily A member 7 [Sou... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-13A23.930e-6831.54Putative cytochrome P450 CYP13A2 [Source:UniProtK... [more]
cyp-13A37.394e-6731.31Putative cytochrome P450 CYP13A3 [Source:UniProtK... [more]
cyp-13A72.445e-6431.97Putative cytochrome P450 CYP13A7 [Source:UniProtK... [more]
cyp-13A43.824e-6428.55Putative cytochrome P450 CYP13A4 [Source:UniProtK... [more]
cyp-13A122.510e-6330.06CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp6a21.722e-5228.31gene:FBgn0000473 transcript:FBtr0086133[more]
Cyp6a236.150e-5026.53gene:FBgn0033978 transcript:FBtr0087452[more]
Cyp6a81.807e-4928.82gene:FBgn0013772 transcript:FBtr0087455[more]
Cyp6a171.594e-4827.86gene:FBgn0015714 transcript:FBtr0345527[more]
Cyp6a171.594e-4827.86gene:FBgn0015714 transcript:FBtr0087451[more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbxas13.760e-6930.66thromboxane A synthase 1 (platelet) [Source:ZFIN;A... [more]
cyp3a653.113e-6428.62cytochrome P450, family 3, subfamily A, polypeptid... [more]
cyp3c32.224e-6228.32cytochrome P450, family 3, subfamily c, polypeptid... [more]
cyp3c43.533e-5728.16cytochrome P450, family 3, subfamily C, polypeptid... [more]
cyp3c34.162e-5728.27cytochrome P450, family 3, subfamily c, polypeptid... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000012846.12.798e-6929.71cytochrome P450 3A8-like [Source:NCBI gene;Acc:100... [more]
cyp3a54.142e-6729.56cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
cyp3a51.448e-6629.89cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
cyp3a52.272e-6429.92cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
cyp3a51.407e-6328.79cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp3a131.102e-7330.58cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a116.149e-6930.40cytochrome P450, family 3, subfamily a, polypeptid... [more]
Tbxas11.260e-6629.78thromboxane A synthase 1, platelet [Source:MGI Sym... [more]
Cyp3a41a6.058e-6529.45cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a41b6.058e-6529.45cytochrome P450, family 3, subfamily a, polypeptid... [more]
back to top
BLAST of cytochrome P450 3A29 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24463|CP3AC_CANLF1.160e-7430.78Cytochrome P450 3A12 OS=Canis lupus familiaris OX=... [more]
sp|P11707|CP3A6_RABIT7.184e-7430.35Cytochrome P450 3A6 OS=Oryctolagus cuniculus OX=99... [more]
sp|O18993|CP3AL_CALJA9.124e-7430.64Cytochrome P450 3A21 OS=Callithrix jacchus OX=9483... [more]
sp|P51538|CP3A9_RAT2.914e-7331.09Cytochrome P450 3A9 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q64464|CP3AD_MOUSE7.707e-7330.58Cytochrome P450 3A13 OS=Mus musculus OX=10090 GN=C... [more]
back to top
BLAST of cytochrome P450 3A29 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JCI62.816e-10335.38cytochrome P450 3A29 OS=Lingula unguis OX=7574 GN=... [more]
K1PQG26.367e-10335.36Putative cytochrome P450 CYP13A5 (Fragment) OS=Cra... [more]
A0A210QVL07.273e-10135.98Cytochrome P450 3A24 OS=Mizuhopecten yessoensis OX... [more]
A0A2C9K0E78.172e-9935.41Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K0E01.413e-9835.41Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056570.18.948e-7229.21cytochrome P450 3A56-like [Source:NCBI gene;Acc:10... [more]
cyp3a651.642e-6629.43cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000012911.26.966e-6628.87cytochrome P450 3A56-like [Source:NCBI gene;Acc:10... [more]
tbxas12.072e-5828.06thromboxane A synthase 1 (platelet) [Source:ZFIN;A... [more]
ENSAMXT00000055169.11.430e-5528.02cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010515.13.090e-5227.83pep scaffold:Pmarinus_7.0:GL494623:61763:74387:-1 ... [more]
ENSPMAT00000004192.14.906e-4927.76pep scaffold:Pmarinus_7.0:GL501190:14217:30704:1 g... [more]
ENSPMAT00000010493.14.805e-4825.91pep scaffold:Pmarinus_7.0:GL494623:34025:53335:-1 ... [more]
cyp4t82.661e-3523.79cytochrome P450, family 4, subfamily T, polypeptid... [more]
ENSPMAT00000000063.16.891e-3227.85pep scaffold:Pmarinus_7.0:GL478178:2662:7225:1 gen... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ERG53.649e-1626.84C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
DIT24.111e-1428.77N-formyltyrosine oxidase; sporulation-specific mic... [more]
ERG111.582e-1230.20Lanosterol 14-alpha-demethylase; catalyzes C-14 de... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360232.629e-6729.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464493.411e-6728.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302631.581e-6630.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335589.541e-6531.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335593.350e-6430.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbxas19.501e-7130.67thromboxane A synthase 1 [Source:NCBI gene;Acc:101... [more]
cyp3a6.440e-6328.15cytochrome P450, family 3, subfamily A [Source:NCB... [more]
cyp3a407.788e-6327.83cytochrome P450 3A40 [Source:NCBI gene;Acc:1001258... [more]
cyp3a401.069e-6228.20cytochrome P450 3A40 [Source:NCBI gene;Acc:1001258... [more]
ENSORLT00000004982.22.704e-6229.82cytochrome P450 3A30 [Source:NCBI gene;Acc:1011578... [more]
back to top
BLAST of cytochrome P450 3A29 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060689.10.000e+099.82SMESG000060689.1[more]
SMESG000060680.10.000e+059.25SMESG000060680.1[more]
SMESG000013752.11.085e-5928.36SMESG000013752.1[more]
SMESG000013783.13.117e-5827.53SMESG000013783.1[more]
SMESG000013783.12.554e-5726.86SMESG000013783.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019040 ID=SMED30019040|Name=cytochrome P450 3A29|organism=Schmidtea mediterranea sexual|type=transcript|length=1909bp
GTCATTTTCAAGTTATTTTAAAATAAGATTTCAGTTTATCAAATAATAAT
GTTGATTTTTGTTTCTTTGTTATTAACATTTTTATCTCTCTTTTACTTTT
ATCGTCGAAGGAGGTTTGCTTCGTTTGCCAAATACAACATCCCTGGTCCG
CCGCCGAATTTTCTTTTCGGTAATTTGATCGAGTATCGAAATAATACGTT
TTACGAATTATTGATTAAATGGCAAAAGGAGTTTGGGAAAGTTTTTGTCT
ACTTCGAAGGACCGACTCCGAATGTTGTTATTGGTGATCCTGATCTTTTG
CAAGAGGTAATGGTAAAACAATTCAGTAATTTTCATGGAAGAAAACTGTT
TCCAATGCAAAAGAATCCAGACGAAGACGAAAAAGTCAGCATGTTTCTTG
CTCGCGGTAAACGATGGAAACGCTTAAGAACTACAATCAACCCTGCATTC
TCAGACGCTAAAATGCGCAGGATGTTTCCAATGGTTGACGAATCAATCGC
TTCATTCGTTAACAAATTGAATGAGCGTGGTGATAAAAAATTCGATTGTA
TAAATATTCAGGAGTATTTGCAGAGACTGACAATGGATATAATCTGTAAA
TGTGCCTTTGGTGTCGACACTGACTGTCAGACTAATGTCAACCATCCTTT
CATCGTTTCATTGAAAAAGTTTCTCAAGGAAATGAATCTTTCAACATTGA
AAGCCGCGGTTGTTTTAACGCTTGCTGAAATAAAGCCGGTCCTTGTTTAT
TTATTAGAAGCGTTTAATCAGAGACCCGGTCAAAGGGTAGAGCTTATGAA
AATTAGGTCAACATTGGTCCAGGTGATTGAGGCTCGTAGAAAATGTTCCG
AGAAAAGATTTGATTTACTGCAAATGTTAATTGATGCTGAAGTACCTGGC
ACAAAAATACTTGACGAAGATAATCTCTGCCCCATGAATGATAATACTTC
GCTGAATCAAGCAGAAAGTCAAACCGACGAAGAAAAGACTGATGAAGAAA
TTACCGAACAAACCAGTTCAAATCAGAAAAAGACATCGAAACCACTTACA
ACAGAAGAAGTAATTGCTCAAGCAAATTTATTTTTATTCGCCGGCTATGA
AACAAGCTCTACAGCCTTGTCCTTTATTCTCCATTCTCTTTCTGTATATC
CGGACGTTCAAGACAAATTGTTTCAAGAAATATCCCGGTTGCATGAGAAA
ATTGAAGATAAAAGCATTGGATCCAGAGAGTTATATGACGCCCTTGGTCG
GCTACCTTATTTGAATGCTTTAATTTATGAAACACTTCGATTCTATCCTT
TCGCTTCGACAGTGATTCACAGAATGTGCCTCAAATCCGAAGGAACTCAT
TTATCAAATGGCTTATACATCCCACAAGGTACCTTTGTTATCCCGAATGT
GTTTGCTATACACTATGACAAGGATATATGGACATCTGTTGATCCTCATA
CATTTTCACCAGAAAGGTTTTTACAAAGCAATGGAACTGAATTGGAATTT
ATCGGACCCCCCAATCCATTTGCCTGGCTCCCATTTGGAGCCGGTCCAAG
AAACTGTATTGGACAAAGGTTTGCAATGATGGTCATCAGAGCAACTTTAT
GCCAATTTGTCTATCGGTTCCAAGTTAGTAGTACAGAGAAAACTGAAAAT
CCTTTGAAACTTAAAGTTGGAGCAACAATTTCACCTATTAATGGAGTGAA
TATTGTACTTAAAAAAAGAAATTCCTGATTTCGTCCAAGGAGCCAGGCCG
ATTTAACCGTAGAGAAATAACTTTTTCGAACATGTCTGACTTAATTTTTT
TGTTATAAATAATTTGGTAGTTTCTTTTTCAATTTTGAAGGATATTATTC
ATTTGTATTTATTTAATTGGTCGATTTAATAAAAGCTTGATTGGTTGATT
CAAAAAAAA
back to top

protein sequence of SMED30019040-orf-1

>SMED30019040-orf-1 ID=SMED30019040-orf-1|Name=SMED30019040-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=560bp
MLIFVSLLLTFLSLFYFYRRRRFASFAKYNIPGPPPNFLFGNLIEYRNNT
FYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKL
FPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESI
ASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNVNHP
FIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELM
KIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNT
SLNQAESQTDEEKTDEEITEQTSSNQKKTSKPLTTEEVIAQANLFLFAGY
ETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALG
RLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPN
VFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGP
RNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGV
NIVLKKRNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
GO:0070330aromatase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 83..104
score: 24.29
coord: 337..354
score: 27.43
coord: 357..383
score: 28.57
coord: 59..78
score: 33.43
coord: 452..476
score: 29.24
coord: 503..526
score: 22.59
coord: 493..503
score: 54.09
IPR001128Cytochrome P450PRINTSPR00385P450coord: 348..365
score: 39.01
coord: 494..503
score: 64.4
coord: 407..418
score: 44.22
coord: 503..514
score: 36.79
IPR001128Cytochrome P450PFAMPF00067p450coord: 32..539
e-value: 5.9E-93
score: 312.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 302..331
NoneNo IPR availablePANTHERPTHR24302:SF15coord: 7..547
NoneNo IPR availablePANTHERPTHR24302FAMILY NOT NAMEDcoord: 7..547
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 496..505
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 31..557