Metalloendopeptidase

Overview
NameMetalloendopeptidase
Smed IDSMED30019039
Length (bp)3655
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metalloendopeptidase (SMED30019039) t-SNE clustered cells

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30019039) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metalloendopeptidase (SMED30019039) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30019039) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019039

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30019039SMESG000005882.1 dd_Smed_v4_5652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019039SMESG000005882.1 dd_Smed_v4_5652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30019039SMESG000005882.1 dd_Smed_v4_5652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019039SMESG000005882.1 Contig38932newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019039SMESG000005882.1 Contig38932uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30019039SMESG000005882.1 H.14.4asmed_ncbi_20200123PMID:17942485
Reddien et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30019039SMESG000005882.1 dd_Smed_v4_5652_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019039SMESG000005882.1 dd_Smed_v4_5652_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 452/998 (45.29%), Postives = 625/998 (62.63%), Query Frame = 3
Query:  492 DELELKENFRFLDPCKANAFMGDIALTDDEKMRM--LERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            +E +  E   + DPCKA  F GDIAL DDE + +  ++R I L++    +    +    +H   K R         +L++  + ++   +      T+K K             P+Q       + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++FI +RS ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E + N SSP   N   +     C WR+SVT GE++ LN +   + +S  C  +Y+E+RDG +  S L+GR+C       + S  SR+WI +++ +     GF A Y+A+CGGEI  +EG+I SPNYP+ Y+P K+C+WKITV   Y + L F+SF+IE+HD C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K  + GC   C+NTLG+Y CAC+ GYEL  D ++CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ ++ G  +  K  GK+CG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H CVNT+GSY C CR G+ LH  K +CKE     C  +I    G I SPN+P  YPS+  C W+I  TPGH I+L FS+FEIE HQEC YD L V+DG + K+  LGR CG+K P P+ +  N + + F SD SVQR+GF+ T ++ C G+L A  +P+ ++SHA +G   Y    +C WLL +  +   ++L F  FEVE E  C YD V+++DG    A  +G++CG+  P  I S   ++LIHF +DDT++ KGF   Y ++  P
Sbjct:   40 NEEDKTETIDYKDPCKAAVFWGDIAL-DDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKR--------GALYQLIDRIRRIGFGLEQNNTVKGK------------VPLQ-FSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFI-ERSDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPN--GYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAE---CEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVS-ERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYP 1006          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL2 (tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 434/985 (44.06%), Postives = 616/985 (62.54%), Query Frame = 3
Query:  522 FLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYK--TLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + DPCKA  F GDIAL D++ +++   D        + W  ++  ++ H +  +  +     P++   +     TKE      +  TL   P  +    +  FSP           R RRA TS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++FI +R+ ++S+I+F+ +TCGCCSYVGRR    PQAISIGKNCDK GIV HELGHV+GFWHEHTRPDRD HV I+ EN+  GQ++NF KME+ EV SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQR+ LS GDI Q  KLY CP CG+TL + + NFS+P   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C      P++S  SR+W+ +++ +     GF A+Y+A CGG+++   G+I SPNYP+ Y+P+K+C+W+ITV  G+ + L F++F+IE+HD+C YD+LE+RDG  E+  L+   CGY+ P  +K+++N++++KF+SD S+ K GF A F +E DEC    H GC H CVNTLG+Y CACD GYEL AD K CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ V  G   + K  G++CG + P+ ITS +N + + F SD+TV K+GF+ +F++D++EC   NG C+H CVNT GSY C CR GY LH    +CKE    GC ++I+   G + SPN+P  YPS+  C W I +T GH ++LTF++FEIE HQEC YD L +YDG       LGRFCGSK P P  +  +S+ + F SD SVQR+GF+   ++ C G+L A  + + ++SHA +G   Y     C W++        V+L F  FEVE E  C YD ++ YDG    AP +G++CG+     I S   +L+I F +DDT++ KGF A Y + 
Sbjct:   52 YHDPCKAAVFWGDIAL-DEDDLKLFHID------KARDWTKQTVGATGHSTGGLEEQASESSPDTTAMD---TGTKEAGKDGRENTTLLHSPGTLHAAAKT-FSP-----------RVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFI-ERTDEESFIVFSYRTCGCCSYVGRRGGG-PQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPN--GYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDFVEVRSGLSPDAKLHGRFCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEA---GCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVI-VAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTST 1005          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 452/1021 (44.27%), Postives = 625/1021 (61.21%), Query Frame = 3
Query:  492 DELELKENFRFLDPCKANAFMGDIALTDDEKMRM--LERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFK-----------------------IEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            +E +  E   + DPCKA  F GDIAL DDE + +  ++R I L++    +    +    +H   K R         +L++  + ++   +      T+K K             P+Q       + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++FI +RS ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E + N SSP   N   +     C WR+SVT GE++ LN +   + +S  C  +Y+E+RDG +  S L+GR+C       + S  SR+WI +++ +     GF A Y+A+CGGEI  +EG+I SPNYP+ Y+P K+C+WKITV   Y + L F+SF+                       IE+HD C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K  + GC   C+NTLG+Y CAC+ GYEL  D ++CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ ++ G  +  K  GK+CG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H CVNT+GSY C CR G+ LH  K +CKE     C  +I    G I SPN+P  YPS+  C W+I  TPGH I+L FS+FEIE HQEC YD L V+DG + K+  LGR CG+K P P+ +  N + + F SD SVQR+GF+ T ++ C G+L A  +P+ ++SHA +G   Y    +C WLL +  +   ++L F  FEVE E  C YD V+++DG    A  +G++CG+  P  I S   ++LIHF +DDT++ KGF   Y ++  P
Sbjct:   40 NEEDKTETIDYKDPCKAAVFWGDIAL-DDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRG--------ALYQLIDRIRRIGFGLEQNNTVKGK------------VPLQ-FSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFI-ERSDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPN--GYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAE---CEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVS-ERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYP 1029          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 409/865 (47.28%), Postives = 565/865 (65.32%), Query Frame = 3
Query:  876 AATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            AATS   R W  G+IP+ I  NF+   +A   +AMRHWE +TC++F+ +R+ + SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI PK      +PPIGQR  LS GDI Q  KLY CP CG+TL + + NFSSPE  N   +S  + C WRISVT GE++ LN +   +  S  C  +Y+E+RDG +  + L GR+C      PI+S  SR+W+ +++ +     GF A Y+A+CGG++    G I SPNYP+ Y+P+K CIW+I V  G+ + L F+SF+IE+HD+C YD+LE+RDGH E   L+ + CGY+ P  IK+T++++++KF+SD S+ K GF   F +E DEC +  + GC   C+NTLG+Y C+CD GYEL  D + CE ACGG + + NGS+ SP +P  YPPNK CIW+++A  + +I   F  F+ EG +  C+YD++ V  G   + K  GK+CG + P+ ITS  N + + F SD+TV KKGFK +F++D++EC   NG C+  CVNT GSY C CR G+ LH  K +CKE    GC +++T   G I SPN+P  YPSK  C W I +TPGH ++LTF + +IES  EC YD L V+DG   K   LGRFCGSK P P+ +  + + + F SD SVQR+GF+ +  + C G++ A  + + ++SHA +G   Y    +C W++    +   V+L F  FEVE E  C YD ++++DG    AP +G+YCG+  P  + S   ++L+ F SDDT++ KGF   Y + 
Sbjct:  121 AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFL-ERTDEDSYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPN--GYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDV-CKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEA---GCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVI-VAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTST 976          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 291/589 (49.41%), Postives = 399/589 (67.74%), Query Frame = 3
Query:  876 AATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDR 2633
            AATS   R W  G+IP+ I  NF+   +A   +AMRHWE +TC++F+ +R+ + SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI PK      +PPIGQR  LS GDI Q  KLY CP CG+TL + + NFSSPE  N   +S  + C WRISVT GE++ LN +   +  S  C  +Y+E+RDG +  + L GR+C      PI+S  SR+W+ +++ +     GF A Y+A+CGG++    G I SPNYP+ Y+P+K CIW+I V  G+ + L F+SF+IE+HD+C YD+LE+RDGH E   L+ + CGY+ P  IK+T++++++KF+SD S+ K GF   F +E DEC +  + GC   C+NTLG+Y C+CD GYEL  D + CE ACGG + + NGS+ SP +P  YPPNK CIW+++A  + +I   F  F+ EG +  C+YD++ V  G   + K  GK+CG + P+ ITS  N + + F SD+TV KKGFK +F++++
Sbjct:  121 AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFL-ERTDEDSYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPN--GYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDV-CKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSEK 704          

HSP 2 Score: 255.758 bits (652), Expect = 1.601e-71
Identity = 147/429 (34.27%), Postives = 222/429 (51.75%), Query Frame = 3
Query: 1821 VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKN-GECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
             CG  +  S G   SP YP  Y  +  C+W+I+V  G  I L F S  + +   C YD++E+RDG   +  L  + CG ++P PI +T+++++++F S S+   +GF A +                                          E  CGG +K+  G + SPNYP +Y P+K CIWRI  S+   +   F  F++E +   C YDY+ V DG   +   +G+YCG + P  I ST++ L + F SD ++ K GF +NF+ + +EC   N G CE  C+NT+GSY C C PGY+L   K+ C+      C   +T  +G I SP +P  YP   NC W+++    + I L F  FE E +  C YD + V  G +  +K  G+FCGS+ P  + SQ+N++ + F SD +V ++GFK  F S
Sbjct:  321 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVY------------------------------------------EAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIE-RHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEA----ACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFS 702          

HSP 3 Score: 191.045 bits (484), Expect = 9.026e-50
Identity = 135/447 (30.20%), Postives = 201/447 (44.97%), Query Frame = 3
Query: 2286 ACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICD------------------GKLIATEEPQFIFS------HAAYG-----------TP-----YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTYRFQY 3506
            ACG  +++S G+  SP YP+ Y  +  C+WRI  +   KI  NFT  D+  + + C YDY+ V DG        G++CG K P+PI ST + L + F S S    KGF                    F V             Y+              C  ++   +G I+SPNYP  Y     C W+I  + G  + LTF  FEIE H  C YD L V DG S  +  +GR+CG + P  +KS  + + + F SDGS+ + GF + F    D                  G    + +P +  +       AA G           +P     Y  N+NC+W L     Q  + L+F  FE E  + C YD V++  G +  + + G++CG+  P +ITSQ  N+ + F SD+TVS KGFKA + +  +P       + ++ ++
Sbjct:  321 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLY-RSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGF--------------------FAV-------------YEAI------------CGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQL-VAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSEKRPALQPPRGRPHQLKF 720          

HSP 4 Score: 153.68 bits (387), Expect = 1.288e-37
Identity = 89/284 (31.34%), Postives = 128/284 (45.07%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY-------------------------------------------QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSH 2201
            CG  + +   +  SP   +++  S    C WRI V+EG  V L    F I     C  +YLE+RDG  E+S LIGRYC       I S  SR+W+++ +       GF  ++                                           +A CGG +    G I SP +P+ Y PNK CIW++  P  Y I+L+F+ F+ E +D C YDF+E+R G     +L  K CG + P  I +  N M ++F SD++V K+GF A+F  E         G  H
Sbjct:  435 CGGDVKKDYGHIQSPNYPDDYRPSKV--CIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSEKRPALQPPRGRPH 716          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-39 (Zinc metalloproteinase nas-39 [Source:UniProtKB/Swiss-Prot;Acc:Q20176])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 392/921 (42.56%), Postives = 539/921 (58.52%), Query Frame = 3
Query:  810 TEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCP-RPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNI---------------------SEFHIPESLDCTINYLEIRDGV--YENS----DLIGRYCARAAI-SPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDG-----HDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQL-HGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDG-SSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            T +R   ++  + + N  R  RAAT+ K R W  GIIP+ I +NFS E +   ++AMRHWEN+TC+SF+P++   K YI FT   CGCCSYVGRR E  PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD +VDI  +++  GQD+NF+K +  EVDSL E YD+ SIMHYA+ TFS+     TI PK     R  IGQR+ LS GDIRQT KLY C +CG TL++ S N +            A  C W I   +G  + LNI                     +E   P  L     YL  +  +  Y NS    +++ R C   ++   I S G+R+ I+ ++  P+ +  F A+Y A+CGG I+A+EG I SP YPE Y PN  C W I V     +A++F  F +E+H  C+YD L + +G       + K +    CG      I +  NQ+ ++F SD+SV+K GF   F +E +EC   K+ C H CVNT+G + CAC +GY L ++G +C++ CGG +K SNGS+ SPN+P  YP +K CIW I A     IF NFT+F+VEG + +C YDY+ + D    ++K  G+Y         T+  N + I F SDS+V++ GF  NF  D +EC++ N  CEH C N +GSY C C PGY L   K NCKE +   C +E+    G+I SPNYP  YP   NC W  +TTPGH + LTFS F++E H +C YD + VYDG     +  G FCG   P  + S  N + +TF+SD SV RRGF+  + S+C G+L A   P  I+SHA +  + Y  NQ+C W++   +    V+++F  F +E E  C YD ++IYDG  + +  ++G++CG + P +ITS    LL+   +D+    KGF AEY   P+
Sbjct:   26 TFIRSGDVRFRRYYRNNGRVSRAATAKKERIWPEGIIPFVIASNFSGEHQHLFLRAMRHWENFTCVSFVPRQPHHKHYITFTVDKCGCCSYVGRRGEG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDMYVDIFYKSIQTGQDYNFEKSKPEEVDSLGEPYDFSSIMHYARDTFSRGAFYDTILPKPNSGFRLEIGQRVQLSEGDIRQTKKLYKCAECGGTLMQESGNLA---------IQHAGVCTWHIISPQGHTIFLNITGGLKLIIMIIFLTDEKLEDLTEIFKPNILKKNQTYLHWKTFLIYYTNSFFHFEILDRICGGDSLFRTIASSGNRMLIQVRSSTPAASLPF-ATYYAICGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEFVYFHLEQHKECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKTIVSKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDYVKIGD----SEKLCGEY---HEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGS---CFFEVNAPAGDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVEEHAQCKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSSNELYLTFSSDASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPELLLIMHTDNAEEEKGFVAEYREAPR 925          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-4 (Zinc metalloproteinase nas-4 [Source:UniProtKB/Swiss-Prot;Acc:P55112])

HSP 1 Score: 143.28 bits (360), Expect = 3.476e-37
Identity = 71/201 (35.32%), Postives = 112/201 (55.72%), Query Frame = 3
Query:  873 RAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCP 1475
            R A    +R W +  IPY + + + S  ++ I  AM  +   TC+ F+ +  S     ++     GC S VG+    +P  +S+   C + G ++HEL H +GF+HE +R DRD ++D++ +NV+ G D  F+K   + +  L+E YDY SIMHY    FS + K+  +  K+   R  +GQR+  S  D+R+ NKLYNCP
Sbjct:   94 RNAIKQIYRRWPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDEGCYSLVGKTGGKQP--VSLDSGCIQVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVPKKSGSER--MGQRVKFSDIDVRKINKLYNCP 290          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: ZC116.3 (Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc:Q20911])

HSP 1 Score: 153.68 bits (387), Expect = 4.265e-37
Identity = 162/728 (22.25%), Postives = 283/728 (38.87%), Query Frame = 3
Query: 1446 RQTNKLYNCPKCGKTLLE-YSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARA----------AISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV-----CGGEIHASEGRIISPNYPEF-YKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGH----------------DEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKN-CKEKTVDGCTYEITDAHG---EIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASI-KNKQLGRFCGSKTPVP---MKSQHNSILITFTSDGSVQRRGFKITFNSI------CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLE-TINQQLTVQLKFLHFEV-------EPENQCTYDSVKIYDGSSVMAPMI-GQYC--GTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            +Q N      KCG  +    + + +SP   +   +     C+W +   EG+ V + I E  I    +C  ++L I +G   + + I +YC +               I S G  + + +         G+   Y+ +     CG       G I +P + +  Y+ + +C+W I VP+GY I LKF+ F +E  + C  D L I   H                DE+K   + +CG + P   ++ +N++ + F +DS    +GF   ++ E      + HG                 I      +G   +  C  LI   + +                   +IA K A   F+            C+ DY+ + D      + L  +C  +P                 D+ V K    + F +D++          ++ +     Y      G+QL    N C      G   E+ +  G    + SP +P+ Y    +C W I T P   + + F + ++E+  +C+ D +  +D + I  NK LG+FCG+   +P   + +   ++LI   +D +V   GFK+   S       C GKL AT   Q + S       Y     C W +   ++ QL +++  +  E         P  +C  D++ IYDG    +P++ G  C  GT +P ++ +   +  I F +D   + +GF   Y  V
Sbjct: 2985 QQFNLTIEFQKCGGVISSPNTGDITSPNFGSGLKYLPGSKCRWVLEAPEGQIVKVKIVEMQIAYDHECENDHLIIGEGRQADVNTIHKYCHKMDGEQEQKLEDRFKIIKSHGRYLTLIWVTNMKYEEAGWKIQYEFLNENEECGYHTSGMSGTIYTPMFGDKDYENDLECVWDIQVPLGYHINLKFKDFDVETAENCAKDQLLISQEHSTRANSPNGDYYFLFQDEEKE--TPLCGIEHPKDFESESNRVRLNFTTDSQTTARGFRVNWEAECGAIYRLNHGV----------------ITSPYYPNGYPNDITCTYLIAPPDQN------------------SVIAIKFAD--FDLATMRTSFGRAPCEDDYLQIID--TGTDRVLHTFCASEP--------------MPKDALVFKGAIGLKFVSDKS----------YYWMEEDNKYGRKGSKGFQLAYSINKC------GDNIELREGTGFITTVTSPAFPLPYTKDLDCVWNITTDPNRQLNIRFEEMKLEAFHDCSADYIEFFDSSDIMANKTLGKFCGTMDKIPQYRIVTSGPNLLIHMRTDFNVNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGNYPPALLCGWTISGPVDSQLQIRIDGVDTEQLEYPPGDRPSPECI-DALAIYDGQEFFSPLLAGDICTSGTPLPKILYTSHRHAFITFETDRDGTGRGFNISYSIV 3641          

HSP 2 Score: 103.219 bits (256), Expect = 1.017e-21
Identity = 128/617 (20.75%), Postives = 231/617 (37.44%), Query Frame = 3
Query: 1545 FSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDL-----IGRYCARAAISP---IISKGSRIWIRYKNQAPSRNTGF-VASYQAV-----CGGEIHASEG--RIISP-----NYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHD---------TCVYDFLEIRDGHDEQKRLLS-KIC--GYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYD------------GPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEI---TDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIES----HQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGK-----LIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQ 3224
            ++  LDC W I+     ++++   E  +    DC+ +Y+E     +++SD+     +G++C      P   I++ G  + I  +      + GF +A   ++     CGG++ A+     + SP     NYP    P   C W I+ P+   + ++ +    E+ +          C+ D L I DG +    LL+  IC  G  +P  + T++   +I F +D     +GF   +     +C               G ++ A +    L   G T ++      KE N              +++C + I   K   +  NF +F++  K  DC   ++ + D              E NQ+K+ K CG   P    S TN + I   +D    K                                    RP  +       +   +D C   I   T   G + SPNYP  Y   S C   + ++   ++ L F+DF +E     ++ C YD L++ +G S        +CGS  P  + +    +     SD S+   G+  ++ ++   +        + E + + S   Y   YN +   ++ L   N  
Sbjct: 3412 YTKDLDCVWNITTDPNRQLNIRFEEMKLEAFHDCSADYIEF----FDSSDIMANKTLGKFCGTMDKIPQYRIVTSGPNLLIHMRTDFNVNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGNYP----PALLCGWTISGPVDSQLQIRIDGVDTEQLEYPPGDRPSPECI-DALAIYDGQEFFSPLLAGDICTSGTPLPKILYTSHRHAFITFETDRDGTGRGFNISYSIVDSDC---------------GGWLKATNEIKTLVYKGITSDDN-----KEMN----------KERSHQRCRFMIQGPKTEPVIVNFQQFNIPSKAGDCSDSFVEIRDVGSLQECKHPACAREPNQRKITKLCGTHVPTSHVSNTNTIQIIVSADIMPNKN---------------------------------QSRPSLKF------EYNILDSCNRTIDTNTIKSGRLTSPNYPQVYSENSTCVTNLQSSNQKML-LVFNDFTLEEPNNVNKNCDYDYLMLKEGDS----NGTYYCGSTLPKALMTSGKDLTALLKSDHSLNHAGYDASYYTVVSERDDQIQFADSYELEGVISSIGYPNGYNKSYTQIFTLRPPNSH 3945          

HSP 3 Score: 93.9745 bits (232), Expect = 6.189e-19
Identity = 115/543 (21.18%), Postives = 205/543 (37.75%), Query Frame = 3
Query: 1884 YKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKR--------LLSKICGYQIPGPIK--TTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDG-------PENNQKKLGKYCGKKPPQP---ITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFS--DFEIESHQE-C-TYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFN-SICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYC-GTSMPTLIT-SQSGNLLIHFVSDDTVSAKG 3431
            Y+ N  C W I  P+   I LKF+  ++E    C +DF+  R   D+Q           +SK C           + N  ++I F++D S    GF   ++   +  ++++ G       T   Y                            +G+ H+P+         KC + +I     K+     + D++ +   C Y+   +            +   K  KYCGK         TS    L I  Y+     +KGFK+       EC                       P   LH   N   + ++              SP +P   P+   CE+ +    GH + LTF   +F+I+ +Q+ C   D + + DG ++ ++ +G +CG++ P  + S  N + +   +    + R F  T+  + C G ++  E      +  ++  P+     C W +++ N  + ++ K  H  +     CT + + I DG+S   P+IG  C     P + T S S  + + F S+ T +  G
Sbjct: 2232 YEENLHCRWIIRRPMFTGIELKFDYLELEDVQNCAFDFVSFRLQFDDQPEENDDVDLSSVSKHCALVRSNNTFNFSVNRALHIHFVTDRSRHGIGFKLKYRLTCNSFEHIRPGIFFEHTLTSPNY----------------------------DGNFHTPSVW-------KCQYSLIIESNRKVSVEIVDLDIQ-ENSPCSYNNALILGNRFSELVETHSQYSKSSKYCGKLEQGERLNFTSARGRLFIK-YNSGPNSRKGFKMIIKEQLTEC-----------------------PSGVLHVDDNSPSRVLN--------------SPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIGIYCGNQAPSTIFSTTNFLYMKLHTSEYGKSRRFVATYGIATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHM-IEAKVDHVWLFYNPNCTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGG 2699          

HSP 4 Score: 93.9745 bits (232), Expect = 7.265e-19
Identity = 71/208 (34.13%), Postives = 104/208 (50.00%), Query Frame = 3
Query: 1581 VTEGERVSLNISE-FHIPESLDCTINYLEIRDGVYENSDLIGRY-CAR------AAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIE--KHDTCVYDFLEIRDG-HDE--QKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQ 2156
            +T G RV L +SE F+ P +++   NY+E   G  +N+    RY CAR      A +S  +S   R+ I+  +       G    Y+     CGG   +  G I SPNYPE Y+P+  C++ + V    ++ L F+ F +E     +C YD +EI    H+E     LL K CG  IP  I +T N M + F+SD SV   G+ A F+
Sbjct:  976 LTIGLRV-LPMSECFYTPNAVETYENYVEFSGGRTDNALFNRRYVCARYPFVEGAWMS--VSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTGTISSPNYPEKYQPHMHCVYNLYVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYSTTNTMAVVFVSDRSVAGPGWNAKFE 1180          

HSP 5 Score: 88.1965 bits (217), Expect = 3.368e-17
Identity = 81/315 (25.71%), Postives = 135/315 (42.86%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPER-----ENEWTFSGALDCQWRISVTEGERVSLNISE--FHIP-ESLDC-TINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQ-AVCGGEIHASEG---RIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPI--KTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIW 2375
            +C   +L   DN  SP R     E       +++C++ ++   G R+ L      F I     +C  ++Y+EIRDG   +S++IG YC   A S I S  + ++++       ++  FVA+Y  A CGG +   E     I SP++P  +    QC W +  P  + I  K +   +  +  C  + L IRDG+     L+  +C  +    +  ++ +NQ+ ++F S+S+  + G           C N K               C  D+   +  +       CGG I    G+L  P YP     + KCIW
Sbjct: 2466 ECPSGVLHVDDN--SPSRVLNSPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIGIYCGNQAPSTIFSTTNFLYMKLHTSEYGKSRRFVATYGIATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVDHVWLFYNPNCTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGG--------RQYCSNKK---------------CGFDVAVTMSGE------KCGGRITNLIGTLTPPGYPGKLLSHVKCIW 2749          

HSP 6 Score: 75.0998 bits (183), Expect = 3.345e-13
Identity = 86/382 (22.51%), Postives = 149/382 (39.01%), Query Frame = 3
Query: 2382 IASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCG-KKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFS--DFEIESHQEC--------TYDQLIVYDGASIKNKQLGR-FCGSKTPVPMK-----SQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKF--LHFEVEPENQCTYDSVKIYDG---SSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            IA   +++F     FD+      C  D++ ++DG   +   + + C  ++PP  +T       + F+SDS  Q KGF+I +              E  C                        EK V+G        +G I++ N+P    +   C + I     H+I + F      +    EC        TY+  + + G    N    R +  ++ P         S    + I   SDG+   +G  + + +   G            S   Y   Y  + +C++ L  ++   TV+L F     EV P   C YD V+IY      +V   ++G++CG  +P  I S +  + + FVSD +V+  G+ A++ AV +
Sbjct:  858 IAPGFSRVFAYRNLFDM----GTCTNDFLKIHDG---DGTLVQETCNPRRPPNVLTVNNPAAVLTFHSDSAEQGKGFRIQY--------------EMLC------------------------EKRVNG--------NGTIQTWNFP-NGGAAGTCTYIIEAPKTHVISVRFLTIGLRVLPMSECFYTPNAVETYENYVEFSGGRTDNALFNRRYVCARYPFVEGAWMSVSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTGTISSPNYPEKYQPHMHCVYNL-YVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYSTTNTMAVVFVSDRSVAGPGWNAKFEAVSR 1184          

HSP 7 Score: 72.0182 bits (175), Expect = 2.940e-12
Identity = 142/638 (22.26%), Postives = 231/638 (36.21%), Query Frame = 3
Query: 1500 YSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLI---------GRYCARAAISP---IISKGSRIWIRYKNQAPSRNTGF---VASYQAVC-GGEIHA---SEGRII-SPNYPEFYKPNKQCIWKITVPIGYSIALKFES--FKIE--KHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXK--KCIWRIIASK----KAKI-----FFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYC-GKKPPQPIT-STTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHI--IQLTFSD-----------FEIESHQECTYDQLIV-----YDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNI-NQNCLWLLETINQQLTVQLKF 3245
            +    +SP  +  +       CQ+ + +    +VS+ I +  I E+  C+ N   I    +  S+L+          +YC +          S   R++I+Y N  P+   GF   +      C  G +H    S  R++ SP +P+    + +C + +  P G+ + L F+S  F I+  + +  + D++EIRDG      ++   CG Q P  I +T N +Y+K  +                       ++G S   V T G   C                   G ++   N + H  +    YP     +C W + +      +AK+     F+N           +C  + + + DG       +G  C  +  P   T S +N++T+ F S+ST  + G        R  C +K                C       + G+K         C   IT+  G +  P YP    S   C W     PG I   ++TF             F I + Q C  D  +V     YDGA         FC ++T +   S  ++I I +  D S  R       N   D  L +T    F   + A   P N  NQ C      IN+ LT +   
Sbjct: 2347 FEHTLTSPNYDGNFHTPSVWKCQYSLIIESNRKVSVEIVDLDIQENSPCSYNNALILGNRF--SELVETHSQYSKSSKYCGKLEQGERLNFTSARGRLFIKY-NSGPNSRKGFKMIIKEQLTECPSGVLHVDDNSPSRVLNSPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIGIYCGNQAPSTIFSTTNFLYMKLHTS----------------------EYGKSRRFVATYGIATCG------------------GTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVDHVWLFYN----------PNCTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGG--------RQYCSNKK---------------CGFDVAVTMSGEK---------CGGRITNLIGTLTPPGYPGKLLSHVKCIWDFKMKPGFIYRFKITFPGANAYHKFDNQVFRI-AKQHCFPDVAVVEGFPPYDGAQYST----YFCKNETQI--TSITDTIRIVY--DDSHTREMISAIGN---DQPLNSTFYAPFTIDYMA--IPANSENQGCTL---QINKNLTTEFHL 2882          

HSP 8 Score: 71.633 bits (174), Expect = 4.406e-12
Identity = 56/228 (24.56%), Postives = 93/228 (40.79%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNISEFHIPESLD----CTI---NYLEIRDGVYENSDLIGRYCARAAIS-PIISKGSRIWIRYKNQAPSRNT---GFVASYQAVCGGEIH-ASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHD------TCVYDFLEIRDGHDEQKRL------------LSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAY 2150
            L C W ++V  G +V   ++      S D    C +   N ++  D   + +  + RYCA+   S PI S  + + I+Y      ++    GF   +  +C G +H A  G I SP YP     N+ C W I VP G  I      F I +         C+ D L++ D    +  +            ++K C   IP  I++ +N M + + S      Q + ++
Sbjct: 1328 LKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRYCAKEMASEPITSDDNELIIKYVQSGGFQSKKIFGFSGHFTTLCNGIVHEAISGSIQSPGYPYKVYSNQFCTWTIKVPKGNRIVATVHHFSISQKSYFEGGINCITDMLKVDDTDLAEAEVTFKKTDYNITNSVNKYCDKAIPRVIRSRHNSMKLTYSSQGDPTNQFWLSW 1555          

HSP 9 Score: 65.0846 bits (157), Expect = 4.528e-10
Identity = 81/345 (23.48%), Postives = 141/345 (40.87%), Query Frame = 3
Query: 1644 CTINYLEIRDGVYENSDLIGRYC-ARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYM---CACDIGYELQADG-----------KTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVE-GKEKDCQYDYINVYDGPENNQ---KKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF 2621
            CT ++L+I DG   +  L+   C  R   + +        + + + +  +  GF   Y+ +C   ++ + G I + N+P        C + I  P  + I+++F +  +                     R+L     +  P  ++T  N  Y++F S    +   F            N ++ C+       GA+M    A  +  ++ +DG           KT +  CGG+     G++ SPNYP  Y P+  C++ +  S    +   F  FD+E    K C+YD + +Y    N     + LGK+CG   P  I STTN + + F SD +V   G+   F
Sbjct:  877 CTNDFLKIHDG---DGTLVQETCNPRRPPNVLTVNNPAAVLTFHSDSAEQGKGFRIQYEMLCEKRVNGN-GTIQTWNFPNGGAAGT-CTYIIEAPKTHVISVRFLTIGL---------------------RVLPMSECFYTPNAVETYEN--YVEF-SGGRTDNALF------------NRRYVCARYPF-VEGAWMSVSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTGTISSPNYPEKYQPHMHCVYNLYVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYSTTNTMAVVFVSDRSVAGPGWNAKF 1179          

HSP 10 Score: 57.7658 bits (138), Expect = 7.022e-8
Identity = 79/380 (20.79%), Postives = 142/380 (37.37%), Query Frame = 3
Query: 1563 CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAI-------SPII-SKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESF-KIEKHDTCVY------DFLEIRDGHDEQKRLLSKICGYQIPG-PIKTTNNQMYIKFMSDSSVEKQ---GFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKES-NGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEK-----DCQYDYINVYDGPE------------NNQKKLGKYCGKKPPQPITSTTNELTIAFYS 2582
            C + I+V E +R+ + ++   +P    C  + L  R+G  E S         + I        P+I S  +R+ I YK+   S  + F  +Y+ +   CGG +    G + +P YP   K N +C W + V +G  +     +   +   D+  +      + ++  D   +  + L + C  ++   PI + +N++ IK++     + +   GF+ +F                                             C G++ E+ +GS+ SP YP     N+ C W I   K  +I      F +  K       +C  D + V D               N    + KYC K  P+ I S  N + + + S
Sbjct: 1211 CTYHIAVHENQRILIKMNNMSLP----CDKSSLMFRNGPSETSPPFSSLPPESEICTPKVNYMPVIRSFSNRVTIVYKS-INSEGSFFNLTYETITSGCGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRYCAKEMASEPITSDDNELIIKYVQSGGFQSKKIFGFSGHFT------------------------------------------TLCNGIVHEAISGSIQSPGYPYKVYSNQFCTWTIKVPKGNRIVATVHHFSISQKSYFEGGINCITDMLKVDDTDLAEAEVTFKKTDYNITNSVNKYCDKAIPRVIRSRHNSMKLTYSS 1543          

HSP 11 Score: 56.6102 bits (135), Expect = 1.714e-7
Identity = 49/251 (19.52%), Postives = 98/251 (39.04%), Query Frame = 3
Query: 2748 EKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQEC-------TYDQLIVYDGASIKNKQLGRFCGSKTPV-PMKSQHNSILITFTSDGSVQRR---GFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNI--NQNCLWLLETINQQLTVQLKFLHFEVEPEN------QCTYDSVKIYDGSSVMAPM------------IGQYCGTSMPTLITSQSGNLLIHFVS 3407
            E    GC   +    G + +P YP+       C+W +    G+ ++   +  +  +  +          +++  +D A   N+ L R+C  +    P+ S  N ++I +   G  Q +   GF   F ++C+G +          S  + G PY +  NQ C W ++       V     HF +  ++       C  D +K+ D     A +            + +YC  ++P +I S+  ++ + + S
Sbjct: 1298 ETITSGCGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRYCAKEMASEPITSDDNELIIKYVQSGGFQSKKIFGFSGHFTTLCNGIV----HEAISGSIQSPGYPYKVYSNQFCTWTIKVPKGNRIVA-TVHHFSISQKSYFEGGINCITDMLKVDDTDLAEAEVTFKKTDYNITNSVNKYCDKAIPRVIRSRHNSMKLTYSS 1543          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-14 (Zinc metalloproteinase nas-14 [Source:UniProtKB/Swiss-Prot;Acc:Q19269])

HSP 1 Score: 145.976 bits (367), Expect = 1.665e-36
Identity = 79/199 (39.70%), Postives = 113/199 (56.78%), Query Frame = 3
Query:  897 RTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTC-GCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKT 1490
            + W  G +PY ++   +++ +  I +A   ++  TC+ F+PK   D  YI        GC SYVGR   ++  ++ + K C  KGI+ HEL H +GF+HEH+R DRDD VDI  +N+  G   NF+K     +DSL   YDY+S+MHY K  FS+ N + TI PK       +GQR  LS  D ++ NKLY C +  KT
Sbjct:  123 KLWPEGQVPYMLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSYVGRAGGNQTVSLEVDK-CFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFSR-NGKPTIIPKD--NEADVGQRYKLSEMDSKKVNKLYQCGEYSKT 317          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-4 (Zinc metalloproteinase nas-4 [Source:UniProtKB/Swiss-Prot;Acc:P55112])

HSP 1 Score: 142.124 bits (357), Expect = 1.966e-36
Identity = 71/201 (35.32%), Postives = 112/201 (55.72%), Query Frame = 3
Query:  873 RAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCP 1475
            R A    +R W +  IPY + + + S  ++ I  AM  +   TC+ F+ +  S     ++     GC S VG+    +P  +S+   C + G ++HEL H +GF+HE +R DRD ++D++ +NV+ G D  F+K   + +  L+E YDY SIMHY    FS + K+  +  K+   R  +GQR+  S  D+R+ NKLYNCP
Sbjct:   94 RNAIKQIYRRWPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDEGCYSLVGKTGGKQP--VSLDSGCIQVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVPKKSGSER--MGQRVKFSDIDVRKINKLYNCP 290          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084690)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 425/884 (48.08%), Postives = 564/884 (63.80%), Query Frame = 3
Query:  858 RKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSS-DKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRP--KACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALD-CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRN-TGFVASYQAVCGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEG---KEKDCQYDYINVYDG-PENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGT-PYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIY----DGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            R R  RA T+ K R W +G+IPY I  NFS   KA    AMRHWEN TC+ F+ +      +YI+FT ++CGCCS+VG+R  + PQAISIG+NCDK GIV+HELGHV+GFWHEHTRPDR+ HV I   N++ GQD+NF  +   EVDSL  AYDY SIMHYA+ TFSK     TI P       RP IGQR+ LS GDI Q N LY CPKCG+T  E S  F+SP        S   + C+WRI+ T GERV L +   +I +S +C  +YLEIRDG +E S LIGR+C +     I ++ SR+ + Y N        GF A +  VCGGE+   +  GR+ SPNYP  Y PNK+C+WKITVP  Y +ALKF+SF++E HD+CVYD++E+RDG  +   L+   CGY+ P  +K++ N MY+KF+SD+SV+K GF+A F +E DEC+   HGC H C+NTLG Y C+C IG+EL +D K CE+ACGG+I+  NG++ SP++P  YP  K+CIW I+A  K +I  NFT FD+EG   ++ DC YD + VY    EN  K++G +CG   P   TS +N L + F+SD ++Q+ GF   F+TD +EC   NG C+H C NTIGSY C C  GY +H    +CKE     C YEI+   G I SPNYP +YP  ++C W  ITTPGH I+L F++F++ESHQECTYD + VYDG S  +  LGRFCG K P P+ S  N + +   +D + Q+ GF  + ++ C G L AT + Q  +SHA +G   Y+   +C W +   +    VQL FL F++E    CT+D V+++    D      PM GQYCG  +P  I S + +LL+ F +D +V  KGF A Y+AVP
Sbjct:  514 RHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRG-NGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVVCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGE---CKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSY-VQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAVP 1392          

HSP 2 Score: 142.51 bits (358), Expect = 8.643e-34
Identity = 105/418 (25.12%), Postives = 164/418 (39.23%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIP----ESLDCTINYLEIRDGVYENS-DLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY-------------------------------------------QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSL----HXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLG----KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECE 2645
            +C W I      R+SLN + F +     +  DC  + + +   + EN    IG +C  +      S+ + + + + +    + +GF A +                                           +  C  EI A  G I SPNYP+ Y PN  C+W      G+ I L F  F +E H  C YD + + DG  E   +L + CG +IP PI +T+NQMY+   +D + +K GFTA                SH                            ACGG ++ ++       H+     +Y     C W I A   + +   F  FD+E  E +C +DY+ V+   ++   + G    +YCG   PQ I S T+ L + F +D +V  KGF  ++    N  E
Sbjct: 1022 ECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTA----------------SH--------------------------STACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSE-NCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAVPNSGE 1396          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0339252)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 425/884 (48.08%), Postives = 564/884 (63.80%), Query Frame = 3
Query:  858 RKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSS-DKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRP--KACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALD-CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRN-TGFVASYQAVCGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEG---KEKDCQYDYINVYDG-PENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGT-PYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIY----DGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            R R  RA T+ K R W +G+IPY I  NFS   KA    AMRHWEN TC+ F+ +      +YI+FT ++CGCCS+VG+R  + PQAISIG+NCDK GIV+HELGHV+GFWHEHTRPDR+ HV I   N++ GQD+NF  +   EVDSL  AYDY SIMHYA+ TFSK     TI P       RP IGQR+ LS GDI Q N LY CPKCG+T  E S  F+SP        S   + C+WRI+ T GERV L +   +I +S +C  +YLEIRDG +E S LIGR+C +     I ++ SR+ + Y N        GF A +  VCGGE+   +  GR+ SPNYP  Y PNK+C+WKITVP  Y +ALKF+SF++E HD+CVYD++E+RDG  +   L+   CGY+ P  +K++ N MY+KF+SD+SV+K GF+A F +E DEC+   HGC H C+NTLG Y C+C IG+EL +D K CE+ACGG+I+  NG++ SP++P  YP  K+CIW I+A  K +I  NFT FD+EG   ++ DC YD + VY    EN  K++G +CG   P   TS +N L + F+SD ++Q+ GF   F+TD +EC   NG C+H C NTIGSY C C  GY +H    +CKE     C YEI+   G I SPNYP +YP  ++C W  ITTPGH I+L F++F++ESHQECTYD + VYDG S  +  LGRFCG K P P+ S  N + +   +D + Q+ GF  + ++ C G L AT + Q  +SHA +G   Y+   +C W +   +    VQL FL F++E    CT+D V+++    D      PM GQYCG  +P  I S + +LL+ F +D +V  KGF A Y+AVP
Sbjct:  514 RHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRG-NGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVVCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGE---CKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSY-VQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAVP 1392          

HSP 2 Score: 142.51 bits (358), Expect = 8.643e-34
Identity = 105/418 (25.12%), Postives = 164/418 (39.23%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIP----ESLDCTINYLEIRDGVYENS-DLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY-------------------------------------------QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSL----HXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLG----KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECE 2645
            +C W I      R+SLN + F +     +  DC  + + +   + EN    IG +C  +      S+ + + + + +    + +GF A +                                           +  C  EI A  G I SPNYP+ Y PN  C+W      G+ I L F  F +E H  C YD + + DG  E   +L + CG +IP PI +T+NQMY+   +D + +K GFTA                SH                            ACGG ++ ++       H+     +Y     C W I A   + +   F  FD+E  E +C +DY+ V+   ++   + G    +YCG   PQ I S T+ L + F +D +V  KGF  ++    N  E
Sbjct: 1022 ECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTA----------------SH--------------------------STACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSE-NCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAVPNSGE 1396          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084689)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 425/884 (48.08%), Postives = 564/884 (63.80%), Query Frame = 3
Query:  858 RKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSS-DKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRP--KACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALD-CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRN-TGFVASYQAVCGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEG---KEKDCQYDYINVYDG-PENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGT-PYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIY----DGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            R R  RA T+ K R W +G+IPY I  NFS   KA    AMRHWEN TC+ F+ +      +YI+FT ++CGCCS+VG+R  + PQAISIG+NCDK GIV+HELGHV+GFWHEHTRPDR+ HV I   N++ GQD+NF  +   EVDSL  AYDY SIMHYA+ TFSK     TI P       RP IGQR+ LS GDI Q N LY CPKCG+T  E S  F+SP        S   + C+WRI+ T GERV L +   +I +S +C  +YLEIRDG +E S LIGR+C +     I ++ SR+ + Y N        GF A +  VCGGE+   +  GR+ SPNYP  Y PNK+C+WKITVP  Y +ALKF+SF++E HD+CVYD++E+RDG  +   L+   CGY+ P  +K++ N MY+KF+SD+SV+K GF+A F +E DEC+   HGC H C+NTLG Y C+C IG+EL +D K CE+ACGG+I+  NG++ SP++P  YP  K+CIW I+A  K +I  NFT FD+EG   ++ DC YD + VY    EN  K++G +CG   P   TS +N L + F+SD ++Q+ GF   F+TD +EC   NG C+H C NTIGSY C C  GY +H    +CKE     C YEI+   G I SPNYP +YP  ++C W  ITTPGH I+L F++F++ESHQECTYD + VYDG S  +  LGRFCG K P P+ S  N + +   +D + Q+ GF  + ++ C G L AT + Q  +SHA +G   Y+   +C W +   +    VQL FL F++E    CT+D V+++    D      PM GQYCG  +P  I S + +LL+ F +D +V  KGF A Y+AVP
Sbjct:  514 RHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRG-NGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVVCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGE---CKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSY-VQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAVP 1392          

HSP 2 Score: 142.51 bits (358), Expect = 8.643e-34
Identity = 105/418 (25.12%), Postives = 164/418 (39.23%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIP----ESLDCTINYLEIRDGVYENS-DLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY-------------------------------------------QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSL----HXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLG----KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECE 2645
            +C W I      R+SLN + F +     +  DC  + + +   + EN    IG +C  +      S+ + + + + +    + +GF A +                                           +  C  EI A  G I SPNYP+ Y PN  C+W      G+ I L F  F +E H  C YD + + DG  E   +L + CG +IP PI +T+NQMY+   +D + +K GFTA                SH                            ACGG ++ ++       H+     +Y     C W I A   + +   F  FD+E  E +C +DY+ V+   ++   + G    +YCG   PQ I S T+ L + F +D +V  KGF  ++    N  E
Sbjct: 1022 ECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTA----------------SH--------------------------STACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSE-NCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAVPNSGE 1396          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tld (gene:FBgn0003719 transcript:FBtr0084691)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 402/903 (44.52%), Postives = 553/903 (61.24%), Query Frame = 3
Query:  861 KRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSS-DKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCP--RPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSP---------------------ERENEWTFSGAL-DCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRN-TGFVASYQAVCGGEIHASEGRII-SPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIK--ESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKE---KDCQYDYINVYDGPENNQ-KKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQL-HGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGT-PYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            +R RRA T  K RTW +G+IPY I   FS   KA   +AMRHWEN+TC+ F+ +  +   +YI FT K CGCCS++G+      Q ISIG+NC+K GI+IHELGH IGF HEH R DRD H+ I   N++ GQ++NF  +   EVD     YD  SIMHYAK +FSK+    TI P    P     +GQR  LS GDI Q N LY C  CG+T  + S +  SP                     +   E  F  +L +C+WRI+ T GE+V L++ + H+  S DCT +YLEIRDG +  S L+ R C   +   I ++ SR+ + Y N+  ++   GF A ++ VCGG++  ++ + I SPNYP  Y P+K+C+W+IT P  + +ALKF+SF++EKHD C YDF+EIRDG+    RL+ + CG ++P  IKT +NQMYI+F+SDSSV+K GF+A    + DECK   HGC H+C+NTLG+Y C C  GYELQA+GKTCE+ACGG++   +SNGSL+SP+YP  YP +K+C+W ++A     +F NF+ FD+EG       C YDY+ +Y    +N+ KK+G YCG + P  + S  + L + FYSD TVQ+ GF   F  D +EC   NG C+H C NT GSY C CR GY L     NC E     C +EIT ++G ++SPNYP  YP    C W   T  GH IQLTF DFE+ESHQEC YD + +YDG S  +  LG +CG + P  + +  N + +   +D  +QR+GFK TF S C G L AT   Q  +SH  YG+ PY  N  C W ++  + + +V+++FLHFE+E   +C YD ++I +    M  + G++CG   P +I S S  LL+ F +D++ S +GF   ++AV  P
Sbjct:  132 QRRRRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGR-QPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCASCGRTYQQNSGHIVSPHFIYSGNGVLSEFEGSGDAGEDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDCTQDYLEIRDGYWHKSPLVRRICGNVSGEVITTQTSRMLLNYVNRNAAKGYRGFKARFEVVCGGDLKLTKDQSIDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCAYDFVEIRDGNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFTDHGCQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDVYPNSKQCVWEVVAPPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSILRLEFYSDRTVQRSGFVAKFVIDVDECSMNNGGCQHRCRNTFGSYQCSCRNGYTLAENGHNCTETR---CKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVSECGGYLRATNHSQTFYSHPRYGSRPYKRNMYCDWRIQA-DPESSVKIRFLHFEIEYSERCDYDYLEITEEGYSMNTIHGRFCGKHKPPIIISNSDTLLLRFQTDESNSLRGFAISFMAVDPP 1029          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: Cubn (gene:FBgn0052702 transcript:FBtr0273437)

HSP 1 Score: 165.622 bits (418), Expect = 1.260e-40
Identity = 149/653 (22.82%), Postives = 258/653 (39.51%), Query Frame = 3
Query: 1563 CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAI--SPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIH-ASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYD--GPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEI-------ESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVP-MKSQHNSILITFTSDGSVQRRGFKITFNSICDGK----LIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYD--GSSV---MAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            C W I   E   V++  + F + +S +C  ++L+I DG    + +IGRYC         I+S G+++++ +++   +   GF  ++ ++   CGG ++  + G + SP  P  Y  N+ C W++  P    I L F S ++E+H  C +D++ I+D      R L+K C    P P+    +   I F SD+     GF  ++  E                                +  G      CGG+     G++   +  +  P    C + I  +   ++   F   +++    DC  + +++ D  G    +K  G    +  P   TS  N L I FY+    +   F++N+                                                C Y++ +  G I SP YP    S   C + I T    +I L   DF++       + + EC    L + DG  +  K LG +CG   P     S+ N + +  ++D     RGFK  + ++  G      + T     I     +   Y     C W++     +  ++L +  F +E    C YD ++IYD  G+ V    +  + +YCG S+P  + S S  L++ FVSD + S  GF   Y
Sbjct:  535 CAWVIRTNESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDLTWNSMEPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCNFDYVLIKD--SISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEE-------------------------------RVPG------CGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELD--PLDC-LEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYA----RAGSFQLNYRM---------------------------------------------ACDYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDG--LNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGNDKCGGVHTRSGDHI-RLPVHDDSYAGEATCYWVIMAPANK-AIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTY 1092          

HSP 2 Score: 165.236 bits (417), Expect = 1.506e-40
Identity = 156/680 (22.94%), Postives = 275/680 (40.44%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVY-----ENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY----QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPE-NNQKKLGKYCGKKPPQP--ITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNY--PVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQ---LIVYDGASIK---NKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            KCG       D+   P  ++  +++G   C W I     + + L+ + F +  ++DC  +YLEI D +      E S  + +YC  +    ++S   ++ +++ +     + GF  +Y    +A CGG IHAS G + SP YP  Y     C W +T  I + + ++ E+F++E+   C  D+LE+R+G      L+ + CG  IP  I   +++M +   +DS++  +GF                                  + + + A G      CGG ++ + G++ SP YP++YP    C WRI     + I     + ++EG   +C YD + +Y G +  NQ      C         I    N+ TI F SD++   +GF+I++                                     K NC           +T   G I+S NY  P       NC W I    G+ + +  S          T      L + DG +++     Q     G    V   + + +  + +  DG ++    + TF                 F    Y   Y  N  C WL+ T+ Q   ++L   + ++E    CT D++ + +  + +  +  ++CG++   +ITS    L + F+SD++ +  GF+A Y  V
Sbjct:  977 KCGGVHTRSGDHIRLPVHDD--SYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFR---------------------------------LRWRIFAFG------CGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIEDLELEGL-SNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISY-------------------------------------KANCIRN--------LTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVSHLARHEQHVPTATMPGGLYIVDGRNVQEIVTPQAMNISGEVLTVVHNASNVNFQLDYRIDGCMEE--LRGTFG---------------FFQSPNYPKMYPNNLECYWLI-TVEQDSAIELTINNIDLEDSPNCTKDALTVSNHKNSVE-VHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTV 1550          

HSP 3 Score: 164.081 bits (414), Expect = 3.318e-40
Identity = 165/703 (23.47%), Postives = 283/703 (40.26%), Query Frame = 3
Query: 1464 YNCPKCGKTL-LEYSDNFSSPERENEWTFSGALDCQWRIS----------VTEGERVSLNISEFHI-----------PESLDCTINYLEIRDGVYENSDLIGRYCARA-AISPIISKGSRIWIRYKNQAPSRNTGFVAS--YQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVYDFLEIRDGHDEQKRL--LSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRII--ASKKAKIFFNFTEFDVE-GKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNK-QLGRFCG---SKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI--CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            Y+   CG  + LE  DN +  +     + +GA+DC W I           V   + + L +S +++           PE+  C  +YL++ +G  +NS  +G +C +A A++ ++ +G  +++ Y + + S N  F  S  Y + CGG++      I   ++ E YK N +CIW++   +GY I L F+  F IE    C  D+L ++  ++       L +ICG   P  I TT+  + + F SD  V   GF A F++                           + G  L AD    E A  G        L             +C W I+  +     +  +F  FD+E G    C YD + V    +    +    CG K           + +   +D +   +GF +  YT R             C   I               + +  E  V     + TD            T P  S+C W +    G+   + F   + E++  C YD + V+ G     + + GRFCG      P+    Q   I+ +F SD     RGF+     +  CD K+      ++++S       Y  + +C  +   +N    + ++F +F V+  + C  D V++ DG    A +IG++CG + P  + +    L + FV+D+ V+  GF+    A+P+
Sbjct: 2756 YSTQSCGGVIILEPGDNMTVHQPSGMVSAAGAIDCAWAIGPYTDASGEDEVLVPQDIQLEVSVYNVNLPAPSPSAQSPEA-PCLHHYLKVYNGPDQNSPSLGLFCNQATAVNMVVERG--LFLEYHSDSFSANATFNVSIKYGSGCGGKLVYPYRAI---DFAEQYKNNVECIWEVEATMGYHIGLTFQGRFYIEDSPGCTKDYLLVQQRNETTGNWTDLQRICGRVAPEMINTTSPYLRLIFRSDGDVVADGFLAKFER---------------------------NCGGLLYADSTEQELASPGFPNGYEKYL-------------QCNWTIVPRSPSMGGVLVSFVNFDLEQGPISVCLYDNLTVTTKDKGKDPQQTTLCGVKHNHEYRG-KEYVNLLLRTDGSYSGRGFTL-LYTSR------------LCGGII--------------SRTSMVESPV-----QHTDN-----------TLPPGSDCYWNLTAPAGYKFNIKFLFIDFEANSNCAYDGVEVFSGPIPDERYRWGRFCGRINEDLPLISIPQERGIIHSF-SDDRDPSRGFRALVRVMPNCDEKISLNGSSRYVYSKFNNAGGYQNDLDCQIVFR-VNPDQQISVEFSNFHVQDTDGCRSDYVELRDGGGTFADIIGRFCGQNQPPTLRTTRHTLYMRFVTDNKVTDTGFQVTINAIPR 3366          

HSP 4 Score: 159.073 bits (401), Expect = 1.059e-38
Identity = 157/686 (22.89%), Postives = 275/686 (40.09%), Query Frame = 3
Query: 1473 PKCGKTL-LEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV-----CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLS-KICGYQI----PGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKD------CQYDYINVYDGPENNQKKLGKYCGK-KPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYD--GASI---KNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFN----SICDGKLIATEEPQFIFSHAAYGTPYNINQNCLW-LLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            P+CG  L  E     +SP       +    DC+W++     +R+ L      + +  +C  +Y+ I+D +  +   + +YC   A +P++       I + + A   +TGF   Y        CGG   A EG I   +          C ++I + +G  + ++F   +++       D LE+ D  DE   +L  KICG       P    +  N++ IKF + +          FQ                       Y  ACD  Y+L  +                G++ SP YP+    ++ C + I  +    I     +F +   E D      C    + + DG   N+K LG YCGK +P +   S TN L +   +D     +GFK                                   Y+     N      D C    T +   I+ P +  +Y  ++ C W I+      I+L ++ F +E+  +C YD L +YD  GA +   ++K L ++CG+  P  + S    +++ F SD S    GF +T+     + C G + A+       +   Y   Y+   +C W L  TI+  L +Q++  +FE+E    C+ D +++ +G    +P+IG++CG  +P  I   S  + +   +D  ++ +GF+  +
Sbjct:  625 PQCGGRLNFETHGTLASPGSPG--NYPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCNFDYVLIKDSI--SGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELDP-----LDCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYARA--------GSFQLN---------------------YRMACD--YKLNNE---------------QGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDGL--NRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFE---------------------------------YRALATGN------DKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHASSGE---LTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVE--NFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRW 1209          

HSP 5 Score: 143.665 bits (361), Expect = 6.734e-34
Identity = 136/559 (24.33%), Postives = 230/559 (41.14%), Query Frame = 3
Query: 1824 CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIP--GPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIK-ESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKT----PVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEV-------EPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTL-ITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            C G + A  GR+  P     Y+ N QC W I       + + F SF +E    C +D+L+I DG     +++ + CG  +P  G I ++ NQ+Y+ F SD+S  K+GF                                 D+ +       + E  CGG +  E++G+L SP  P NYP N+ C W+++A    +I   F    +E +  +C +DY+ + D      ++L KYC    P P+   T+   I F+SD+     GF++                 H+ V                       E+ V GC    T   G I   +   T P   +CE++I    G  + + F+  E++   +C     I  +G SI  +++   CGS      P    S+ N + I F +        F++ +   CD KL      Q   +   Y      ++ C + + T    + + LK + F++       +  ++C   +++I DG  +   ++G YCG + P     S++  L +H  +D     +GFK EY A+
Sbjct:  509 CNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGF---------------------------------DLTW------NSMEPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQLE-QHANCNFDYVLIKDSISG--RELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQL-----------------HYSV-----------------------EERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELDP-LDCLEVLDITDEGGSILQEKI---CGSDASRLNPPTFTSEFNRLKIKFYARAG----SFQLNYRMACDYKL---NNEQGTITSPGYPNLTRSDRICTYTISTATNTV-ISLKRIDFQLTNGESDDDDNDECLTTNLRINDG--LNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRAL 971          

HSP 6 Score: 141.354 bits (355), Expect = 2.792e-33
Identity = 151/641 (23.56%), Postives = 263/641 (41.03%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNIS-----EFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA-VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQK--KLGKYCGKKPP--QPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLE-TINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            ++C W I   +G RV + +S     E H+P +         +  G+Y    + GR          ++    +     N +   N  F   Y+   C  E+  + G   SPNYP+ Y  N +C W ITV    +I L   +  +E    C  D L + + H     +  + CG      I ++ ++++++F+SD+S    GF A +                                       +T +  CGG +   NG + SPNYP NYP + +C W++  S+  +I F   + ++E    DC +DY+  YD  E++ +  +L K CG +    + ++S++N   + F SD +V KKGF+++F+                C  TI                    E   D        A  E     +    P+K     +II TP H+     ++ +  +  +C    + +Y+G   +     +FC S  P  + S   ++ ++       + +G  +T ++ C     A       F+   Y   Y  N  CLWLLE ++   L++ L+ +  ++E    C  D +++ +  S    +IG YCG  +P +I S+ G + + F SDD    +GF A Y
Sbjct: 1358 INCSWTIRAPKGNRVLVEVSHLARHEQHVPTA--------TMPGGLYI---VDGRNVQEIVTPQAMNISGEVLTVVHNAS---NVNFQLDYRIDGCMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVSN-HKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATY---------------------------------------RTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESG-YDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFHES--------------CGQTI-----------------IVDETMFDYIQMSRQAARNESCLWVFQAVEPNK-----RIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPA-LISNGQALTVSVPLQLVEEFQGHYMTMDTSCGSIYNALSGK---FTSPYYPASYPPNIECLWLLEASMGNSLSLTLESM--DLEKSESCNRDYLEVRE-ESESGQLIGVYCGNEVPGVIHSR-GAIWMKFKSDDDNVGEGFMASY 1899          

HSP 7 Score: 131.724 bits (330), Expect = 2.691e-30
Identity = 128/541 (23.66%), Postives = 215/541 (39.74%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENS-DLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQ---AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRD--GHDEQKRLLSKICGYQIPGP--IKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAK-IFFNFTEFDVE-------GKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATE 3131
            L+C W I+V +   + L I+   + +S +CT + L + +  ++NS ++  R+C       I S G R+ +R+ +       GF A+Y+   A CGG++ A  G I SPNYP  Y  + +C W++ V   + I  +     +E    C +D+LE  D    D +   L K+CG +      + +++N   ++F+SD SV K+GF  +F   H+ C     G + +   T+  Y         +Q   +   N                         + C+W   A +  K I F  T   +          E DC    + +Y+G E       K+C   PP  I S    LT++       + +G  +   T                  + GS Y                               G+  SP YP +YP    C W +  + G+ + LT    ++E  + C  D L V +  S   + +G +CG++ P  + S+  +I + F SD      GF  ++N     +L  TE
Sbjct: 1463 LECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVSN--HKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHF---HESC-----GQTIIVDETMFDY---------IQMSRQAARN-------------------------ESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPALI-SNGQALTVSVPLQLVEEFQGHYMTMDT------------------SCGSIY---------------------------NALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVRE-ESESGQLIGVYCGNEVPGVIHSR-GAIWMKFKSDDDNVGEGFMASYNYEHHNELNGTE 1911          

HSP 8 Score: 130.954 bits (328), Expect = 4.394e-30
Identity = 151/649 (23.27%), Postives = 257/649 (39.60%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGV-YENSDLIGRYCARAAI-SPIIS-KGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPE-FYKPNK-QCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGA--SIKNKQLGRFCGSKTPVP--MKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVE--------PENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITS 3374
            CG +L       SSP   N  ++     C+WRIS+  G  +SL I +  +    +C  + ++I  G+   N       C    + +P+I  + ++  I + + A +   GF  SY+A C   + A+ G I S NY E F++     C W I  P G  + +  E   + +H+  V                           P  T    +YI    D    ++  T        E   + H  S+V            +   + + DG      C   ++ + G   SPNYP  YP N +C W I   + + I       D+E    +C  D + V +  +N+ +   ++CG      ITS+ + L + F SD++    GF+  + T +  C  K                                          +T  +G I+SPNYP+ YP+ S CEW++  +  H I    +D  +ES  +C +D L  YD      + ++L + CG +T     + S  N  ++ F SD SV ++GF++ F+  C   +I  E    +F +         N++CLW+ + +     +     H ++          E  C    VKIY+G+        ++C +  P LI++
Sbjct: 1216 CGGSLRSNMGAISSPRYPN--SYPNMAHCEWRISLHPGSGISLLIEDLELEGLSNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLV--EVSHLARHEQHV---------------------------PTATMPGGLYI---VDGRNVQEIVTPQAMNISGEVLTVVHNASNV------------NFQLDYRIDG------CMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLE-DSPNCTKDALTVSNH-KNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKATCGGK------------------------------------------LTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFHESCGQTIIVDET---MFDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPALISN 1765          

HSP 9 Score: 117.087 bits (292), Expect = 8.300e-26
Identity = 96/403 (23.82%), Postives = 169/403 (41.94%), Query Frame = 3
Query: 2226 YMCACDIGYELQADGKTCE---NACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQP--ITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFN-----SICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLE-TINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHF 3401
            ++C C  GY     G+ CE   ++C G++   +G L  P   + Y  N +C W I  ++   +   F  FDVE    +C++D++ + DG     + +G+YCG   P    I S+ N+L + F SD++  K+GF + + +   +C                             G+ N              + HG + SP  P  YP   +C W+++      I+LTF   ++E H  C +D +++ D  SI  ++L ++C +  P P+    +   I F SD      GF++ ++       C G   A +E     S  A   P  +  +C + +   + +Q+ +Q  F   E++P +      +    GS +   + G       P   TS+   L I F
Sbjct:  489 FVCQCLPGYR----GRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVE-DSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDLTWNSMEPQC----------------------------GGRLN-------------FETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCNFDYVLIKD--SISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEERVPGCGGVYTA-KEGTISESSTANTEPGGV--SCEYEIHLAVGEQVVIQ--FARLELDPLDCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKF 838          

HSP 10 Score: 111.694 bits (278), Expect = 2.955e-24
Identity = 75/258 (29.07%), Postives = 119/258 (46.12%), Query Frame = 3
Query: 2694 YYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTP--VPMKSQHNSILITFTSDGSVQRRGFKITFNSI---CDGKLIATEEPQFIFSHAAYGTP--YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            + C C PGY+    + C E     C   ++   G ++ P     Y   + C W I T    ++ +TF+ F++E   EC +D L + DG S   + +GR+CG+  P    + S  N + + F SD S  + GF +T+NS+   C G+L            A+ G+P  Y  N++C W L     +  ++L F   ++E    C +D V I D  S+    + +YC T  P  +   +    IHF SD   S  GF+  Y
Sbjct:  489 FVCQCLPGYR---GRLC-ETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDLTWNSMEPQCGGRLNFETHGTL----ASPGSPGNYPKNRDCRWQLVAPTTK-RIKLTFFSLQLEQHANCNFDYVLIKD--SISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHY 735          

HSP 11 Score: 103.219 bits (256), Expect = 1.185e-21
Identity = 160/678 (23.60%), Postives = 262/678 (38.64%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQ-IPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGG---LIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAK-IFFNFTEFDVEGKEKDCQYDYINVYDGPE-NNQKKLGKYCG--KKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQ-----ECTYDQLIVYDGASIKNKQLGR--FCGSKTPVPMKSQHNSILITFTSDGS----VQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLET-----INQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKA 3440
            CG      S  F+SP      ++   ++C W +  + G  +SL +    + +S  C  +YLE+R+   E+  LIG YC       I S+G+ IW+++K+   +   GF+ASY      E++ +EG I S   P F  P+K   ++  VP  + I        ++K        L +R   D  +  L+   GY  I   I+ T+         D ++       YF       K   +  S   + +               A+ +T    CG     I  S    HSP YP+ Y  +  C W ++ S  A       ++ D+E   +DC  DY+ ++ G +  N  +L   C    +    +      L + F +D +V K GF              NG     C    GS                  E T       IT+    +  PN+        +C W I    G  I++ F DF+++++      +C  + L++ +G    +  LGR  +C       + +  N   I F         V  R  ++ +      +L A+ + QFI S      P+  +  C+W++E      I          L    EPE +C  + V I DGS+ + P IG+YCG   P  I S    + I + +D +    GF A
Sbjct: 1792 CGSIYNALSGKFTSPYYPA--SYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVREES-ESGQLIGVYCGNEVPGVIHSRGA-IWMKFKSDDDNVGEGFMASYNYEHHNELNGTEGTIES---PHF--PSK---FQDPVPYSWRIT-------VDKEYVVAISLLYLR---DLDQPHLNFYDGYSDIGARIEVTD--------PDETIISSTNVVYFTSNRGPFKLNWNRLSKEALRS------------NRTAEERT--RQCGNQLITIDRSVIGFHSPGYPNGYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSGSDLQNWSELRTLCSLPTESSDRVFHGRPYLRVEFVTDPSVNKTGF--------------NGIVRTAC----GS------------------EITASKGLVNITEILKVLPRPNH--------DCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCR-NYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKFHFASPPRFLVSFRFEELRYTDSGRIRLSASGDEQFISSPYYPHLPHP-HSECIWIVEAPPEHRIMLHFQGAFDMLDATGEPE-ECQREFVLINDGSTELRPEIGRYCGNRKPDTIYSTGNQMRIRYFTDVSEPHMGFNA 2378          

HSP 12 Score: 92.4337 bits (228), Expect = 2.272e-18
Identity = 55/188 (29.26%), Postives = 89/188 (47.34%), Query Frame = 3
Query: 1629 PESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG 2192
            P   DC    ++I +G         ++C R+    +IS G  + +    Q      G   +    CG   +A  G+  SP YP  Y PN +C+W +   +G S++L  ES  +EK ++C  D+LE+R+   E  +L+   CG ++PG I  +   +++KF SD     +GF A +  EH    N   G
Sbjct: 1728 PTEGDCLNVGVKIYEGTEPQGTPRLKFC-RSHPPALISNGQALTVSVPLQLVEEFQGHYMTMDTSCGSIYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVRE-ESESGQLIGVYCGNEVPGVIH-SRGAIWMKFKSDDDNVGEGFMASYNYEHHNELNGTEG 1912          

HSP 13 Score: 88.9669 bits (219), Expect = 2.758e-17
Identity = 96/398 (24.12%), Postives = 150/398 (37.69%), Query Frame = 3
Query: 2364 KCIWRIIASKKAKIFFNFT-EFDVEGKEKDCQYDYINVYDGPE--NNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHI--IQLTFSDFEIESH--QECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS-ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPM------IGQYCG---TSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTYRFQY 3506
            +CIW + A+    I   F   F +E     C  DY+ V    E   N   L + CG+  P+ I +T+  L + F SD  V   GF   F                                     ++NC      G          E+ SP +P  Y     C W I+     +  + ++F +F++E      C YD L V      K+ Q    CG K     + +    L+   +DGS   RGF + + S +C G +  T   +    H     P     +C W L T        +KFL  + E  + C YD V+++ G     P+       G++CG     +P LI+      +IH  SDD   ++GF+A    +P   +    + + R+ Y
Sbjct: 2920 ECIWEVEATMGYHIGLTFQGRFYIE-DSPGCTKDYLLVQQRNETTGNWTDLQRICGRVAPEMINTTSPYLRLIFRSDGDVVADGFLAKF-------------------------------------ERNC------GGLLYADSTEQELASPGFPNGYEKYLQCNWTIVPRSPSMGGVLVSFVNFDLEQGPISVCLYDNLTVTTKDKGKDPQQTTLCGVKHNHEYRGKEYVNLL-LRTDGSYSGRGFTLLYTSRLCGGIISRTSMVESPVQHTDNTLP--PGSDCYWNL-TAPAGYKFNIKFLFIDFEANSNCAYDGVEVFSG-----PIPDERYRWGRFCGRINEDLP-LISIPQERGIIHSFSDDRDPSRGFRALVRVMPNCDEKISLNGSSRYVY 3263          

HSP 14 Score: 83.1889 bits (204), Expect = 1.791e-15
Identity = 135/710 (19.01%), Postives = 252/710 (35.49%), Query Frame = 3
Query: 1461 LYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDG-VYENSDLIGRYCARAAIS-PIISKGSRIWIRYK---NQAPSRNTGFVASYQAVCGGEI--HASEGRIISP-NYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKD--CQYDYINVY------------------DGPENNQKKLG-----KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCG-SKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI-----CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPM-IGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHK 3470
            LY    CG  ++  +    SP +  + T     DC W ++   G + ++         + +C  + +E+  G + +     GR+C R     P+IS      I +    ++ PSR    +      C  +I  + S   + S  N    Y+ +  C     V     I+++F +F ++  D C  D++E+RDG      ++ + CG   P  ++TT + +Y++F++D+ V   GF                    V +N +     + +I   L ADG           KE   +  +     NYP    C W+I      ++   F  FD+ G  ++  C  DY+ +Y                  +G  +++   G      YCG   P      ++E+ + F S    Q  GF++    + N                                    +E+  DG                  V     ++C   I   P + + L +++    ++ +C  + L V+D     N+ L R C        + S  N + +   +   +         + +     C G+   TE    IFS+  Y      N  C W++   +  + V L F  F +  +  C  D ++I +  +      + ++CG   P    S+   +L+ F         G+   +  V   H+
Sbjct: 3124 LYTSRLCGG-IISRTSMVESPVQHTDNTLPPGSDCYWNLTAPAGYKFNIKFLFIDFEANSNCAYDGVEVFSGPIPDERYRWGRFCGRINEDLPLISIPQERGIIHSFSDDRDPSRGFRALVRVMPNCDEKISLNGSSRYVYSKFNNAGGYQNDLDCQIVFRVNPDQQISVEFSNFHVQDTDGCRSDYVELRDGGGTFADIIGRFCGQNQPPTLRTTRHTLYMRFVTDNKVTDTGF-------------------QVTINAIPRLCGSSEI--TLSADGT----------KEVTINSPARTPGGNYPNGVSCFWKIKGDSLLRV--QFVNFDLHGPNQNGSCVDDYLKIYNSEDAPLLEQGLGTDLVFNGQTSSKNGFGFATEHVYCGNVKPDIYYGRSSEVYLKFRSKGLEQHGGFQLQVALNSN------------------------------------RERHYDGLQGR--------------VHLSQSADCNIIIRAPPNYTLSLYYTELIFGTY-DCEMENLEVFDRT---NRSLQRVCSFVDMGKSLFSNANELRLQMKTGSYLTSLDLTYLASPVEKGPGCGGQFYNTEG---IFSNPFYPNNVRNNSECQWIVRVPSNNV-VFLTFEVFNLGSKTTCHTDYLQILEQDATGEEREMRRFCGEDNPKYYKSRRSQVLVRFHKTVNYDGIGWVIRFAGVYSDHQ 3741          

HSP 15 Score: 69.707 bits (169), Expect = 2.051e-11
Identity = 92/379 (24.27%), Postives = 148/379 (39.05%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNI-SEFHIPESL----DCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQ-AVCGGEIHASEGRIISPNYP-----EFYKPNKQCIWKITVPIGYSIALKFESFKIE--KHDTCV---YDFLEIRD--GHDEQKRLLSK--ICGYQIPGPIKTTNNQMY-IKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQ----YDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF 2621
            +C W +      R+ L+    F + ++     +C   ++ I DG  E    IGRYC       I S G+++ IRY       + GF AS   A CGG  H+ EG I SP+       E  K  ++C++ I +  G +I L  E  +I   ++ +C    +  LE  D  G D +++++    +CG +    I  TN  ++  +F+     E QGF   +                    +LG+                     CG  I  S G L +P YP   P    C W++   K  ++     +F+  G   D +    +            Q  LG+Y    PP  + S+ N + I  +    VQ  G K+ F
Sbjct: 2291 ECIWIVEAPPEHRIMLHFQGAFDMLDATGEPEECQREFVLINDGSTELRPEIGRYCGNRKPDTIYSTGNQMRIRYFTDVSEPHMGFNASLSVARCGGSFHSPEGVIASPSRDLLLIHEEGKQLQECVYTIELEKGSTIDLTSEYLQIPTLRNGSCSQRNHLMLEEMDAFGLDGEEKIVDTLMLCGMEAKHLISETNKIVFRYRFLDGIPAENQGFRLKY-------------------TSLGS--------------------RCGETIYASVGVLQTPGYPLGVPHPMHCKWQVQVPKGRRVRLEILDFNT-GTNMDLRGRLGFRGRLTVANDFKMQSILGRY-NVDPPAEVLSSDNTMGIDAFLLPIVQNHGIKLRF 2628          

HSP 16 Score: 68.5514 bits (166), Expect = 4.643e-11
Identity = 96/464 (20.69%), Postives = 169/464 (36.42%), Query Frame = 3
Query: 1824 CGGEIHASEGRII---SPNYPEFYKPNKQCIWKITVPIGYSI--ALKFESFKIEK-HDTCVYDFLEIRDGHDEQK-RLLSKICGYQIPGPIKTTNNQMYIK--FMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXK-KCIWRIIASKKAKIFFNFTEFDVEGK----EKDCQYDYINVYDGPENNQKKLG--KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF------YTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSD-FEIESH----QECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFN-SICDGKLIATE 3131
            CG ++   +  +I   SP YP  Y+ +  C W + VP   ++   L      +E   + C+ D+++I  G D Q    L  +C        +  + + Y++  F++D SV K GF    +                                           ACG  I  S G ++        P     C+W I   +  +I  +F +F ++        DC+ +Y+ + +G + +   LG  KYC     + + +++N+  I F+  S  +   F ++F      YTD           E F                                          I SP YP      S C W +   P H I L F   F++       +EC  + +++ DG++    ++GR+CG++ P  + S  N + I + +D S    GF  + + + C G   + E
Sbjct: 2019 CGNQLITIDRSVIGFHSPGYPNGYEQDLNCFWTL-VPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSGSDLQNWSELRTLCSLPTESSDRVFHGRPYLRVEFVTDPSVNKTGFNGIVR------------------------------------------TACGSEITASKGLVNITEILKVLPRPNHDCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCR-NYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKFHFASPPR---FLVSFRFEELRYTDSGRIRLSASGDEQF------------------------------------------ISSPYYPHLPHPHSECIWIVEAPPEHRIMLHFQGAFDMLDATGEPEECQREFVLINDGSTELRPEIGRYCGNRKPDTIYSTGNQMRIRYFTDVSEPHMGFNASLSVARCGGSFHSPE 2393          

HSP 17 Score: 62.7734 bits (151), Expect = 2.495e-9
Identity = 53/223 (23.77%), Postives = 99/223 (44.39%), Query Frame = 3
Query: 1545 FSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGS---RIWIRYKNQAPSRNTGFVAS---YQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEI--RDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH 2189
             S + DC   I       +SL  +E  I  + DC +  LE+ D     +  + R C+   +   +   +   R+ ++  +   S +  ++AS       CGG+ + +EG   +P YP   + N +C W + VP    + L FE F +    TC  D+L+I  +D   E+ R + + CG   P   K+  +Q+ ++F    + +  G+   F   + + +  +H
Sbjct: 3528 LSQSADCNIIIRAPPNYTLSLYYTEL-IFGTYDCEMENLEVFD---RTNRSLQRVCSFVDMGKSLFSNANELRLQMKTGSYLTSLDLTYLASPVEKGPGCGGQFYNTEGIFSNPFYPNNVRNNSECQWIVRVPSNNVVFLTFEVFNLGSKTTCHTDYLQILEQDATGEE-REMRRFCGEDNPKYYKSRRSQVLVRFHKTVNYDGIGWVIRFAGVYSDHQIPRH 3745          

HSP 18 Score: 61.2326 bits (147), Expect = 8.251e-9
Identity = 59/230 (25.65%), Postives = 98/230 (42.61%), Query Frame = 3
Query: 1476 KCGKTLLEYSDN---FSSPERENEWTFSGALDCQWRISVTE-GERVSLNISEFHIPE-SLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIW-------IRYKNQAPSRNTGFVASYQAVCGGEIHASEGRI-ISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKH----DTCVYDFLEIRDGHDEQKRLL--SKICGYQIPGPIKTTNNQMYIKF 2108
            +CG  L+    +   F SP   N   +   L+C W +  +       L +S+  +   S DC  +Y++I  G    SDL      R   S       R++       + +        TGF    +  CG EI AS+G + I+       +PN  C+W I V  G  I + F  F+++ +     +   ++L +R+G+DE    L   K C   +   + T++N+ YIKF
Sbjct: 2018 QCGNQLITIDRSVIGFHSPGYPN--GYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSG----SDLQNWSELRTLCSLPTESSDRVFHGRPYLRVEFVTDPSVNKTGFNGIVRTACGSEITASKGLVNITEILKVLPRPNHDCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCRNYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKF 2241          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 446/987 (45.19%), Postives = 612/987 (62.01%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E   + DPCKA  F GDIAL DDE ++M   D  +  +  Q+   + + S     H   +K  ++    L      +  + W  +  K +    + IR++   R            + R  RAATS   + W  G+IPY I  NF+   +A + +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  +V+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       ++S  SR+WI +++ +     GF A Y+A+CGGEI    G+I SPNYP+ Y+P+K+C+W+ITV  GYS+ L F+ F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C ++I    G I SPN+P  YPS+  C W I  TPGH ++++F++FEIE HQEC YD L  +DG S K   L R CG+K P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+        ++L F  FEVE E  C YD +++YDG    A  IG++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   49 ETIDYKDPCKAAVFWGDIAL-DDEDLKMFHIDGTIDLKQ-QTHGRQGHTSGGLGEHVPTKKRGSLY--LLLDRIRRLGFESWPVNSSKDVSSIKTGIRRVNSAR----------NVKSRVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEV-CKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAE---CEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-VAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 446/987 (45.19%), Postives = 612/987 (62.01%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E   + DPCKA  F GDIAL DDE ++M   D  +  +  Q+   + + S     H   +K  ++    L      +  + W  +  K +    + IR++   R            + R  RAATS   + W  G+IPY I  NF+   +A + +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  +V+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       ++S  SR+WI +++ +     GF A Y+A+CGGEI    G+I SPNYP+ Y+P+K+C+W+ITV  GYS+ L F+ F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C ++I    G I SPN+P  YPS+  C W I  TPGH ++++F++FEIE HQEC YD L  +DG S K   L R CG+K P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+        ++L F  FEVE E  C YD +++YDG    A  IG++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   49 ETIDYKDPCKAAVFWGDIAL-DDEDLKMFHIDGTIDLKQ-QTHGRQGHTSGGLGEHVPTKKRGSLY--LLLDRIRRLGFESWPVNSSKDVSSIKTGIRRVNSAR----------NVKSRVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEV-CKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAE---CEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-VAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 446/987 (45.19%), Postives = 612/987 (62.01%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E   + DPCKA  F GDIAL DDE ++M   D  +  +  Q+   + + S     H   +K  ++    L      +  + W  +  K +    + IR++   R            + R  RAATS   + W  G+IPY I  NF+   +A + +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  +V+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       ++S  SR+WI +++ +     GF A Y+A+CGGEI    G+I SPNYP+ Y+P+K+C+W+ITV  GYS+ L F+ F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C ++I    G I SPN+P  YPS+  C W I  TPGH ++++F++FEIE HQEC YD L  +DG S K   L R CG+K P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+        ++L F  FEVE E  C YD +++YDG    A  IG++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   49 ETIDYKDPCKAAVFWGDIAL-DDEDLKMFHIDGTIDLKQ-QTHGRQGHTSGGLGEHVPTKKRGSLY--LLLDRIRRLGFESWPVNSSKDVSSIKTGIRRVNSAR----------NVKSRVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEV-CKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAE---CEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-VAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: bmp1a (bone morphogenetic protein 1a [Source:ZFIN;Acc:ZDB-GENE-060818-1])

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 422/863 (48.90%), Postives = 569/863 (65.93%), Query Frame = 3
Query:  882 TSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG-CSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            TS   R W  G+IPY I  NFS   +A   +AMRHWE +TC++FI +R++++SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ +N+  GQ++NF KME  EVDSL E YD+ SIMHYA+ TFS+     TI P+      RPPIGQR  LS GDI Q  KLY CP+CG +L E S NFSSP   N   +S  + C WRISVT GE++ LN +   +  S  C  +++EIRDG +  + L GR+C      PIIS  SR+WI +++ +     GF A Y+A+CGGE+    G+I SPNYP+ Y+PNK C+WKITV  GY + L F+SF+IE+HD C YD+LE+RDG+ E   LL + CGY  P  IK+++NQ+++KF+SD SV K GF A F +E DEC    +G C   CVNTLG+Y CACD GYEL AD ++CE ACGG I + NGS+ SP +P  YPPNK CIW+++A  + +I   F  F+ EG +  C+YD++ V  G   + +  GK+CG + P+ ITS  N + I F SD+TV KKGFK  F++D++EC  +NG C+H CVNT GSY C CR G+ LH  K +CKE    GC + +    G I SPN+P  YPSK  C W + TTPGH I++ F++ ++E H EC YD + +YDG   K + LGR+CG+K P P+ S  N + I F SD SVQ++GF+ +  + C G+L A  + + ++SHA +G   Y    +C W++ T  +   V+L F  FE+E E  C YD ++++DG+   +P +G+YCG+  P  I S   +++I F SDDT++ KGF   Y + 
Sbjct:  112 TSRPERVWPEGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFI-ERTTEESYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKLYKCPRCGDSLQESSGNFSSPGYPN--GYSAYMHCIWRISVTPGEKIILNFTSMDLYRSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPDPIISTDSRLWIEFRSSSNWVGKGFSAVYEAICGGEVKKDNGQIQSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEIERHDNCAYDYLEVRDGNSESSPLLGRFCGYDKPDDIKSSSNQLWMKFVSDGSVNKAGFAANFFKEMDECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDV-CKYDFVEVRSGLSADSRLHGKFCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGFVLHENKHDCKEA---GCDHVVNSVSGTITSPNWPDKYPSKKACTWALSTTPGHRIKIAFNEIDMEPHLECAYDHIEIYDGRDSKAQSLGRYCGTKKPQPIISTGNKMFIRFFSDNSVQKKGFEASHTAECGGRLKAEVKTKDLYSHAQFGDNNYPGASDCQWVI-TAEKGYGVELIFQTFEIEEEADCGYDYMELFDGADTKSPRLGRYCGSGPPEEIYSAGDSIVIKFHSDDTINKKGFHVRYTST 965          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: bmp1b (bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB-GENE-060818-2])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 447/983 (45.47%), Postives = 611/983 (62.16%), Query Frame = 3
Query:  522 FLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG-CSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKK-NCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + DPCKA AF+GDIAL D+E +R L+   + + E+      ES+ SS                                         KP  + + +  R +  + +  + +  R RRAAT+   R W +GIIPY I  NF+   +A   +AMRHWE +TC++F+ +RS ++SYI+FT + CGCCS+VGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HVDI  EN+  GQ++NF KME  +VDSL E YD+ SIMHYA+ TFS+     T+ PK      RPPIGQR  LS GDI Q  KLY CP+CG++L + + NFSSP   N   ++  L C WRISVT GE++ LN +   +  S  C  +Y+E+RDG   ++ L GR C       I+S  S +WI +++ +     GF A Y+A+CGGE+    G+I SPNYP+ Y+PNK CIWKI VP G+ + L F+SF+IEKHD C YD+LE+RDG  E   LL + CGY+ P   K+++NQ+++KF+SD SV K GF A F +E DEC    +  C   C+NTLG++ CACD G+EL  D ++C  ACGG I + NGS  SP +P  YPPNK C+W++IA  + +I   F  F++EG +  C+YDY+ V+ G   + K  GK+CG + P+ ITS  N +++ F SD+TV K+GFK  F++D +EC  +NG C+H CVNT GSY C CR G+ LH  K +CKE    GC   IT   G I SPN+P  YPSK  C W + TTPGH I+L F + ++E+HQEC YD L +YDG + +   +GRFCGSK P P+ S  N++ + F SD SVQ+RGFK + ++ C G L A  + + ++SHA +G   Y    +C W++ +  +   V+L F  FE+E E  C YD V+++DG  V AP +G+YCG+  P  I S    ++I F SDDT++ KGF   Y + 
Sbjct:   34 YKDPCKAVAFLGDIAL-DEEDLRFLKAHYMHATEN------ESSGSS-----------------------------------------KPDSVNRSSANRNAKDEPVLANQSILRRRRAATARPERVWPNGIIPYIISGNFTGSQRAIFKQAMRHWEKHTCVTFV-ERSVEESYIVFTLRPCGCCSFVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVDIFRENIQPGQEYNFIKMEPDDVDSLGEVYDFDSIMHYARNTFSRGIYLDTMLPKYDVDGVRPPIGQRTRLSKGDIAQARKLYRCPRCGESLQDSAGNFSSPGFPN--GYAAYLHCIWRISVTPGEKIVLNFTSMDLYRSNLCWYDYVEVRDGYGRSAPLKGRICGDQLPEAIVSTDSELWIEFRSTSNWVGKGFSAVYEAICGGEVRRDSGQIESPNYPDDYRPNKACIWKIVVPEGFHVGLVFQSFEIEKHDNCAYDYLEVRDGDSESSPLLGRFCGYEKPDDFKSSSNQLWMKFVSDGSVNKAGFAANFFKEIDECSRPDNAHCEQRCINTLGSFHCACDPGFELAPDRRSCAAACGGFISKLNGSFTSPGWPQEYPPNKNCVWQLIAPVQYRITLLFDAFEMEGNDV-CKYDYVEVHSGLSADGKLHGKFCGTEKPEAITSQLNSMSVEFKSDNTVSKRGFKAQFFSDMDECSRENGGCQHECVNTFGSYSCQCRSGFVLHSNKHDCKEV---GCDQAITSVSGLITSPNWPDKYPSKKACTWTLSTTPGHRIKLAFEEIDMEAHQECAYDHLEIYDGQNGRATSVGRFCGSKKPSPVISSSNTMFLRFFSDNSVQKRGFKASHSAECGGSLKAEIKTKDLYSHAQFGDNNYPGASDCQWVI-SAEKGYGVELIFHTFEIEEEADCGYDYVELFDGGDVKAPRLGRYCGSGPPEEIYSAGDAIVIKFHSDDTINKKGFHVRYTST 959          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007933.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 448/1000 (44.80%), Postives = 625/1000 (62.50%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALT-DDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKL-TEMRFSPIQR-LKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKE----------KDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E F + DPCKA A+ GDIAL  DD +     +   L   +    QP ++N    +  K+  +N      +L +               K +K K S+++ L TE   + I    +   +  R RRAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQRI LS GDI Q  KLY CP CG+TL +   NFS+P       +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR C      PIIS  S++WI +++ +     GF A Y+A+CGG+I    G+I SPNYP+ Y+P K+CIWKITV  G+ + L F++F+IE+HD C YD+LE+RDG  E   L+ + CGY+ P  IK+T+N+++IKF+SD S+ K GF+A F +E DEC    + GCS  CVNTLG+Y C C+ G+EL AD K CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +          K C+YD++ +  G  +  K  GK+CG + P+ ITS  N + + F SD+TV K+GFK+NF++D++EC   NG C+H CVNT GSY C C+ G+ LH    +CKE    GC  ++ +A G I SPN+P  YPS+  C W I  T GH ++L F+DFEIE HQEC YD L +YDG + K+  LGRFCGSK P P+ +  NS+ + F SD SVQR+GF+  +++ C G+L A  + + I+SHA +G   Y +  NC W++        V+L F  FE+E E+ C YD +++YDG    AP +G+YCG+  P  + S   +++I F +DDT++ KGF  +Y + 
Sbjct:   39 EEFDYKDPCKAAAYWGDIALDEDDLRWFFKNKSNDLRNTNYNQTQPTTDN----FPEKVGTRNQNATSSNLSR---------------KKVK-KGSRLKLLITEKPATEINNTFQVQKSNDRVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYP--LGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVSDGISVVSLKVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA---GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI-VAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 1010          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000008231.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 443/987 (44.88%), Postives = 615/987 (62.31%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E F + DPCKA A+ GDIAL D++ +R   +                 N SN     +R  N             + QT+         +  KP+     TE+        +   +  R RRAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQRI LS GDI Q  KLY CP CG+TL +   NFS+P       +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR C      PIIS  S++WI +++ +     GF A Y+A+CGG+I    G+I SPNYP+ Y+P K+CIWKITV  G+ + L F++F+IE+HD C YD+LE+RDG  E   L+ + CGY+ P  IK+T+N+++IKF+SD S+ K GF+A F +E DEC    + GCS  CVNTLG+Y C C+ G+EL AD K CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ +  G  +  K  GK+CG + P+ ITS  N + + F SD+TV K+GFK+NF++D++EC   NG C+H CVNT GSY C C+ G+ LH    +CKE    GC  ++ +A G I SPN+P  YPS+  C W I  T GH ++L F+DFEIE HQEC YD L +YDG + K+  LGRFCGSK P P+ +  NS+ + F SD SVQR+GF+  +++ C G+L A  + + I+SHA +G   Y +  NC W++        V+L F  FE+E E+ C YD +++YDG    AP +G+YCG+  P  + S   +++I F +DDT++ KGF  +Y + 
Sbjct:   45 EEFDYKDPCKAAAYWGDIAL-DEDDLRWFFK-----------------NKSN----DLRNTN-------------YNQTQPTTGRLKLLITEKPA-----TEIN----NTFQVQKSNDRVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYP--LGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA---GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI-VAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 978          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007882.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 417/869 (47.99%), Postives = 575/869 (66.17%), Query Frame = 3
Query:  864 RYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            R RRAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQRI LS GDI Q  KLY CP CG+TL +   NFS+P       +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR C      PIIS  S++WI +++ +     GF A Y+A+CGG+I    G+I SPNYP+ Y+P K+CIWKITV  G+ + L F++F+IE+HD C YD+LE+RDG  E   L+ + CGY+ P  IK+T+N+++IKF+SD S+ K GF+A F +E DEC    + GCS  CVNTLG+Y C C+ G+EL AD K CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ +  G  +  K  GK+CG + P+ ITS  N + + F SD+TV K+GFK+NF++D++EC   NG C+H CVNT GSY C C+ G+ LH    +CKE    GC  ++ +A G I SPN+P  YPS+  C W I  T GH ++L F+DFEIE HQEC YD L +YDG + K+  LGRFCGSK P P+ +  NS+ + F SD SVQR+GF+  +++ C G+L A  + + I+SHA +G   Y +  NC W++        V+L F  FE+E E+ C YD +++YDG    AP +G+YCG+  P  + S   +++I F +DDT++ KGF  +Y + 
Sbjct:   41 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYP--LGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA---GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI-VAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 900          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007804.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 417/869 (47.99%), Postives = 575/869 (66.17%), Query Frame = 3
Query:  864 RYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            R RRAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQRI LS GDI Q  KLY CP CG+TL +   NFS+P       +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR C      PIIS  S++WI +++ +     GF A Y+A+CGG+I    G+I SPNYP+ Y+P K+CIWKITV  G+ + L F++F+IE+HD C YD+LE+RDG  E   L+ + CGY+ P  IK+T+N+++IKF+SD S+ K GF+A F +E DEC    + GCS  CVNTLG+Y C C+ G+EL AD K CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ +  G  +  K  GK+CG + P+ ITS  N + + F SD+TV K+GFK+NF++D++EC   NG C+H CVNT GSY C C+ G+ LH    +CKE    GC  ++ +A G I SPN+P  YPS+  C W I  T GH ++L F+DFEIE HQEC YD L +YDG + K+  LGRFCGSK P P+ +  NS+ + F SD SVQR+GF+  +++ C G+L A  + + I+SHA +G   Y +  NC W++        V+L F  FE+E E+ C YD +++YDG    AP +G+YCG+  P  + S   +++I F +DDT++ KGF  +Y + 
Sbjct:   61 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYP--LGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA---GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI-VAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 920          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007792.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 417/869 (47.99%), Postives = 575/869 (66.17%), Query Frame = 3
Query:  864 RYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            R RRAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQRI LS GDI Q  KLY CP CG+TL +   NFS+P       +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR C      PIIS  S++WI +++ +     GF A Y+A+CGG+I    G+I SPNYP+ Y+P K+CIWKITV  G+ + L F++F+IE+HD C YD+LE+RDG  E   L+ + CGY+ P  IK+T+N+++IKF+SD S+ K GF+A F +E DEC    + GCS  CVNTLG+Y C C+ G+EL AD K CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ +  G  +  K  GK+CG + P+ ITS  N + + F SD+TV K+GFK+NF++D++EC   NG C+H CVNT GSY C C+ G+ LH    +CKE    GC  ++ +A G I SPN+P  YPS+  C W I  T GH ++L F+DFEIE HQEC YD L +YDG + K+  LGRFCGSK P P+ +  NS+ + F SD SVQR+GF+  +++ C G+L A  + + I+SHA +G   Y +  NC W++        V+L F  FE+E E+ C YD +++YDG    AP +G+YCG+  P  + S   +++I F +DDT++ KGF  +Y + 
Sbjct:   44 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYP--LGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA---GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI-VAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 903          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 436/991 (44.00%), Postives = 608/991 (61.35%), Query Frame = 3
Query:  507 KENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSP---IQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            ++   + DPCKA  F GDIAL D++ +++   D        + W   S +   H +  +                    +  W N       ++  +        F P          T   R RRA TS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+F+ +TCGCCSYVGRR    PQAISIGKNCDK GIV HELGHV+GFWHEHTRPDRD HV I+ EN+  GQ++NF KME+ EV SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQR+ LS GDI Q  KLY CP CG+TL + + NFS+P   N   +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR+C       ++S  SR+W+ +++ + S   GF A Y+A+CGG+I    G+I SPNYP+ Y+P+K+C+W+ITVP G+ + L F+SF+IE+HD+C YD+LEIRDG  E   L+   CGY+ P  +K++ N++++KF+SD S+ K GF A F +E DEC    H GC   CVNTLG+Y CACD GYEL AD KTCE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ V  G   + K  GK+CG + P+ ITS +N + + F SD+TV K+GF+ +F++D++EC   NG C+  CVNT GSY C CR GY+LH    +CKE    GC Y+I+ A G + SPN+P  YPS+  C W I +T GH +++TFS+FEIE HQEC YD L +YDG       LGRFCGSK P P+ +  +S+ + F SD SVQR+GF+   ++ C G+L A  + + ++SHA +G   Y     C W++        V+L F  FEVE E  C YD ++ YDG    AP +G++CG+     I S   +L+I F +DDT++ KGF A Y + 
Sbjct:   45 EQQLHYHDPCKAAVFWGDIAL-DEDDLKLFHID------KAEDWTKPSIDKPGHDTGGLEET-----------------SARWPNDTASNASIQAPRKDGKDATTFLPNPGTSNTTAKTFSARVRRATTSRTERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFSYRTCGCCSYVGRRGGG-PQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPN--GYPSYSHCVWRISVTPGEKIILNFTSMDLFKSRLCWYDYVEIRDGYWRKAPLLGRFCGDKIPESLVSSDSRLWVEFRSSSSSLGKGFFAVYEAMCGGDITKDAGQIQSPNYPDDYRPSKECVWRITVPDGFHVGLTFQSFEIERHDSCAYDYLEIRDGPTEDSTLIGHFCGYEKPEAVKSSANRLWVKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCVNTLGSYTCACDPGYELAADKKTCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPVQYRISLQFEAFELEGNDV-CKYDFVEVRSGLSPDAKLHGKFCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQQECVNTFGSYLCRCRNGYRLHENGHDCKEA---GCAYKISSAEGTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQHQECAYDHLELYDGTDSLAPILGRFCGSKKPDPVVATGSSLFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSQARCDWVI-VAEDGYGVELIFRTFEVEEEADCGYDFMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTST 1002          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 449/998 (44.99%), Postives = 618/998 (61.92%), Query Frame = 3
Query:  492 DELELKENFRFLDPCKANAFMGDIALTDDEKMRM--LERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            +E +  E   + DPCKA  F GDIAL DDE + +  ++R I L++         +    +H   K R         +L++  E              ++   S + +   M+     +L   + + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F  +RS ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E S N SSP   N   +     C WR+SVT GE++ LN +   + +S  C  +Y+E+RDG +  S L+GR+C       + S  SR+WI +++ +     GF A Y+A+CGGEI  +EG+I SPNYP+ Y+P K+C+WKI V  GY + L F++F+IE+HD+C YD LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K  + GC   C+NTLG+Y CAC+ GYEL  D ++CE ACGGL+ + NG++ +P +P  YPPNK C+W++IA  + +I   F  F++EG E  C+YDY+ ++ G  +  K  GK+CG   P+ +TS  N + I F SD+TV KKGFK +F++D++EC   NG C+H CVNT+GSY C CR G+ LH  K +CKE     C  +I    G I SPN+P  YPS+  C W I   PGH I L F++FE+E HQEC YD L ++DG + K+  LGR CGSK P P+ +  N + I F SD SVQR+GF+ T ++ C G+L A  +P+ ++SHA +G   Y    +C WLL +  +   ++L F  FEVE E  C YD V+++DG S  A  +G++CG+  P  I S     LIHF +DDT++ KGF   Y ++  P
Sbjct:   40 NEEDKTEPIDYKDPCKAAVFWGDIAL-DDEDLNIFQIDRTIDLTQSPFGKLGHITGGFGDHGMPKKR--------GALYQLIE-------------RIRRIGSGLEQNNTMKGKAPPKLSEQSEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFT-ERSDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESSGNLSSPGFPN--GYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAE---CEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVS-ERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSIRYP 1006          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 438/994 (44.06%), Postives = 608/994 (61.17%), Query Frame = 3
Query:  489 IDELELKENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + E +  E   + DPCKA AF+GDIA               L  E ++++Q +                  +L +   + P     K   NS     +    Q ++         +   R   R R RRAATS   R W  G+IP+ I  NF+   +A   +AMRHWE +TC++F+ +R+ + SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI PK      +P IGQR  LS GDI Q  KLY CP CG+TL + + NFSSPE  N   +S  + C WRISVT GE++ LN +   +  S  C  +Y+E+RDG +  + L GR+C      PI+S  SR+W+ +++ +     GF A Y+A+CGG++    G I SPNYP+ Y+P+K CIW+I V  G+ + L F+SF+IE+HD+C YD+LE+RDGH E   L+ + CGY+ P  IK+T++++++KF+SD S+ K GF   F +E DEC +  + GC   C+NTLG+Y C+CD GYEL  D + CE ACGG + + NGS+ SP +P  YPPNK CIW+++A  + +I   F  F+ EG +  C+YD++ V  G   + K  GK+CG + P+ ITS  N + + F SD+TV KKGFK +F++D++EC   NG C+  CVNT GSY C CR G+ LH  K +CKE    GC +++T   G I SPN+P  YPSK  C W I +TPGH ++LTF + +IES  EC YD L V+DG   K   LGRFCGSK P P+ +  N + + F SD SVQR+GF+ + ++ C G++ A  + + ++SHA +G   Y    +C W++    +   V+L F  FEVE E  C YD ++++DG    AP +G+YCG+  P  + S   ++L+ F SDDT+S KGF   Y + 
Sbjct:   39 LGEEDAPELLNYKDPCKAAAFLGDIA---------------LDEEDLRAFQVQQA---------------AVLRQQTARRPSI---KAAGNSSALGGQGTSGQPQR---------ESRGRWRGRPRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFL-ERTDEDSYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPN--GYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDV-CKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEA---GCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVI-VAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYTST 981          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 420/989 (42.47%), Postives = 594/989 (60.06%), Query Frame = 3
Query:  507 KENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSP---IQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            ++   + DPCKA  F GDIAL D++ +++   D        + W   S +   H +  +                    +  W N       ++  +        F P          T   R RRA TS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++F+ +R+ ++S+I+F+ +TCGCCSYVGRR    PQAISIGKNCDK GIV HELGHV+GFWHEHTRPDRD HV I+ EN+  GQ++NF KME+ EV SL E YD+ SIMHYA+ TFS      ++  K C  R    ++  L+               CG+TL + + NFS+P   N   +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR+C       ++S  SR+W+ +++ + S   GF A Y+A+CGG+I    G+I SPNYP+ Y+P+K+C+W+ITVP G+ + L F+SF+IE+HD+C YD+LEIRDG  E   L+   CGY+ P  +K++ N++++KF+SD S+ K GF A F +E DEC    H GC   CVNTLG+Y CACD GYEL AD KTCE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YD++ V  G   + K  GK+CG + P+ ITS +N + + F SD+TV K+GF+ +F++D++EC   NG C+  CVNT GSY C CR GY+LH    +CKE    GC Y+I+ A G + SPN+P  YPS+  C W I +T GH +++TFS+FEIE HQEC YD L +YDG       LGRFCGSK P P+ +  +S+ + F SD SVQR+GF+   ++ C G+L A  + + ++SHA +G   Y     C W++        V+L F  FEVE E  C YD ++ YDG    AP +G++CG+     I S   +L+I F +DDT++ KGF A Y + 
Sbjct:   45 EQQLHYHDPCKAAVFWGDIAL-DEDDLKLFHID------KAEDWTKPSIDKPGHDTGGLEET-----------------SARWPNDTASNASIQAPRKDGKDATTFLPNPGTSNTTAKTFSARVRRATTSRTERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFV-ERTDEESFIVFSYRTCGCCSYVGRRGGG-PQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFS------SLCSKVCELRGKTVRKEKLTAS---------RDAACGETLQDTTGNFSAPGFPN--GYPSYSHCVWRISVTPGEKIILNFTSMDLFKSRLCWYDYVEIRDGYWRKAPLLGRFCGDKIPESLVSSDSRLWVEFRSSSSSLGKGFFAVYEAMCGGDITKDAGQIQSPNYPDDYRPSKECVWRITVPDGFHVGLTFQSFEIERHDSCAYDYLEIRDGPTEDSTLIGHFCGYEKPEAVKSSANRLWVKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCVNTLGSYTCACDPGYELAADKKTCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPVQYRISLQFEAFELEGNDV-CKYDFVEVRSGLSPDAKLHGKFCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQQECVNTFGSYLCRCRNGYRLHENGHDCKEA---GCAYKISSAEGTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQHQECAYDHLELYDGTDSLAPILGRFCGSKKPDPVVATGSSLFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSQARCDWVI-VAEDGYGVELIFRTFEVEEEADCGYDFMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTST 985          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Cubn (cubilin (intrinsic factor-cobalamin receptor) [Source:MGI Symbol;Acc:MGI:1931256])

HSP 1 Score: 280.796 bits (717), Expect = 1.860e-76
Identity = 189/673 (28.08%), Postives = 310/673 (46.06%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA-----VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKH--DTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDG-SVQRRGFKIT-FNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCG---TSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            +CGK L E +    SP   N   +   ++C W I V  G+ + L  S F++    +C  +YLE+ D + + S  +GRYC ++    + S    I + + + +   + GF  +Y+A     VC  +   + GR+ SPN+P  Y  N  C+++ITV +   IAL F  F +E +    CV DF+EIRDG  E   L+   CG   P  I + +N+++++F SD+++  +GF+AY+                                             CGG +    G L SPNYP  Y  + +C WR+ AS+ +     F +F +E    +C  DY+ V+DGP  N + + K CG  PP PI S+ + + +   +D+  Q +GF+IN+                                     ++ C    +      +    G ++S NYP  Y     C W I  T G+ +  TF +F++E++  C+ D L +YDG     +++GR+CG   P P  +  + +++ F +DG     +GFK+  F   C G++  T      FS   Y   Y  N+ C+W +  +    ++QL    F+VE    C YD+++IY G    +P I Q C    ++ P  I+S    L I F +D +++ +GF A + AVP
Sbjct:  931 ECGKVLTESTGIIESPGHPN--VYPSGVNCTWHIVVQRGQLIRLVFSSFYLEFHYNCANDYLEVYDTIAQTS--LGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCV-DFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDTALTARGFSAYWDAS---------------------------------------STGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLE-HHPNCSLDYLAVFDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINY-------------------------------------RQTCDNVVI------VNKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDVENYVNCSTDYLELYDGP----QRIGRYCGENIPPPGATTGSKLIVVFHTDGVDSGEKGFKMHWFIHGCGGEMSGTMGS---FSSPGYPNSYPHNKECIWNIR-VAPGNSIQLTIHDFDVEYHASCKYDTLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFNASWRAVP 1507          

HSP 2 Score: 273.863 bits (699), Expect = 2.813e-74
Identity = 178/646 (27.55%), Postives = 298/646 (46.13%), Query Frame = 3
Query: 1491 LLEYSDNF---SSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCT-INYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDST-VQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCG---SKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLI 3395
            L +Y+DNF   SSP   N +  +   +C +RI+V   ++++L+ ++F + +      ++++EIRDG +E S LIG YC       IIS  +++W+R+K+       GF A + A    CGG +    G + SPNYP  Y  + +C W++    G    L+F+ F +E H  C  D+L + DG     RL++K+CG   P PI+++ + + +K  +D+  + +GF   ++Q                                      TC+N    ++ +++G L S NYP+ Y  +++C W I A+    + + F EFDVE    +C  DY+ +YDGP+    ++G+YCG+  P P  +T ++L + F++D     +KGFK++++                                            + GC  E++   G   SP YP +YP    C W I   PG+ IQLT  DF++E H  C YD L +Y G    + ++ + C    S  P+ + S  N + I F +D S+  RGF  ++ ++  G     +  +       Y   Y  N  C W+++ + +   V L    F++E  + C    +  YDGSS     +   CG   P    + SGN L 
Sbjct: 1049 LYDYTDNFGRLSSPNFPNNYPHN--WNCVYRITVGLNQQIALHFTDFALEDYFGPKCVDFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDTALTARGFSAYWDASSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHHPNCSLDYLAVFDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINYRQ--------------------------------------TCDNVV--IVNKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDVE-NYVNCSTDYLELYDGPQ----RIGRYCGENIPPPGATTGSKLIVVFHTDGVDSGEKGFKMHWF--------------------------------------------IHGCGGEMSGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVEYHASCKYDTLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFNASWRAVPGGCGGIFQVSRGEIHSPNYPNNYRANTECSWIIQ-VEKYHRVLLNITDFDLEATDSC----LMTYDGSSSANTRVATVCGRQQPPNSITSSGNSLF 1598          

HSP 3 Score: 268.855 bits (686), Expect = 1.260e-72
Identity = 208/754 (27.59%), Postives = 331/754 (43.90%), Query Frame = 3
Query: 1479 CGKTLLEYSD-NFSSPERENEWTFSGALDCQWRISVT--EGERVSLNISEFHIPESLDCTINYLEIRDGVYENSD--LIGRYCARAAIS-PIISKGSRIWIRYKNQAPSRNTGFVASYQAV-CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIA--SKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGP-ENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF-----------------------YTDRNEC---------------------EDKN---GECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG-------------------------CTYEITDAHGEIKSPNYPVT-YPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI------CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVE---PENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            CG TL   S  NFSSP       ++  LDC+W +S    E   +S++     +    DCT + LE R G   N+D  LI ++C+ +A   P++    ++WI + +      TGF   Y    CGG      G I SPNYP  Y    QC W +  P G++I L F  F +E H TC  D + +R+G      ++ + CG  +PGPI++ +NQ+ + F +++  + +GF A +                   NTLG                      CGG +   NG++ SP++P  +P N +C W  +   SK  +I F+ + F +   +  C+  ++ V++G  E N   L   CG   P PI +  N  T  F S+  +  +GF  +F                       Y +   C                     ED++   G C++  ++ I  +     P   + G +  +  T+DG                         C    +  +G + SP++  T YP+   C + +      +I L F+DFEI     C++D L V+DG SI N+ +G+FCGS  P  +KS +NS+ + F +D S   RG+K++F         C G L    +      H + G  Y+   NC+W +     +L V+L F  F +E      +CT+D V+I DG+S+ + + G++CG+S P    S    L + FVSD ++  +GF A Y  V  P
Sbjct: 2570 CGGTLPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLESHQDCTFDVLEFRVG---NADGPLIEKFCSLSAPRVPLVIPYPQVWIHFVSNERVEYTGFYVEYSFTNCGGIQTGENGVISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPTCTSDSVTVRNGDSPGSPIIGRYCGQSVPGPIQSGSNQLVVTFNTNNQGQSRGFYATWN-----------------TNTLG----------------------CGGTLHSDNGTIKSPHWPQTFPENSRCSWTAVTHESKHWEISFD-SNFRIPSSDSQCRNSFVKVWEGMLETNDALLATSCGNVAPSPIVTLGNIFTAVFQSEE-MPAQGFSASFISRCGRTFNSSTGDIVSPNFPKHYDNNMNCNYYIDVAPQSLVILTFVSFHLEDRSAVSGTCDYDGLHIIKGHNLSSTPLVTICGSETLRPLTIDGPVMLNFYSDAYITDFGFKISYRVANCGGIYSGTYGVLNSPSFSYTNYPNNVYCVYSLQVRNDRLILLRFNDFEIVPSNLCSHDYLEVFDGPSIGNRSIGKFCGSTLPQVIKSTNNSLTLLFKTDSSQTARGWKVSFRETIGPQQGCGGYLTEDSKSFVSPDHDSDGL-YDKGLNCIWYIIAPENKL-VKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMP 3277          

HSP 4 Score: 257.299 bits (656), Expect = 4.833e-69
Identity = 183/670 (27.31%), Postives = 292/670 (43.58%), Query Frame = 3
Query: 1473 PKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV-----CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLG--KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFI--FSHAAYGTPYNINQNCLWLLET-INQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLA 3452
            P+CG  L     + +SP       +    DC W + V+ G  ++       +    DC+ +YLEIRDG + +  ++G++C   +  P+ + G    I + + + + + GF  +Y        CGG    +EG ++ P     +  ++QC++ I+ P G  I + F   ++E    C + F+E+ D     + LL KICG +   PI++ +N ++I+   D+ V+K  F A +Q                                           ACGG ++   G + SP YP+ Y   + C W I    +  +  NFT+F + G    C  DYI +  GP +     G  K+CG   P  ITS  N L + F   S+++ +GF   F +++ EC                             GK              +T++ G I+SP +P  YPS  NC W I+   G +I+L FS F +E H  C  D L VYD  +I    LGR+CG   P  + S  +SI + F SD ++   GF I + +I    +   +        S   +   Y  N NC++ +   +NQQ+ +       E     +C  D V+I DG    +P+IG YCG+  P  I S S  L + F SD  ++A+GF A + A
Sbjct:  588 PECGGILTGNYGSITSPGYPGN--YPPGRDCVWNLLVSPGSLITFTFGTLSLESHNDCSKDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSDSETSDKGFHITYLTTPSDLYCGGNYTDTEGELLLPPLTGPFSHSRQCVYLISQPQGEQIVINFTHVELESQRGCSHTFIEVGD----HESLLRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRADYQV------------------------------------------ACGGELR-GEGVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQI-GSSSSCDTDYIEI--GPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMFSSEKLEC-----------------------------GKV-------------LTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYLEFHYNCANDYLEVYD--TIAQTSLGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCV-DFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDTALTARGFSAYWDA 1160          

HSP 5 Score: 244.588 bits (623), Expect = 5.320e-65
Identity = 174/636 (27.36%), Postives = 274/636 (43.08%), Query Frame = 3
Query: 1545 FSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESH--QECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            FS +  C + IS  +GE++ +N +   +     C+  ++E+ D    +  L+ + C    + PI S  + +WIR +  A  +   F A YQ  CGGE+   EG I SP YP  Y   + C W I+ P    + L F  F+I    +C  D++EI            K CG  IP  I +  N +Y+ F+  SS+E +GF A F  E  E                                       CG ++ ES G + SP +P+ YP    C W I+  +   I   F+ F +E    +C  DY+ VYD     Q  LG+YCGK  P  +TS+++ + + F SDS +  +GF IN+              E    +++                          C Y+ TD  G + SPN+P  YP   NC ++I       I L F+DF +E +   +C  D + + DG    +  +G +CGS  P  + S  N + + F SD ++  RGF   +++   G       P  + +   Y  PY  +  C W LE  ++     L+F  F +E    C+ D + ++DG S  + +I + CG + P  I S    +L+   +D     +GF+  Y
Sbjct:  728 FSHSRQCVYLISQPQGEQIVINFTHVELESQRGCSHTFIEVGD----HESLLRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRADYQVACGGELRG-EGVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMFSSEKLE---------------------------------------CGKVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYLE-FHYNCANDYLEVYDTIA--QTSLGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINY--------------EAINASSV--------------------------CLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCV-DFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDTALTARGFSAYWDASSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEA-SRGSPFLLEFQDFHLEHHPNCSLDYLAVFDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINY 1274          

HSP 6 Score: 242.276 bits (617), Expect = 3.208e-64
Identity = 177/640 (27.66%), Postives = 283/640 (44.22%), Query Frame = 3
Query: 1542 TFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSA-KGFKAEYL 3449
             ++G   C+W IS    E V LN ++F I  S  C  +Y+EI       S    ++C     S I S  + +++ +   +   N GF+A + +    CG  +  S G I SP +P  Y     C W I V  G  I L F SF +E H  C  D+LE+ D   +    L + CG  IP  + ++++ + + F+SDS++  +GF+  ++  +          S VC+             Y+                 ++ G L SPN+P+NYP N  C++RI      +I  +FT+F +E        D++ + DG       +G YCG   P  I S +N+L + F SD+ +  +GF                           +Y+                + +  GC   +T   G + SPNYP+ Y   S C W++  + G    L F DF +E H  C+ D L V+DG S  ++ + + CG   P P++S  + +L+   +D   Q RGF+I +   CD  +I  +    I     Y  PY+ +Q C W ++      TV   FL F+VE    C+ D +++YDG       IG+YCG ++P    +    L++ F +D   S  KGFK  + 
Sbjct:  835 AYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMFSSEKLECGKVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYLEFHYNCANDYLEVYDTIAQTS--LGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAIN---------ASSVCL-------------YDY---------------TDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCVDFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDTALTARGFS--------------------------AYW----------------DASSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHHPNCSLDYLAVFDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINYRQTCDNVVIVNKTSG-ILESINYPNPYDKDQRCNWTIQATTGN-TVNYTFLEFDVENYVNCSTDYLELYDGPQ----RIGRYCGENIPPPGATTGSKLIVVFHTDGVDSGEKGFKMHWF 1387          

HSP 7 Score: 241.506 bits (615), Expect = 4.586e-64
Identity = 190/665 (28.57%), Postives = 288/665 (43.31%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEI--HASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDS-SVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKP---PQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPV-PMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLA 3452
            CG  L   +   +SP     +  S   +C WR+  + G    L   +FH+    +C+++YL + DG   NS LI + C     +PI S    + ++ +  A  +  GF  +Y+  C   +  + + G + S NYP  Y  +++C W I    G ++   F  F +E +  C  D+LE+ DG     + + + CG  IP P  TT +++ + F +D     ++GF  ++           HGC                                GG +  + GS  SP YP++YP NK+CIW I  +    I     +FDVE     C+YD + +Y G + +  ++ + C + P   P  I+ST NEL I F +DS++  +GF  ++                              PG               GC      + GEI SPNYP  Y + + C W I     H + L  +DF++E+   C    L+ YDG+S  N ++   CG + P   + S  NS+ + F S  S Q RGF+  F   C   +I         S   Y   Y  NQNC W++E       + L F HF ++    CT D V+I DG    AP+ G+YCGTS+P  I S    L + FVSD      GF A Y A
Sbjct: 1165 CGGNLTTPTGVLTSPNYPMPYYHSS--ECYWRLEASRGSPFLLEFQDFHLEHHPNCSLDYLAVFDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINYRQTCDNVVIVNKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDVENYVNCSTDYLELYDG----PQRIGRYCGENIPPPGATTGSKLIVVFHTDGVDSGEKGFKMHW---------FIHGC--------------------------------GGEMSGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVE-YHASCKYDTLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFNASW---------------------------RAVPG---------------GCGGIFQVSRGEIHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDLEATDSC----LMTYDGSSSANTRVATVCGRQQPPNSITSSGNSLFVRFQSGSSSQSRGFRAQFRQECGAHIITDS--SDSISSPLYPANYPNNQNCTWIIEAQPPFNHIALSFTHFHLQSSTDCTRDFVEILDGRDSDAPVQGRYCGTSLPHPIISFGNALTVRFVSDSVYGFDGFHAIYSA 1733          

HSP 8 Score: 229.18 bits (583), Expect = 3.787e-60
Identity = 167/643 (25.97%), Postives = 274/643 (42.61%), Query Frame = 3
Query: 1542 TFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS--ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            T+   ++C W +   E + + +  + F +  + +C   YL+I DG       +GRYC       + S  + ++    ++   R  GF A ++A    CGG +  + G I SP YP  Y P + C+W + V  G  I   F +  +E H+ C  D+LEIRDG      +L K C      P++TT     I F SDS    +GF                   H+   T  + +                   CGG   ++ G L  P     +  +++C++ I   +  +I  NFT  ++E  ++ C + +I V D    ++  L K CG +   PI S +N + I    D+ VQK  F+ +                         Y   C  G +L G+                   G I+SP YP  Y  +  C W I   P  ++ L F+DF+I S   C  D + +   + + +    +FCG+  P  + S +N + +TF    S++ RGF   F+S  +  GK++   E   I     +   Y    NC W +     QL ++L F  F +E    C  D +++YD  ++    +G+YCG S+P  +TS S ++ + FVSD  ++ +GF   Y A+
Sbjct:  493 TYVHNVNCFWVVRTDEEKVLHITFTFFDLESASNCPREYLQIHDGDSSADFPLGRYCGSTPPQGVHSSANSLYFHLYSEYIKRGRGFTARWEAKLPECGGILTGNYGSITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTLSLESHNDCSKDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSDSETSDKGF-------------------HITYLTTPSDL------------------YCGGNYTDTEGELLLPPLTGPFSHSRQCVYLISQPQGEQIVINFTHVELE-SQRGCSHTFIEVGD----HESLLRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRAD-------------------------YQVAC--GGELRGE-------------------GVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMFSSEKLECGKVLT--ESTGIIESPGHPNVYPSGVNCTWHIVVQRGQL-IRLVFSSFYLEFHYNCANDYLEVYD--TIAQTSLGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAI 1042          

HSP 9 Score: 218.779 bits (556), Expect = 7.290e-57
Identity = 181/674 (26.85%), Postives = 281/674 (41.69%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARA-AISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIIS-PNYPEFYKPNKQCIWKITV-PIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITST-TNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI--------------CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            CG           SP   N   +    +C W I V +  RV LNI++F +  +  C + Y    DG    +  +   C R    + I S G+ +++R+++ + S++ GF A ++  CG  I       IS P YP  Y  N+ C W I   P    IAL F  F ++    C  DF+EI DG D    +  + CG  +P PI +  N + ++F+SDS     GF A +                                           +ACGG     +G  +SP YP +Y  N +C+W I +S    +  +F  F +E    +C  D++ + +G       +G+YCG   P   +S   + L + F SD +    GF+  F         KN                       + G  N            I   HG+I +P +P  YP  SN  W +     HII     + +IE    C YD L +YDG  I ++ +G +CG++      S  NS+   F+SD S   RGF + + ++              C G ++  + P F FS    G PY    +C+W++   +   TV+L  L  ++E +  C+YD + I DG S ++  +   CG S+P  I S    + I F SD +V+  GF A +
Sbjct: 1510 CGGIFQVSRGEIHSPNYPNN--YRANTECSWIIQVEKYHRVLLNITDFDLEATDSCLMTY----DGSSSANTRVATVCGRQQPPNSITSSGNSLFVRFQSGSSSQSRGFRAQFRQECGAHIITDSSDSISSPLYPANYPNNQNCTWIIEAQPPFNHIALSFTHFHLQSSTDCTRDFVEILDGRDSDAPVQGRYCGTSLPHPIISFGNALTVRFVSDSVYGFDGFHAIYSAS---------------------------------------TSACGGTFYTGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLE-NSLNCNKDFVEIREGNATGHL-MGRYCGNSLPGNYSSIEGHNLWVRFVSDGSGTGMGFQARF---------KN-----------------------IFGNDN------------IVGTHGKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTNCFYDSLKIYDGFDIHSRLIGTYCGTQRES-FSSSRNSLTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGGYMVTGDTPVFFFSPGWPG-PYGNGADCIWIIYAPDS--TVELNILSMDIEAQLSCSYDKLIIKDGDSRLSQQLAVLCGRSVPGPIRSTGEYMYIRFTSDGSVTGAGFNASF 2088          

HSP 10 Score: 213.772 bits (543), Expect = 2.580e-55
Identity = 175/655 (26.72%), Postives = 279/655 (42.60%), Query Frame = 3
Query: 1545 FSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVY--DFLEIRDGHDEQKRLL------SKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLI----KESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNF-TEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPV-TYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS---ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLL-IHFVSDDTVSAKGFKAEYLA 3452
            +    DC W I   +   V LNI    I   L C+ + L I+DG    S  +   C R+   PI S G  ++IR+ +       GF AS+Q  CGG +HA  G I SP YP+ Y PN  C W + V  G +IA+ FE  F+I+  D+     D+L +R+G D     L       + CG   P  + T++N+M+I+F+SD+S   QGF   +     E K++                                  ACGG I      S+G + SPNYP+NYP + +CIW + A     I   F  +F++E +  +C   Y+ + DG  +N   L K CG   P+   S+   + + F+++      GFK  +                                            ++  C   ++   G I+S  YP   Y +   C+W I   PGH + + F DF ++S   C  D + +++  +     LGR+CG+  P  + +  N   I F +DGSV   GF++ F S   +C G L     P   F+   Y  P    + C W +  +++   + L F +  +  +  C  + + +++G    +P + + C     T     SGN + + F +D +    GF A Y +
Sbjct: 2000 YGNGADCIWIIYAPD-STVELNILSMDIEAQLSCSYDKLIIKDGDSRLSQQLAVLCGRSVPGPIRSTGEYMYIRFTSDGSVTGAGFNASFQKSCGGYLHADRGIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRY-----EAKSL----------------------------------ACGGTIYIHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIE-ETPNCSASYLELRDGANSNAPVLSKLCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKY--------------------------------------------SIVSCGGTVSGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQSSPGCAKDFVEIWENHT-SGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQFKSSREVCGGDL---HGPTGTFTSPNYPNPNPHPRICEWTIN-VHEGRQIILTFTNLRLSTQQSCNTEHLIVFNGIRNNSPRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTS 2564          

HSP 11 Score: 211.846 bits (538), Expect = 8.457e-55
Identity = 173/653 (26.49%), Postives = 279/653 (42.73%), Query Frame = 3
Query: 1566 QWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV--------------CGGEIHASEGRII--SPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTE-FDVEGKEKDC-QYDYINVYDGPENNQKKL------GKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSD-FEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTP-YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            +W ++V     +   I E  I  + +C  + L+I DG   +S LIG YC     S   S+ S +  ++ + +     GF+  + AV              CGG +   +  +   SP +P  Y     CIW I  P   ++ L   S  IE   +C YD L I+DG     + L+ +CG  +PGPI++T   MYI+F SD SV   GF A FQ+                                          +CGG +    G + SP YP NY PN  C W ++      I  +F + F ++ ++  C Q DY+ + +GP+N+   L      G++CG   P  + ++ NE+ I F SD++   +GFKI +       E K+  C        G+ Y H                          ++ G + SPNYP  YP  + C W +    G  IQL F D F IE    C+   L + DGA+     L + CG   P    S    + + F ++G     GFK  ++ +  G  ++ +    +     Y T  Y  N  C W ++ +     + ++F  F ++    C  D V+I++ +     ++G+YCG S+P+ + + S    I FV+D +V+  GF+ ++
Sbjct: 1879 RWTVNVDSSHIIHGRILEMDIELTTNCFYDSLKIYDGFDIHSRLIGTYCGTQRESFSSSRNS-LTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGGYMVTGDTPVFFFSPGWPGPYGNGADCIWIIYAP-DSTVELNILSMDIEAQLSCSYDKLIIKDGDSRLSQQLAVLCGRSVPGPIRSTGEYMYIRFTSDGSVTGAGFNASFQK------------------------------------------SCGGYLHADRGIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRY-------EAKSLACG-------GTIYIH------------------------DANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVLSKLCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKYSIVSCGGTVSGDSG--VIESVGYPTRLYANNVFCQWHIQGLPGHY-LTIRFEDFNLQSSPGCAKDFVEIWE-NHTSGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQF 2445          

HSP 12 Score: 210.69 bits (535), Expect = 1.998e-54
Identity = 177/677 (26.14%), Postives = 283/677 (41.80%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIIS-KGSRIWIRYKNQAPSRNTGFVASYQAVCGGE-IHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTA-YFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSD-FEIESH-QECTY-DQLIVYDGASIKNKQLG------RFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS---ICDGKL-IATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFL-HFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
             CG T       F+SP    +  +    +C W I+ + G  + L+   F +  SL+C  +++EIR+G      L+GRYC  +      S +G  +W+R+ +       GF A ++ + G + I  + G+I +P +P  Y  N    W + V   + I  +     IE    C YD L+I DG D   RL+   CG Q      ++ N +  +F SDSS   +GF   +F  +           S+V + T+    C    GY +  D      + G      NG+               CIW II +  + +  N    D+E  +  C YD + + DG     ++L   CG+  P PI ST   + I F SD +V   GF  +F   +  C                        G  LH  +                  G I SP YP  Y    NC W ++   G  I + F   F+I++    C+  D L++ +G    +  LG      RFCG  TP  + +  N + I F SD S   +GFKI + +    C G + I         +   Y   Y  +  C+W+LE  + + ++QL+F   F +E    C+   +++ DG++  AP++ + CG ++P    S  G + + F ++      GFKA+Y  V
Sbjct: 1737 ACGGTFYTGDGIFNSPGYPED--YHSNTECVWNIASSPGNHLQLSFLSFQLENSLNCNKDFVEIREG-NATGHLMGRYCGNSLPGNYSSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGNDNIVGTHGKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTNCFYDSLKIYDGFDIHSRLIGTYCGTQRES-FSSSRNSLTFQFSSDSSKSGRGFLLEWFAVD----------VSNVTLPTIAPGACG---GYMVTGDTPVFFFSPGWPGPYGNGA--------------DCIW-IIYAPDSTVELNILSMDIE-AQLSCSYDKLIIKDGDSRLSQQLAVLCGRSVPGPIRSTGEYMYIRFTSDGSVTGAGFNASF---QKSC------------------------GGYLHADR------------------GIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRYEAKSLACGGTIYIHDANSDGYVTSPNYPANYPQHAECIWILEAPSGR-SIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVLSKLCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKYSIV 2334          

HSP 13 Score: 197.978 bits (502), Expect = 1.883e-50
Identity = 167/656 (25.46%), Postives = 280/656 (42.68%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNISEFHIPESLDCTI---NYLEIRDGVYENSDLIG------RYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA---VCGGEIHA----SEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKK-CIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVP--MKSQHNSILITFTSDGSVQRRGFKITFNS----ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQ-LTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTL-ITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            L+C W + V  G  ++++  +    ++ D +    +YL +R+G   +S  +G      R+C     S + +  + ++I++ +   +   GF   Y+A    CGG I+     S+G + SPNYP  Y  + +CIW +  P G SI L+FE  F IE+   C   +LE+RDG +    +LSK+CG+ +P    ++   MY+KF ++      GF A +                                            +CGG +   +G + S  YP+    N   C W I       +   F +F+++     C  D++ +++    +   LG+YCG   P  + +++N  +I F +D +V   GF++ F + R  C                        G  LHG                    G   SPNYP   P    CEW I    G  I LTF++  + + Q C  + LIV++G    + +L + C S+  V    KS  N++ + F +DGS    GF  ++ S    +C G L +     F          Y  N +C W L   N++  ++ + FL   +E    CT+D ++   G++   P+I ++C  S P + +      + IHFVS++ V   GF  EY
Sbjct: 2116 LNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRYEAKSLACGGTIYIHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVLSKLCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKYSIV-----------------------------------------SCGGTVSGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQ-SSPGCAKDFVEIWEN-HTSGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQFKSSREVC------------------------GGDLHGPT------------------GTFTSPNYPNPNPHPRICEWTINVHEGRQIILTFTNLRLSTQQSCNTEHLIVFNGIRNNSPRLQKLC-SRVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGTLPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLESHQDCTFDVLEFRVGNA-DGPLIEKFCSLSAPRVPLVIPYPQVWIHFVSNERVEYTGFYVEY 2684          

HSP 14 Score: 191.43 bits (485), Expect = 1.810e-48
Identity = 174/676 (25.74%), Postives = 281/676 (41.57%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPE----SLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQ-AVCGGEIHASEGRIISPNYPEFYKPNK-QCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXK--KCIWRIIASKKAKIFFNFTEFDVE--GKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSK-TPVPM-KSQHNSILITFTSDGSVQRRGFKITFN-SICDGKLIATEEPQFIFSHAAYGTP--YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            +CG+T    + +  SP       +   ++C + I V     V L    FH+ +    S  C  + L I  G   +S  +   C    + P+   G  + + + + A   + GF  SY+ A CGG    + G + SP++     PN   C++ + V     I L+F  F+I   + C +D+LE+ DG     R + K CG  +P  IK+TNN + + F +DSS   +G+   F++                  T+G                   +  CGG + E + S  SP++ S+   +K   CIW IIA +   +   F  F +E       C +DY+ + DG   N    G++CG   P P  S+ N LT+ F SD ++Q +GF   +      C                                        G TY  T       SP         S C W I   P   +Q+T    ++ S Q+C+   L + D       Q+ +FCG+  T +P+  S  ++ ++ F SD     R  ++ F   I D      E  Q   +  + G P  Y  N +C  +L    Q   + L F  F++E   QC  D +++ +GSS  +P++G+YC   +P  I SQS  L +HF SDD+ +  G++  + + P
Sbjct: 2919 RCGRTFNSSTGDIVSPNFPKH--YDNNMNCNYYIDVAPQSLVILTFVSFHLEDRSAVSGTCDYDGLHIIKGHNLSSTPLVTICGSETLRPLTIDGP-VMLNFYSDAYITDFGFKISYRVANCGGIYSGTYGVLNSPSFSYTNYPNNVYCVYSLQVRNDRLILLRFNDFEIVPSNLCSHDYLEVFDGPSIGNRSIGKFCGSTLPQVIKSTNNSLTLLFKTDSSQTARGWKVSFRE------------------TIGP------------------QQGCGGYLTEDSKSFVSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMPC----------------------------------------GGTYNATSMPQNTSSPQLSNIRRPFSTCTWVIEAPPHQQVQITVWKLQLPS-QDCSRSSLELQDSEQTNGNQVTQFCGANYTTLPVFYSSGSTAVVVFKSD--FLNRNSRVHFTYEIAD---CNREYNQAFGNLKSPGWPQGYANNLDCSIILRA-PQNHRISLFFYWFQLEDSRQCMNDFLEVRNGSSSSSPLLGKYCSNLLPNPIFSQSNELYLHFHSDDSDTHHGYEIIWASSP 3508          

HSP 15 Score: 171.4 bits (433), Expect = 2.808e-42
Identity = 154/640 (24.06%), Postives = 258/640 (40.31%), Query Frame = 3
Query: 1563 CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA---VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICG-YQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKK--AKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQ-PITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKF-LHFEV-EPENQCTYDSVKIYDGS-SVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLA 3452
            CQW I    G  +++   +F++  S  C  +++EI +  + +  L+GRYC  +  S + +  +   IR+       ++GF   +++   VCGG++H   G   SPNYP      + C W I V  G  I L F + ++    +C  + L + +G       L K+C    +    K++ N M + F +D S    GFTA +    D           VC                    G T  +  GG     N S    N   +Y  N  C W +    +  + I  +F    +E   +DC +D +    G   +   + K+C    P+ P+     ++ I F S+  V+  GF +                                            E +   C    T  +G I SPNYP  Y   + C W +    GH I LTFSDF +E+H  CT D + V +G S  +  +GR+CG   P P++S  N +++TF ++   Q RGF  T+N+   G                +   +  N  C W   T ++    ++ F  +F +   ++QC    VK+++G       ++   CG   P+ I +  GN+       + + A+GF A +++
Sbjct: 2363 CQWHIQGLPGHYLTIRFEDFNLQSSPGCAKDFVEIWEN-HTSGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQFKSSREVCGGDLHGPTGTFTSPNYPNPNPHPRICEWTINVHEGRQIILTFTNLRLSTQQSCNTEHLIVFNGIRNNSPRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDA----------VC--------------------GGTLPSVSGG-----NFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLE-SHQDCTFDVLEFRVG-NADGPLIEKFCSLSAPRVPLVIPYPQVWIHFVSNERVEYTGFYV--------------------------------------------EYSFTNCGGIQTGENGVISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPTCTSDSVTVRNGDSPGSPIIGRYCGQSVPGPIQSGSNQLVVTFNTNNQGQSRGFYATWNTNTLGCGGTLHSDNGTIKSPHWPQTFPENSRCSWTAVT-HESKHWEISFDSNFRIPSSDSQCRNSFVKVWEGMLETNDALLATSCGNVAPSPIVTL-GNIFTAVFQSEEMPAQGFSASFIS 2918          

HSP 16 Score: 170.244 bits (430), Expect = 5.783e-42
Identity = 143/565 (25.31%), Postives = 229/565 (40.53%), Query Frame = 3
Query: 1758 WIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRII--SPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            W  Y  Q P          QA CGG +  ++G     SPN  + Y  N  C W +       + + F  F +E    C  ++L+I DG       L + CG   P  + ++ N +Y    S+     +GFTA ++ +  EC                                       GG++  + GS+ SP YP NYPP + C+W ++ S  + I F F    +E    DC  DY+ + DGP ++   LGK+C      P+ +T     I F+SDS    KGF I + T                  T    YC                    G  Y  TD  GE+  P     +     C + I    G  I + F+  E+ES + C++  + V D  S+    L + CG++T  P++S  N++ I    D  VQ+  F+  +   C G+L      + +     Y   Y   + C W +    +++ V L F  F++   + C  D ++I   S + +P   ++CGT++P+ ITS    L + FV   ++  +GF A +
Sbjct:  462 WTGYYCQTP----------QAACGGILSGTQGTFAYQSPN--DTYVHNVNCFWVVRTDEEKVLHITFTFFDLESASNCPREYLQIHDGDSSADFPLGRYCGSTPPQGVHSSANSLYFHLYSEYIKRGRGFTARWEAKLPEC---------------------------------------GGILTGNYGSITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTLSLE-SHNDCSKDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSDSETSDKGFHITYLT------------------TPSDLYC--------------------GGNY--TDTEGELLLPPLTGPFSHSRQCVYLISQPQGEQIVINFTHVELESQRGCSHTFIEVGDHESL----LRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRADYQVACGGELRG----EGVIRSPFYPNAYAGRRTCRWTISQPPREV-VLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYNVLYVTFVKSSSMENRGFMAMF 925          

HSP 17 Score: 157.147 bits (396), Expect = 5.653e-38
Identity = 144/642 (22.43%), Postives = 253/642 (39.41%), Query Frame = 3
Query: 1563 CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY------QAVCGGEIHASEGRIISPNYPE--FYKPNKQCIWKITVPIGYSIALKFESFKIEKHDT---CVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTI-AFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI---CDGKLIATEEPQFIFSHAAYGTPYNINQNCLW-LLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGT-SMPTLITSQSGNLLIHFVSDDTVSAKGFK 3437
            C + + V     + L  ++F I  S  C+ +YLE+ DG    +  IG++C       I S  + + + +K  +     G+  S+      Q  CGG +       +SP++     Y     CIW I  P    + L F +F +E+  +   C +D+++I DG      L  + CG   P P  ++ N + ++F+SD S++ +GF A +      C               G Y                  NA       S+  L      +   P   C W I A    ++    T + ++   +DC    + + D  + N  ++ ++CG           N  T+  FYS  +     FK +F    +          HF                            +  C  E   A G +KSP +P  Y +  +C   +     H I L F  F++E  ++C  D L V +G+S  +  LG++C +  P P+ SQ N + + F SD S    G++I + S    C G L+  E    I ++  +   Y  N +C W ++    + L+V   FL   ++    C  + + +++G    +P  G +CG  ++     + S  + I F ++    + GF+
Sbjct: 3064 CVYSLQVRNDRLILLRFNDFEIVPSNLCSHDYLEVFDGPSIGNRSIGKFCGSTLPQVIKSTNNSLTLLFKTDSSQTARGWKVSFRETIGPQQGCGGYLTEDSKSFVSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMPCG--------------GTY------------------NATSMPQNTSSPQL-----SNIRRPFSTCTWVIEAPPHQQV--QITVWKLQLPSQDCSRSSLELQDSEQTNGNQVTQFCGA----------NYTTLPVFYSSGSTAVVVFKSDFLNRNSRV--------HFTYE-------------------------IADCNREYNQAFGNLKSPGWPQGYANNLDCSIILRAPQNHRISLFFYWFQLEDSRQCMNDFLEVRNGSSSSSPLLGKYCSNLLPNPIFSQSNELYLHFHSDDSDTHHGYEIIWASSPTGCGGTLLGNEG---ILANPGFPDSYPNNTHCEWTIVAPSGRPLSVGFPFL--SIDSPGGCDQNYLILFNGPDANSPPFGPFCGIDTVVAPFHASSNRVFIRFHAEYATVSSGFE 3618          

HSP 18 Score: 157.147 bits (396), Expect = 6.312e-38
Identity = 107/423 (25.30%), Postives = 180/423 (42.55%), Query Frame = 3
Query: 2202 VCVNTLGAYMCACD---IGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF-----NSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
             C++ +  + C C     GY  Q    T + ACGG++  + G+    +    Y  N  C W +   ++  +   FT FD+E    +C  +Y+ ++DG  +    LG+YCG  PPQ + S+ N L    YS+   + +GF   +                                          E  +  C   +T  +G I SP YP  YP   +C W ++ +PG +I  TF    +ESH +C+ D L + DG    +  LG+FC S +  P+++   +  I F SD     +GF IT+     +  C G    TE    +        P++ ++ C++L+     +  V + F H E+E +  C++  +++ D  S++     + CG      I S S N+ I    D  V    F+A+Y
Sbjct:  446 TCIDGVNGFTCDCTSSWTGYYCQ----TPQAACGGILSGTQGTFAYQSPNDTYVHNVNCFWVVRTDEEKVLHITFTFFDLE-SASNCPREYLQIHDGDSSADFPLGRYCGSTPPQGVHSSANSLYFHLYSEYIKRGRGFTARW------------------------------------------EAKLPECGGILTGNYGSITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTLSLESHNDCSKDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSDSETSDKGFHITYLTTPSDLYCGGNYTDTEGELLL---PPLTGPFSHSRQCVYLISQPQGEQIV-INFTHVELESQRGCSHTFIEVGDHESLLR----KICGNETLFPIRSISNNVWIRLRIDALVQKASFRADY 813          

HSP 19 Score: 153.68 bits (387), Expect = 8.105e-37
Identity = 134/550 (24.36%), Postives = 220/550 (40.00%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLD---CTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPV-PMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            CG  L E S +F SP+ +++  +   L+C W I   E + V L  + F + E      CT +Y++I DG   NS L GR+C  +  +P IS G+ + +++ +    +  GF A+Y  V   CGG  +A+       SP      +P   C W I  P    + +     ++   D C    LE++D        +++ CG          N      F S  S     F + F   +                            YE+ AD       C     ++ G+L SP +P  Y  N  C   + A +  +I   F  F +E   + C  D++ V +G  ++   LGKYC    P PI S +NEL + F+SD +    G++I +                                            +  GC   +    G + +P +P +YP+ ++CEW I+   G  + + F    I+S   C  + LI+++G    +   G FCG  T V P  +  N + I F ++ +    GF+I ++S
Sbjct: 3157 CGGYLTEDSKSFVSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMPCGGTYNATSMPQNTSSPQLSNIRRPFSTCTWVIEAPPHQQVQITVWKLQLPSQD-CSRSSLELQDSEQTNGNQVTQFCG---------ANYTTLPVFYSSGSTAVVVFKSDFLNRNSRVH----------------------FTYEI-AD-------CNREYNQAFGNLKSPGWPQGYANNLDCSIILRAPQNHRISLFFYWFQLE-DSRQCMNDFLEVRNGSSSSSPLLGKYCSNLLPNPIFSQSNELYLHFHSDDSDTHHGYEIIW------------------------------------------ASSPTGCGGTLLGNEGILANPGFPDSYPNNTHCEWTIVAPSGRPLSVGFPFLSIDSPGGCDQNYLILFNGPDANSPPFGPFCGIDTVVAPFHASSNRVFIRFHAEYATVSSGFEIMWSS 3623          

HSP 20 Score: 151.369 bits (381), Expect = 3.791e-36
Identity = 104/372 (27.96%), Postives = 165/372 (44.35%), Query Frame = 3
Query: 2361 KKCIWRIIASKKAK-IFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKS-QHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTP-----YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + C W I A      I  +FT F ++    DC  D++ + DG +++    G+YCG   P PI S  N LT+ F SDS     GF   +    + C               G++Y                               G   SP YP  Y S + C W I ++PG+ +QL+F  F++E+   C  D + + +G +     +GR+CG+  P    S + +++ + F SDGS    GF+  F +I     I       + +H    TP     Y +N N  W +  ++    +  + L  ++E    C YDS+KIYDG  + + +IG YCGT   +  +S++ +L   F SD + S +GF  E+ AV
Sbjct: 1645 QNCTWIIEAQPPFNHIALSFTHFHLQ-SSTDCTRDFVEILDGRDSDAPVQGRYCGTSLPHPIISFGNALTVRFVSDSVYGFDGFHAIYSASTSACG--------------GTFY----------------------------TGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLENSLNCNKDFVEIREGNA-TGHLMGRYCGNSLPGNYSSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGNDNI-------VGTHGKIATPFWPGNYPLNSNYRWTVN-VDSSHIIHGRILEMDIELTTNCFYDSLKIYDGFDIHSRLIGTYCGTQRESFSSSRN-SLTFQFSSDSSKSGRGFLLEWFAV 1963          

HSP 21 Score: 96.6709 bits (239), Expect = 1.905e-19
Identity = 86/306 (28.10%), Postives = 128/306 (41.83%), Query Frame = 3
Query: 2673 CVNTIGSYYCHCRPGYQLHGKKNCKEKT--------------VDG-------CTYEITD--------AHGEI----------KSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI---CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGT-SMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            C+ T+ SY+C C  G+     +NC E                +DG       CT   T         A G I          +SPN   TY    NC W + T    ++ +TF+ F++ES   C  + L ++DG S  +  LGR+CGS  P  + S  NS+     S+   + RGF   + +    C G L          +   Y   Y   ++C+W L  ++    +   F    +E  N C+ D ++I DG     P++G++C + S P L T+      IHF SD   S KGF   YL  P 
Sbjct:  409 CIETVSSYFCKCDSGWF---GQNCTENINECVSNPCLNGGTCIDGVNGFTCDCTSSWTGYYCQTPQAACGGILSGTQGTFAYQSPN--DTYVHNVNCFWVVRTDEEKVLHITFTFFDLESASNCPREYLQIHDGDSSADFPLGRYCGSTPPQGVHSSANSLYFHLYSEYIKRGRGFTARWEAKLPECGGILTGNYGS---ITSPGYPGNYPPGRDCVWNL-LVSPGSLITFTFGTLSLESHNDCSKDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPA-ARIHFHSDSETSDKGFHITYLTTPS 704          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|Q8JI28|TLL1_XENLA (Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1)

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 458/984 (46.54%), Postives = 625/984 (63.52%), Query Frame = 3
Query:  522 FLDPCKANAFMGDIALT-DDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + DPCKA  F GDIAL  +D KM  ++R I L++ S +     +     H   K R      L + + +   F   +E  N+   + K+  +Q  K  ++R                 RAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++FI +R+ ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ EN+  GQ++NF KME  EV SL E+YD+ SIMHYA+ TFS+     TI P       RPPIGQR  LS GDI Q  KLY CP CG+TL E + NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG ++ S L+GR+C       + S  SR+WI +++ +     GF A Y+A+CGGEIH   G+I SPNYP+ Y+P K+C+WKITV   Y++ L F++F+IE+HD C YD+LE+RDG  E   L+   CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC    + GC   CVNTLG+Y C+CD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GK+CG + P+ ITS  N + I F SD+TV KKGF+ +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C + I  ++G I SPN+P  YPS+  C W+I  TPGH ++L+FS+FEIE HQEC YD L V+DG + K+  LGR CGSK P P+ +  N + I F SD SVQR+GF+ T ++ C G+L A  +P+ +FSHA +G   Y +  +C W+L T  + L ++L F  FEVE E  C YD ++++DG    A  +G++CG+  P  I S    +LIHF +DDT+S KGF   Y +V
Sbjct:   45 YKDPCKAVVFWGDIALDEEDLKMFHIDRTIDLTQHSNEKLGHTTGGLEEHDLSKKR----GALYQLIERIRRFGSGQE--NTTANSQKVDNNQSGKSKKIRIP---------------RAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFI-ERTDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVHSLGESYDFDSIMHYARNTFSRGMFLDTILPSRDENGLRPPIGQRTRLSKGDIAQARKLYRCPACGETLQESTGNFSSPGFPN--GYPSYTHCIWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWKKSPLLGRFCGDKLPDVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKDAGQIQSPNYPDDYRPLKECVWKITVAENYNVGLTFQAFEIERHDNCAYDYLEVRDGSSENSPLIGHFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFLKEEDECARPDNGGCEQRCVNTLGSYKCSCDPGYELAPDKKSCEAACGGLLTKLNGTITTPAWPKEYPPNKNCVWQVVAPSQYRISMKFDYFELEGNEV-CKYDYVEVRSGLSSDSKLHGKFCGTEVPEVITSQFNNMRIEFKSDNTVSKKGFRAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFVLHDNKHDCKEAE---CEHRIHSSNGVITSPNWPDKYPSRKECTWEISATPGHRVKLSFSEFEIEQHQECAYDHLEVFDGETEKSSILGRLCGSKVPEPLVATGNEMFIRFVSDASVQRKGFQATHSTECGGRLKAEAKPRDLFSHAQFGDNNYPVQADCEWILMT-ERGLRIELNFQTFEVEEEADCGYDFMELFDGHDASAMRLGRFCGSGPPEEIVSTGDAVLIHFHTDDTISKKGFHIRYRSV 998          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|Q9DER7|TLL1_CHICK (Tolloid-like protein 1 OS=Gallus gallus OX=9031 GN=TLL1 PE=2 SV=1)

HSP 1 Score: 873.618 bits (2256), Expect = 0.000e+0
Identity = 456/995 (45.83%), Postives = 628/995 (63.12%), Query Frame = 3
Query:  495 ELELKENFRFLDPCKANAFMGDIALTD-DEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            E +  E   + DPCKA  F GDIAL D D K+  ++R I L++ S +      +N+     H + +K   +         + ++    + S ++    + +  +  T ++FS          + R+ RAATS   R W  G+IPY I  NF+   +A   +AMRHWE YTC++FI +RS ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E + NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  S L+GR+C       + S  SR+WI +++ +     GF A Y+A+CGGEIH +EG+I SPNYP+ Y+P K+C+WKITV   Y++ L F++F+IE+HD C YD+LEIRDG +E   L+   CGY  P  I++T+N +++KF+SD +V K GF A F +E   C+    GC   CVNTLG+Y CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ +  G  ++ K  GK+CG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NT+GSY C CR G+ LH  K +CKE     C  +I   +G I SPN+P  YPS+  C W+I  TPG  ++LTF++FEIE HQEC YD L V+DG S K+  LGR CGSK P P+ +  N + + F SD SVQR+GF+ T ++ C G+L A  +P+ ++SHA +G   Y +  +C WLL    +   V+L F  FEVE E  C YD V+++DG    A  +G++CG+  P  I S    LL+HF +DDT++ KGF   Y ++  P
Sbjct:   37 EEDKAEAIDYKDPCKAAVFWGDIALDDEDLKIFQIDRTIDLTQHSNERL---GHNTGGFGEHGMSKKRGALY--------QLIERIRRFGSGFE----QNNTSKGRTTVKFSG------KNEKNRFPRAATSRTERIWPGGVIPYVIGGNFTGTQRAMFKQAMRHWEKYTCVTFI-ERSDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESTGNFSSPGFPN--GYPSYTHCIWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLASSDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKNEGQIQSPNYPDDYRPMKECVWKITVSENYNVGLTFQAFEIERHDNCAYDYLEIRDGMNENSPLIGHFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEMMCQPDNGGCEQRCVNTLGSYQCACDPGYELGPDKKSCEAACGGLLTKLNGTIPTPGWPKEYPPNKNCVWQVVAPTQYRISMKFEFFELEGNEV-CKYDYVEIRSGLSSDSKLHGKFCGTEVPEVITSQYNNMRIEFRSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRNGFVLHENKHDCKEAE---CEQKIHSPNGIIMSPNWPDKYPSRKECTWEISATPGQRVKLTFNEFEIEQHQECAYDHLEVFDGESEKSPILGRLCGSKIPEPLIATGNKMFLRFISDASVQRKGFQATHSTECGGRLKAETKPKDLYSHAQFGDNNYPVQADCDWLL-VAERGYRVELMFQTFEVEEEADCGYDYVELFDGHDKTAMRLGRFCGSGPPEEIYSAGETLLLHFHTDDTINKKGFHIRYRSIKYP 1001          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|O57382|TLL2_XENLA (Tolloid-like protein 2 OS=Xenopus laevis OX=8355 GN=tll2 PE=2 SV=1)

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 448/990 (45.25%), Postives = 618/990 (62.42%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQR---LKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E F + DPCKA A+ GDIAL +D+   + +               +SN+  N       R N T      F E     ++   +S   + K+K     KL     +  +     +  T+  R RRAATS   R W  GIIPY I  NF+   +A   +AMRHW+ +TC++F+ +R+ ++S+I+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV SL E YD+ SIMHYA+ TFS+     TI P+      RP IGQRI LS GDI Q  KLY CP CG+TL + S NFS+P   +   +     C WRISVT GE++ LN +   + +S  C  +Y+EIRDG +  + L+GR C      PIIS  S++WI +++ +     GF A+Y+A+CGG+I    G+I SPNYP+ Y+P K+CIWKITV  G+ + L F++F+IE+HD C YD+LE+RDG  E   L+ + CGY+ P  IK+T+N+++IKF SD S+ K GF+A F +E DEC    + GCS  CVNTLG+Y C C+ G+EL AD K+CE ACGG I + NG++ SP +P  YP NK C+W+++A  + +I   F  F++EG +  C+YDY+ +  G  +  K  GK+CG + P+ ITS  N + I F SD+TV KKGFK NF++D++EC   NG C+H CVNT GSY C C+ G+ LH    +CKE    GC  ++ +A G I SPN+P  YPS+  C W I  T GH ++L F+DFEIE HQEC YD L +YDG + K   LGRFCGSK P P+ +  N++ + F SD SVQR+GF+  ++  C G+L A  +   I+SHA +G   Y +  NC W++        V+L F  FE+E E+ C YD +++YDG    AP +G+YCG+  P  + S   +++I F +DDT++ KGF  +Y + 
Sbjct:   48 EEFDYKDPCKAAAYWGDIALDEDDLKWIFKN--------------KSNDLRN------TRHNQTHPTTDNFSEKLGTGSQNETSSNLNSKKVKKGSRLKLLIAEKAATETNSTFQVQTSNDRVRRAATSRTERIWPGGIIPYAIAGNFTGTQRAIFKQAMRHWKKHTCVTFV-ERTDEESFIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSSGNFSAPGYPS--GYPSYTHCIWRISVTPGEKIILNFTTMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPDPIISSDSKLWIEFRSSSNILGKGFFAAYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFASDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKSCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDYLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRIEFKSDNTVSKKGFKANFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA---GCEQKLLNAEGTISSPNWPEKYPSRKECTWDISVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKAAILGRFCGSKEPSPVVASTNNMFLRFYSDASVQRKGFQAKYSPECGGRLKAEIQTNDIYSHAQFGDNNYPVQSNCEWVI-VAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 1008          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|O43897|TLL1_HUMAN (Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 452/998 (45.29%), Postives = 625/998 (62.63%), Query Frame = 3
Query:  492 DELELKENFRFLDPCKANAFMGDIALTDDEKMRM--LERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA--CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            +E +  E   + DPCKA  F GDIAL DDE + +  ++R I L++    +    +    +H   K R         +L++  + ++   +      T+K K             P+Q       + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE +TC++FI +RS ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E + N SSP   N   +     C WR+SVT GE++ LN +   + +S  C  +Y+E+RDG +  S L+GR+C       + S  SR+WI +++ +     GF A Y+A+CGGEI  +EG+I SPNYP+ Y+P K+C+WKITV   Y + L F+SF+IE+HD C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K  + GC   C+NTLG+Y CAC+ GYEL  D ++CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ ++ G  +  K  GK+CG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H CVNT+GSY C CR G+ LH  K +CKE     C  +I    G I SPN+P  YPS+  C W+I  TPGH I+L FS+FEIE HQEC YD L V+DG + K+  LGR CG+K P P+ +  N + + F SD SVQR+GF+ T ++ C G+L A  +P+ ++SHA +G   Y    +C WLL +  +   ++L F  FEVE E  C YD V+++DG    A  +G++CG+  P  I S   ++LIHF +DDT++ KGF   Y ++  P
Sbjct:   40 NEEDKTETIDYKDPCKAAVFWGDIAL-DDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKR--------GALYQLIDRIRRIGFGLEQNNTVKGK------------VPLQ-FSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFI-ERSDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPN--GYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAE---CEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVS-ERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYP 1006          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|O57460|TLL1_DANRE (Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1)

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 446/987 (45.19%), Postives = 612/987 (62.01%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E   + DPCKA  F GDIAL DDE ++M   D  +  +  Q+   + + S     H   +K  ++    L      +  + W  +  K +    + IR++   R            + R  RAATS   + W  G+IPY I  NF+   +A + +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  +V+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       ++S  SR+WI +++ +     GF A Y+A+CGGEI    G+I SPNYP+ Y+P+K+C+W+ITV  GYS+ L F+ F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C ++I    G I SPN+P  YPS+  C W I  TPGH ++++F++FEIE HQEC YD L  +DG S K   L R CG+K P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+        ++L F  FEVE E  C YD +++YDG    A  IG++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   49 ETIDYKDPCKAAVFWGDIAL-DDEDLKMFHIDGTIDLKQ-QTHGRQGHTSGGLGEHVPTKKRGSLY--LLLDRIRRLGFESWPVNSSKDVSSIKTGIRRVNSAR----------NVKSRVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEV-CKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAE---CEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-VAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: G4VQ02 (Metalloendopeptidase OS=Schistosoma mansoni OX=6183 GN=Smp_134430 PE=4 SV=1)

HSP 1 Score: 1144.8 bits (2960), Expect = 0.000e+0
Identity = 549/984 (55.79%), Postives = 698/984 (70.93%), Query Frame = 3
Query:  654 NSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRH--TNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPER----ENEWTFSGALDCQWRISVTEGERVSLNISEF-----------HIPESLD-----------------CTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP---KPHKNAKDSQT 3491
            + SN +  + +R+ + +L     K   + Q K    ++   ++L  S  +K   + F+P QR ++    +++R +RAAT++  RTWT+G+IPY IQANFSSETKATIMKAMRHWENYTCLSF+ ++   +SYIIFTEK CGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRD+HVDILL+NVV GQDFNFKKM+  EV+SL E YDY SIMHYAKGTF+KANK+ TIRPKACCPRPPIGQRI LSPGDIRQTNKLY CP CG+TLLE   + SSP+     E+ +  S  L CQWRI+   GER+ LN +             H P +L+                 C  +Y+EIRDG Y  S LIGRYC +     +IS GSR+W+ Y+  A S  TGF+A Y+A+CGGE+   EG + SPNYPEFY+P+K+C+W+I VP+GYS+AL F SF++EKHDTCVYD+LE+RDG  +   LL K+CG  +P PIK+TNN MY+KF+SDSSVEKQGFTA FQ+E DECK MKHGCSH CVNTLG Y C C+IGYEL ADGK CE+ACGG+I ESNG++ +P +P  YPP K CIW+I+A  K  IF NFT F++EG    C+YD+INVY+G  +NQ+K+G +CG + P+PITS TNEL+I FYSD++VQ+ GF+  F+TDR+EC D NG C+H C NTIGSY+C CRPG+ L+G+  CKE    GC  +I+   GEI +PN+P  YP K NC WKI  TPGH +++ F+DFE+ESHQ+CTYDQ+I YDG +  +  LG++CGS+ P P+ S  N +L+TF SD SVQR+GF+    +IC G L A    Q ++SHA +G   Y  NQ C W +       TV LKFL+FEVE E  CTYD ++++DG      ++G +CG ++P    S SG L + FVSDDT+  KGF+A+Y  +P   K  K+  DSQ 
Sbjct:  263 DQSNKFGQRWQRRRNELL-----KRRRYNQLKAETQAF---IQLNKSYQQKADILMFTPEQRKRKEFSQSKRRSKRAATAYVSRTWTNGVIPYIIQANFSSETKATIMKAMRHWENYTCLSFVERQPHHRSYIIFTEKACGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDEHVDILLDNVVEGQDFNFKKMDPGEVNSLGEPYDYSSIMHYAKGTFAKANKDETIRPKACCPRPPIGQRIQLSPGDIRQTNKLYLCPACGRTLLEPVGSLSSPQMAWKLEDRFGASPIL-CQWRINAASGERIRLNFTHMDISGPITQDSIHTPNNLNDLHKAYELNQKSINRISCINDYVEIRDGYYSGSPLIGRYCGQNLPPQLISTGSRLWLEYRRSAGSMTTGFIADYEAICGGELQMEEGTLTSPNYPEFYRPSKECVWQIIVPVGYSVALIFHSFQLEKHDTCVYDYLEVRDGLKDTSPLLKKLCGSHLPTPIKSTNNVMYVKFVSDSSVEKQGFTATFQKEFDECKTMKHGCSHTCVNTLGGYRCQCEIGYELHADGKRCEDACGGVINESNGTIQTPLFPDLYPPKKNCIWKILAPPKTTIFLNFTHFNLEGHNVTCRYDFINVYNGSTDNQQKIGTFCGDQIPEPITSHTNELSIEFYSDTSVQRTGFRAVFFTDRDECADNNGGCQHLCRNTIGSYHCACRPGFNLYGRYECKENIKTGCQQDISSPDGEIITPNWPNEYPVKQNCHWKITVTPGHRVKVIFADFELESHQQCTYDQVIAYDGPTNSSAFLGQYCGSRKPGPIISSQNQLLLTFNSDSSVQRKGFRAQHTTICGGHLTADSVAQTLYSHAKFGDLDYESNQQCYWTITPKLDNHTVLLKFLYFEVEEETLCTYDYLRVFDGGDPKGKLLGGFCGRTLPNTFLSNSGQLYLQFVSDDTIGGKGFQAQYQMIPYDFKLPKHEIDSQV 1237          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A1S3HHT9 (Metalloendopeptidase OS=Lingula unguis OX=7574 GN=LOC106155400 PE=4 SV=1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 475/994 (47.79%), Postives = 640/994 (64.39%), Query Frame = 3
Query:  513 NFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA---CCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPER-ENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCT-------INYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKN-QAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVM-APMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYL 3449
            N  ++DPCK  AF+GDIAL   E ++ L++ I   RE  +S  P  ++       K+ +    +    L K      +K+  N + +       Q       R     R K+  +   ++RAAT+   R W +G+IPY I ANFS + KA   +AMRHWEN+TC++F+ K   D +YI+FTE+ CGCCS+VG+R  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD +V I+ EN++ GQ++NF K+ + EV+SL E YD+ SIMHYA+ TFS+     TI P+       RP IGQRI LS GDI Q  KLY CP CG+TL E S  F SP+   NE        C+WRIS T GE++ LNI+   IP S +C         +++EIRDG Y  S LIGRYC     + I+S  SR+WIRY+     S + GF A Y+AVCGGEI   +G + S NYP+ YKPNK+C+WKITVP  YS+A+KF+SF+IE HD C YD+LEIRDGH++  +L+ K CGY+IP  IK+T+N++YIKF+SD SV+K GF+A F +E+DEC    HGC+H C NTLG++ C C IGYEL +DGK CE+ACGG I+E NG++ SP++P  YP NK C+W+I+A  + +I  NFT FD+EG  +DC+YD + V  G E +   LG +CG   P P+TS  N L I F SD++VQK GF   F+TD++EC   NG C+H C NT+GSY C C  GYQLH  K +CKE    GC++EI    GEI SP++P  YP++ NC W   T PGH ++LTF +F++E HQECTYD + ++DG   K + LGR+CG   P P+ S  N I + F SD SVQR+GFK+   ++C G+L+AT +   ++SHA +G   YN   +C W+++   +   V+L+FL FEVE E+ C YD V+++DG        +G+YCG  +P    S    L + F SDDT++ KGF A YL
Sbjct:   40 NDLYMDPCKVGAFIGDIALAK-EDIQFLKQIIDNKREPPKSV-PVISSHRGEEGKKLHKNISKLTRSRLHKSKR--GSKKPRNKHRR-------QRNHRKRHRKHGHSRTKKQMHHSVHKRAATARPERLWDYGVIPYEINANFSGQHKALFKQAMRHWENHTCVTFVEKTDEDYNYILFTERPCGCCSFVGKRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDKNVQIIYENIMPGQEYNFNKLSAAEVNSLGEPYDFASIMHYARNTFSRGTYLDTILPRRDSDTLTRPEIGQRIKLSSGDIAQAKKLYRCPICGRTLQESSGKFDSPQHVPNEQQI-----CEWRISATHGEKIVLNITAMDIPFSANCQEGDYVDRTDHVEIRDGHYAESPLIGRYCGNNLPATIVSSDSRMWIRYRALPGTSNHQGFTAQYEAVCGGEIFKEQGHLSSSNYPDDYKPNKKCVWKITVPEPYSVAVKFQSFEIENHDNCQYDYLEIRDGHEDTSKLIGKFCGYKIPDSIKSTSNKIYIKFVSDGSVQKPGFSAQFVKEYDECATEDHGCAHECENTLGSFKCQCHIGYELHSDGKQCEDACGGYIEELNGTIQSPSFPDLYPINKNCVWQIVAPAQYRISLNFTHFDLEGNNQDCEYDSVEVRSGFETDSNLLGVFCGSTLPMPLTSEGNSLRIEFNSDNSVQKTGFLATFFTDKDECAVDNGGCQHICKNTVGSYQCACNNGYQLHENKHDCKE---GGCSHEIVTPEGEITSPDWPSHYPARKNCVWHFTTKPGHRVKLTFVEFQLEPHQECTYDHIELFDGDDDKARSLGRYCGHNNPEPVVSSSNRIFMVFFSDASVQRQGFKVAHTTVCGGRLLATSKEHNLYSHAKHGDVNYNNKADCDWVIQA-KEGYRVRLRFLTFEVEEESDCGYDHVELFDGEETSEVNRVGKYCGNELPPEYISTGEYLTLRFRSDDTINWKGFSATYL 1012          

HSP 2 Score: 290.426 bits (742), Expect = 4.983e-78
Identity = 187/597 (31.32%), Postives = 286/597 (47.91%), Query Frame = 3
Query: 1821 VCGGEIHASEGRIISPNYPEFYKPNKQ--CIWKITVPIGYSIALKFESFKIEKHDTCV-------YDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMS-DSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGK-KNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIE-SHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF--------------NSICDGKLIATE--------------------------EPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            +CG  +  S G+  SP +     PN+Q  C W+I+   G  I L   +  I     C         D +EIRDGH  +  L+ + CG  +P  I +++++M+I++ +   +   QGFTA +                                          E  CGG I +  G L S NYP +Y PNKKC+W+I   +   +   F  F++E  + +CQYDY+ + DG E+  K +GK+CG K P  I ST+N++ I F SD +VQK GF   F  + +EC  ++  C H C NT+GS+ C C  GY+LH   K C+    D C   I + +G I+SP++P  YP   NC W+I+    + I L F+ F++E ++Q+C YD + V  G    +  LG FCGS  P+P+ S+ NS+ I F SD SVQ+ GF  TF                IC   + + +                           P+   +   + + Y   +NC+W   T      V+L F+ F++EP  +CTYD ++++DG    A  +G+YCG + P  + S S  + + F SD +V  +GFK  +  V
Sbjct:  352 ICGRTLQESSGKFDSPQH----VPNEQQICEWRISATHGEKIVLNITAMDIPFSANCQEGDYVDRTDHVEIRDGHYAESPLIGRYCGNNLPATIVSSDSRMWIRYRALPGTSNHQGFTAQY------------------------------------------EAVCGGEIFKEQGHLSSSNYPDDYKPNKKCVWKITVPEPYSVAVKFQSFEIENHD-NCQYDYLEIRDGHEDTSKLIGKFCGYKIPDSIKSTSNKIYIKFVSDGSVQKPGFSAQFVKEYDECATEDHGCAHECENTLGSFKCQCHIGYELHSDGKQCE----DACGGYIEELNGTIQSPSFPDLYPINKNCVWQIVAPAQYRISLNFTHFDLEGNNQDCEYDSVEVRSGFETDSNLLGVFCGSTLPMPLTSEGNSLRIEFNSDNSVQKTGFLATFFTDKDECAVDNGGCQHICKNTVGSYQCACNNGYQLHENKHDCKEGGCSHEIVTPEGEITSPDWPSHYPARKNCVWHF-TTKPGHRVKLTFVEFQLEPHQECTYDHIELFDGDDDKARSLGRYCGHNNPEPVVSSSNRIFMVFFSDASVQRQGFKVAHTTV 896          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A2T7PWN1 (Metalloendopeptidase OS=Pomacea canaliculata OX=400727 GN=C0Q70_00431 PE=4 SV=1)

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 444/872 (50.92%), Postives = 584/872 (66.97%), Query Frame = 3
Query:  864 RYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK---ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            R +RAAT+ K R W +GIIPY I+ANF+   KA    AMRHWEN+TC++F+ ++  D++YI+FTE++CGCCS+VG+R  +  QAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ +N++ GQ++NF K+ + +V+SL E YDY SIMHYA+ TF++ N   TI P+       RP IGQR+ LSPGDIRQ NKLY CPKCG+TL + S  FS      +        CQWRIS T GE++ LNI+E  IP+S +C ++YLE+RDG Y  S L+GR+C       +IS  +R+WI Y+  +     GF A Y+A+CGGEI+  +G + SPNYP+ Y+PNK CIWKI+V  GYS+ALKF+SF+IE HD CVYD+LE+RDG +E   LL + CGY+IP  IK++ N++Y+KF+SD S              DEC    HGC H+CVNTLG+Y C C IGYEL +DGK CE+ACGG I E  G L SP++P  YPPNK C+W+I+A  + KI  NFT FD+EG  +DC+YD + +  G   +QK  G +CG   P P+TS  N L I F SD++VQK GF   F TD++EC   NG C+H C NT+GSY C C  G+ LH    +CKE    GC YEI    G I SPN+P  YP++ +C W   T PGH I+LTF +F +E HQECTYD ++++DG     + LG FCG  TP P+ S  NS+ + F SD SVQR+GF+  + S+C G L+AT  PQ I+SHA YG   Y+   +C W L+  +    +QLKF  FE+E E++C YD+V +YDG S   P+IG YCG+ +P  I S    L IHF +DD++  KGF A Y+    P
Sbjct:  199 RGKRAATARKDRLWDYGIIPYDIEANFTGANKAMFKLAMRHWENHTCVTFVERKPDDENYILFTERSCGCCSFVGKRG-NGAQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVQIIYKNIMPGQEYNFNKLTATDVNSLGEVYDYGSIMHYARNTFARNNYLDTILPRRKPGMVVRPEIGQRVKLSPGDIRQANKLYRCPKCGRTLQDSSGKFSQQASVGKEEL-----CQWRISATHGEKIVLNITELDIPKSYNCEMDYLEVRDGYYIKSPLLGRFCGNKLPETLISSDTRMWIEYRT-SRGGGKGFFAEYEAICGGEINKDQGFLTSPNYPDDYRPNKDCIWKISVEEGYSVALKFQSFEIENHDNCVYDYLEVRDGSEESSPLLGRYCGYKIPDDIKSSGNKLYVKFVSDGSF-------------DECTVSNHGCDHICVNTLGSYKCECRIGYELHSDGKRCEDACGGYIDEEEGILQSPSFPDLYPPNKNCVWQIVARDQYKITINFTHFDLEGHNQDCEYDSVRLSSGVGEDQKLHGVFCGATFPAPVTSEGNTLRIEFNSDNSVQKTGFVAEFRTDKDECAINNGGCQHVCRNTVGSYQCACYNGFTLHENNHDCKEG---GCQYEINKPEGIITSPNWPNFYPARKDCVWHFTTKPGHRIKLTFREFGLEPHQECTYDHVVLFDGDDNNARSLGLFCGGATPDPITSSGNSMYMVFYSDASVQRKGFEAEYESVCGGHLVATATPQMIYSHAKYGDLNYDNRADCEWRLQA-DTGFRIQLKFRAFELEDEHECAYDAVSVYDGQSETDPLIGTYCGSEIPPDIVSNGEYLTIHFRTDDSIHWKGFYATYVLTEAP 1046          

HSP 2 Score: 261.151 bits (666), Expect = 3.416e-68
Identity = 173/564 (30.67%), Postives = 256/564 (45.39%), Query Frame = 3
Query: 1902 CIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGK-KNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESH-QECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICD----------------------------------------GKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPH 3467
            C W+I+   G  I L      I K   C  D+LE+RDG+  +  LL + CG ++P  + +++ +M+I++ +     K  F  Y                                           E  CGG I +  G L SPNYP +Y PNK CIW+I   +   +   F  F++E  + +C YDY+ V DG E +   LG+YCG K P  I S+ N+L + F SD +              +EC   N  C+H CVNT+GSY C CR GY+LH   K C+    D C   I +  G ++SP++P  YP   NC W+I+    + I + F+ F++E H Q+C YD + +  G     K  G FCG+  P P+ S+ N++ I F SD SVQ+ GF   F +  D                                        G      +P+ I +   +   Y   ++C+W   T      ++L F  F +EP  +CTYD V ++DG    A  +G +CG + P  ITS   ++ + F SD +V  KGF+AEY +V   H
Sbjct:  429 CQWRISATHGEKIVLNITELDIPKSYNCEMDYLEVRDGYYIKSPLLGRFCGNKLPETLISSDTRMWIEYRTSRGGGKGFFAEY-------------------------------------------EAICGGEINKDQGFLTSPNYPDDYRPNKDCIWKISVEEGYSVALKFQSFEIENHD-NCVYDYLEVRDGSEESSPLLGRYCGYKIPDDIKSSGNKLYVKFVSDGSF-------------DECTVSNHGCDHICVNTLGSYKCECRIGYELHSDGKRCE----DACGGYIDEEEGILQSPSFPDLYPPNKNCVWQIVARDQYKITINFTHFDLEGHNQDCEYDSVRLSSGVGEDQKLHGVFCGATFPAPVTSEGNTLRIEFNSDNSVQKTGFVAEFRTDKDECAINNGGCQHVCRNTVGSYQCACYNGFTLHENNHDCKEGGCQYEINKPEGIITSPNWPNFYPARKDCVWHF-TTKPGHRIKLTFREFGLEPHQECTYDHVVLFDGDDNNARSLGLFCGGATPDPITSSGNSMYMVFYSDASVQRKGFEAEYESVCGGH 930          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: R7U2Q9 (Metalloendopeptidase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221124 PE=4 SV=1)

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 451/862 (52.32%), Postives = 583/862 (67.63%), Query Frame = 3
Query:  903 WTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK---ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFS-GALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAI-SPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKL--GKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTP-YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY-LAVP 3458
            W HG+IPY I ANFS   KA   +AMRHWENYTCLSF+ K   D++YI FTEK CGCCS+VG+R  +  QAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD HV I+ +N++ GQ++NF K  + EV+SL E+YD+ SIMHYA+ TFSK+    TI P+   +   RP IGQR+ LS GDI Q +KLY CP CG TL E S +FS P   NE +       CQWRIS T GE++ LNI+   I +S  C  +Y+EIRDG + NS L+GRYC    + S ++S  SR+WI Y+    +   GF A Y+A+CGGEI   +G + SPNYP++YKPNK+C+WKITVP  YS+AL+F+SF+IE HD CVYD+LE+RDGH+E   L+ K CGY++P  IK+ +N++Y+KF+SD SV+K GF A F +E+DEC +  HGC H CVNTLG + C C+IGYEL +DGK CE+ACGG I  SNG+LHSP+YP  YP NK C+W I A +  +I  NFT FD+EG  +DC+YD + V  G       L    +CG K P  ITS  N L I F +D+TVQK GF + F+TD++EC   NG C+H C NT+GSY C C  G+ LH  K +CKE    GC +EIT A GE+ SP +P  YP + +C W  ITTPGH I+L F+DFE+E HQEC YD + V+DG S + + LG+FCGSK P P+ +  N + ++F SD SVQR+GF  T  ++C G+L AT + + +FSHA YG   Y+  ++C W L        V+ +F  FEVE E  C YD V+I+DG    AP  G++CG  +P    S    L I F +DDT++ KGFKA + LA P
Sbjct:  166 WEHGVIPYEIDANFSGAHKALFKQAMRHWENYTCLSFVEKTPQDENYITFTEKPCGCCSFVGKRG-NGGQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDAHVQIIYKNILPGQEYNFDKNSADEVNSLGESYDFYSIMHYARNTFSKSTYLDTILPRRDTSSLARPEIGQRVKLSVGDISQASKLYECPSCGHTLQESSGSFSPPPAMNENSLEPTGQHCQWRISTTHGEKIILNITMMDILQSAHCITDYIEIRDGHWLNSPLLGRYCGAGPLPSTLVSSESRMWIEYRTSGRTTQRGFAAKYEAICGGEIIKEQGHLSSPNYPDYYKPNKECVWKITVPESYSVALRFQSFEIENHDNCVYDYLEVRDGHNEDSPLIGKFCGYKVPTDIKSLSNKLYVKFVSDGSVQKGGFAASFVKEYDECASEIHGCHHTCVNTLGGFRCECNIGYELHSDGKKCEDACGGYINTSNGTLHSPSYPDLYPANKNCVWEIEAWEGYRISINFTHFDLEGNNQDCEYDSVEVSSGAGEGGSSLQHSVFCGSKLPPSITSEGNRLRITFNTDNTVQKTGFMVYFFTDKDECAVNNGGCQHACKNTVGSYLCSCHNGFTLHENKHDCKEG---GCQHEITSAIGEVSSPEWPDYYPGRKDCVWHFITTPGHRIKLVFNDFELEPHQECAYDHVEVFDGHSAEGRSLGKFCGSKVPYPLLASGNRMYMSFYSDASVQRKGFHATHTTVCGGRLSATNKAKDLFSHAKYGDQNYHNKEDCSWTLWADEDGYKVRFRFQTFEVEDEMDCGYDYVEIFDGRDSSAPRFGRFCGNMIPPEFVSTGRYLTIRFKTDDTINWKGFKAAFVLASP 1023          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A147BQI3 (Metalloendopeptidase (Fragment) OS=Ixodes ricinus OX=34613 PE=4 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 443/863 (51.33%), Postives = 597/863 (69.18%), Query Frame = 3
Query:  897 RTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK---ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALD-CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISP-IISKGSRIWIRYKNQA-PSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDG-PENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEP-QFIFSHAAYGTP-YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            R W H +IPY I+ANFS + +A   +AMRHWEN+TC+ F+ +    + YI+FTE+ CGCCS+VG+R  +  QAISIGKNCDK GIV+HELGHV+GFWHEHTRPDRD HVDI+ +N++ GQ++NF K+   EV+SL  AYD++SIMHYA+ TFSK     TI P+   A   RP IGQR+ LS GDI QTNKLY CP CG+TLLE +   SSPE  N  T     + C+WRI+ T GER+ LN++E  I ES +C  +Y+E+RDG +  S L+GRYC    I   ++S G R+ I Y+  +  + + GF A Y+AVCGG++   EG + SPNYP+ Y+PNK+C+WKITVP+ Y +ALKF+SF++E HD CVYD+LE+RDGHD    LL K CGY+ P   ++++N+M +KF+SDSSV K GF+A F +E+DEC+   HGC H CVNTLG Y C C+IGYEL +DGK CE+ACGG+I+ SNG++ SP++P  YP NK CIW I+AS + +I  NFT FD+EG  +DC+YD ++++    +N  +K G +CG   P  ITS  N L I F SD++VQK GF   F TD++EC   NG C+H C NT+GSY C C+ G+ LH  + +CKE T   CT++I+   GEI SPNYP +YPS+ +C W   TTPGH ++L F+DFE+E HQEC YD + +YDG S     LGRFCG+K P P+ S  N + + F SD SVQR+GF+   ++ C G+L+AT    + ++SHA YG   Y   ++C WL+E   +   V+L+FL FE+E E  C+YD V+++DG    A  +G++CG  +P   TS SG+LL+ F SDD ++AKGF A Y AV
Sbjct:   91 RLWDHAVIPYEIEANFSGDHRALFKQAMRHWENHTCIKFVERGFEHQHYIVFTERPCGCCSFVGKRG-NGAQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDAHVDIVNKNIMTGQEYNFNKLTDEEVNSLGLAYDFESIMHYARNTFSKNTHLDTILPQEDNASKRRPEIGQRVRLSQGDISQTNKLYKCPSCGRTLLEPNGLVSSPELVNSVTPPAEGEHCEWRITATHGERIVLNVTELDIYESDNCETDYIEVRDGYWHKSPLLGRYCGTGRIPEMLLSTGYRLLIVYRTSSNQNGHIGFRAYYEAVCGGDVDQEEGVLQSPNYPDDYRPNKECVWKITVPVNYQVALKFQSFEVENHDNCVYDYLEVRDGHDAGSPLLGKFCGYRTPDDQRSSSNKMLVKFVSDSSVNKPGFSATFMKEYDECQKPDHGCDHECVNTLGGYRCECNIGYELHSDGKKCEDACGGVIEASNGTITSPSFPDLYPSNKNCIWEIVASPQYRITLNFTHFDLEGNNQDCEYDKVDIHSKMGDNTVRKHGLFCGSYLPPIITSEGNSLRIEFSSDNSVQKSGFAAVFLTDKDECAHSNGGCQHICKNTVGSYSCACQNGFVLHPNRHDCKEGT---CTHQISAPLGEINSPNYPDSYPSRKDCAWLFTTTPGHRLKLIFNDFELEPHQECAYDHISLYDGDSTDAPTLGRFCGAKVPHPILSTTNRMYMVFKSDASVQRKGFRAAHSTACGGRLLATGRTVEHLYSHAKYGDQNYENKEDCDWLVEA--EAGRVRLRFLTFELEHEQDCSYDYVELFDGYDDSAMPLGKFCGNQLPGEFTSSSGSLLLRFRSDDNINAKGFSAAYSAV 947          

HSP 2 Score: 265.388 bits (677), Expect = 6.105e-70
Identity = 169/568 (29.75%), Postives = 264/568 (46.48%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY------------------------------------------QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDT-CVYDFLEIRDGH-DEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTC-ENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIAT 3128
            +C W+I+V    +V+L    F +    +C  +YLE+RDG    S L+G++C         S  +++ +++ + +     GF A++                                          +  CGG I AS G I SP++P+ Y  NK CIW+I     Y I L F  F +E ++  C YD ++I     D   R     CG  +P  I +  N + I+F SD+SV+K GF A F  + DEC +   GC H+C NT+G+Y CAC  G+ L  +   C E  C   I    G ++SPNYP +YP  K C W    +   ++   F +F++E   ++C YD+I++YDG   +   LG++CG K P PI STTN + + F SD++VQ+KGF+    T         G        T+   Y H + G Q                                  Y +K +C+W +    G + +L F  FE+E  Q+C+YD + ++DG       LG+FCG++ P    S   S+L+ F SD ++  +GF   ++++  G+  AT
Sbjct:  430 ECVWKITVPVNYQVALKFQSFEVENHDNCVYDYLEVRDGHDAGSPLLGKFCGYRTPDDQRSSSNKMLVKFVSDSSVNKPGFSATFMKEYDECQKPDHGCDHECVNTLGGYRCECNIGYELHSDGKKCEDACGGVIEASNGTITSPSFPDLYPSNKNCIWEIVASPQYRITLNFTHFDLEGNNQDCEYDKVDIHSKMGDNTVRKHGLFCGSYLPPIITSEGNSLRIEFSSDNSVQKSGFAAVFLTDKDECAHSNGGCQHICKNTVGSYSCACQNGFVLHPNRHDCKEGTCTHQISAPLGEINSPNYPDSYPSRKDCAWLFTTTPGHRLKLIFNDFELE-PHQECAYDHISLYDGDSTDAPTLGRFCGAKVPHPILSTTNRMYMVFKSDASVQRKGFRAAHSTACGGRLLATGR-------TVEHLYSHAKYGDQ---------------------------------NYENKEDCDWLVEAEAGRV-RLRFLTFELEHEQDCSYDYVELFDGYDDSAMPLGKFCGNQLPGEFTSSSGSLLLRFRSDDNINAKGFSAAYSAVDVGEDSAT 955          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: bmp1b (bone morphogenetic protein 1-like [Source:NCBI gene;Acc:103045069])

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 452/987 (45.80%), Postives = 616/987 (62.41%), Query Frame = 3
Query:  510 ENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG-CSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E   + DPCKA AF+GDIAL D+E +R L          ++   P S+N+++              PE+                   TL   P++    +      +      T+  R RRAAT+   R W  G+IPY I  NFS   +A   +AMRHWE +TC++F  +R+ ++SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD HV I+ EN+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P+      RPPIGQR  LS GDI Q  KLYNCPKCG+TL E S NFSSP   N   +S    C W ISVT GE++ LN +   +  S  C  +++E+RDG +  + L GRYC      PIIS  S++W+ +++ +     GF A Y+A+CGG +    G+I SPNYP+ Y+PNK C+WKITV  G+++ L F+SF++E+HD+C YD+LE+RDG+ E   L+ + CGY  PG IK+++N++++KF+SD+SV K GF+A F +E DEC     G C   C+NTLG+Y C CD G+EL +D ++CE ACGG I + NGS  SP +P  YPPNK C+W+++A  + +I   F  FDVEG +  C+YDY+ V+ G  ++ K  G++CG     PITS +N + I F SD+TV K+GFK +F++DR+EC  +NG C+H CVNT GSY C CR G+ LH  K +CKE    GC   IT   G I SPN+P  YPSK  C W + TTPGH I+L F++ ++ESH EC+YD + VYDG + +   LGRFCG K P P+ S  N++ + F SD SVQ+RGF+ + +S C G L A  + +  +SHA +G   Y    +C W++ +  +   V+L F  FE+E E  C YD V ++DGS   AP +G+YCG+  P  I S    +++ F SDD++S KGF   Y + 
Sbjct:  102 EEIDYKDPCKAAAFLGDIAL-DEEDLRYLR---------LEQAGPASSNTTD--------------PENT------------------TLGYGPTEANANSSRGNGSVWD---GTDLPRRRRAATARSERVWPDGVIPYVISGNFSGSQRAIFKQAMRHWEKHTCVTFT-ERAGEESYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDAHVSIIRENIQPGQEYNFLKMEPGEVNSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGARPPIGQRTRLSKGDIAQARKLYNCPKCGETLQESSGNFSSPGFPN--GYSAYSHCIWSISVTPGEKIVLNFTSMDLYRSHLCWYDHVEVRDGYWRKAALKGRYCGDQLPEPIISTDSQLWVEFRSSSNWVGKGFSAVYEAICGGSVKRDSGQIQSPNYPDDYRPNKVCVWKITVAQGFNVGLHFQSFEVERHDSCAYDYLEVRDGNSESSPLIGRFCGYDKPGDIKSSSNRLWMKFVSDASVNKAGFSANFFKETDECARPDRGQCKQRCINTLGSYRCGCDPGFELASDRRSCEAACGGFITKLNGSFSSPGWPKEYPPNKNCVWQLVAPAQHRITLLFDSFDVEGNDV-CKYDYVEVHSGLSSDSKLHGRFCGSTKLDPITSHSNNMRIEFKSDNTVSKRGFKAHFFSDRDECSKENGGCQHECVNTFGSYTCQCRIGFSLHDNKHDCKEA---GCDQVITSVSGTITSPNWPDKYPSKKACSWALSTTPGHRIKLAFNEIDMESHLECSYDHVEVYDGGNGRAPSLGRFCGGKKPSPVFSSVNTMFLRFFSDNSVQKRGFQASHSSECGGGLKAEVKTRDFYSHAQFGDNNYPAAADCEWVI-SAEKGYGVELIFQTFELEEEADCGYDFVDLFDGSDAKAPRLGRYCGSGPPEEIYSAGDAIVLRFHSDDSISKKGFHVRYTST 1034          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: bmp1a (bone morphogenetic protein 1 [Source:NCBI gene;Acc:103024888])

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 422/858 (49.18%), Postives = 569/858 (66.32%), Query Frame = 3
Query:  897 RTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG-CSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            R W  G+IPY I  NFS   +A   +AMRHWE +TC++FI +R++++SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  EVDSL E YD+ SIMHYA+ TFS+     TI+P+      RPPIGQR  LS GDI Q  KLY CP+CG +L E S NFSSP   N   +S  + C WRISVT GE++ LN +   +  S  C  +++EIRDG +  + L GR+C      PIIS  SR+WI +++ +     GF A Y+A+CGGE+    G+I SPNYP+ Y+PNK C+WKITV  GY + L F+SF+IE+HD+C YD+LE+RDG+ E   LL + CGY  P  IKT++NQ+++KF+SD SV K GF A F +E DEC    +G C   CVNTLG+Y CACD GYEL AD ++CE ACGG I + NGS+ SP +P  YPPNK CIW+++A  + +I   F  F+ EG +  C+YD++ V  G   + +  GK+CG + P+ ITS  N + I F SD+TV KKGFK  F++D++EC  +NG C+H CVNT GSY C CR G+ LH  K +CKE    GC + +    G I SPN+P  YPSK  C W + TTPGH I++ F++ ++E H EC YD + +YDG   K   LGR+CGSK P P+ S  N + I F SD SVQ++GF+ + ++ C G+L A  + + ++SHA +G   Y    +C W++ +  +   V+L F  FE+E E  C YD ++++DG+   +P +G+YCG+  P  I S   +++I F SDDT++ KGF   Y + 
Sbjct:  117 RVWPDGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFI-ERTTEESYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTIQPRYDINGVRPPIGQRTRLSKGDIAQARKLYKCPRCGDSLQESSGNFSSPGFPN--GYSAYMHCIWRISVTPGEKIILNFTSMDLYRSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPEPIISTDSRLWIEFRSSSNWVGKGFSAVYEAICGGEVKKDNGQIQSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEIERHDSCAYDYLEVRDGNSENSPLLGRFCGYDKPDDIKTSSNQLWMKFVSDGSVNKAGFAANFFKEMDECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPREYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDV-CKYDFVEVRSGLSADSRLHGKFCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGFVLHENKHDCKEA---GCDHTVNSVSGTITSPNWPDKYPSKKACTWALSTTPGHRIKIAFNEIDMEPHLECAYDHIEIYDGRDGKAPSLGRYCGSKKPPPVMSSGNKMFIRFFSDNSVQKKGFEASHSAECGGRLKAEVKTKDLYSHAQFGDNNYPGASDCQWVI-SAEKGYGVELIFQTFEIEEEADCGYDYMELFDGADTKSPRLGRYCGSGPPEEIYSAGDSIVIKFRSDDTINKKGFHVRYTST 965          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 449/1004 (44.72%), Postives = 613/1004 (61.06%), Query Frame = 3
Query:  495 ELELKENFRFLDPCKANAFMGDIALTD-DEKMRMLERDILLS-----RESIQSWQPESNNSSNHYSH------KIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E E  +   + DPCKA  F GDIAL + D KM  ++R I L+     R+   S   E ++ +   S       +IRR      P++  KE E  +   W  S                    + ++       + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       +IS  SR+WI +++ +     GF A Y+A+CGG++    G+I SPNYP+ Y+P+K+C+W+ITV  GY++ L F++F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F         + C+YD++ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C + I    G I SPN+P  YPS+  C W I  TPGH I++TF++FEIE HQEC YD L  +DG S K+  L R CGSK P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+ T     +++L F  FEVE E  C YD +++YDG    A  +G++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   44 EEEKTDTIDYKDPCKAAVFWGDIALDEEDLKMFQVDRTIDLAQHTHLRQGHTSGGLEEHDFTKKRSSLYLLLDRIRRLGSDSSPKNSSKE-ESSRAGPWSGS-----------------TGGNGVRGRGVRGGKSRVPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKVPEMLISTESRMWIEFRSSSNWVGKGFAAVYEAICGGDVTKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIERHDSCAYDYLEVRDGLSESSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECVKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLSKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQF---------EVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFVLHENKHDCKEAE---CEHTIHSPSGTISSPNWPDKYPSRKECTWDITATPGHRIKITFNEFEIEQHQECAYDHLEAFDGESDKSSILSRLCGSKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-TAEAGYSIELTFTTFEVEEEADCGYDYIELYDGHDTSAHKLGRFCGSGPREELYSAGDTVLIHFHSDDTISKKGFHIRYTST 1012          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 835.869 bits (2158), Expect = 0.000e+0
Identity = 419/880 (47.61%), Postives = 570/880 (64.77%), Query Frame = 3
Query:  831 IQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            +  L+    + R  RAATS   R W  G+IPY I  NF+ + +A   +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       +IS  SR+WI +++ +     GF A Y+A+CGG++    G+I SPNYP+ Y+P+K+C+W+ITV  GY++ L F++F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++      C+YD++ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C + I    G I SPN+P  YPS+  C W I  TPGH I++TF++FEIE HQEC YD L  +DG S K+  L R CGSK P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+ T     +++L F  FEVE E  C YD +++YDG    A  +G++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   78 LSTLQNSRGKSRVPRAATSRAERIWPGGVIPYVIGGNFTGDQRAMFKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKVPEMLISTESRMWIEFRSSSNWVGKGFAAVYEAICGGDVTKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIERHDSCAYDYLEVRDGLSESSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECVKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLSKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFEI---VHVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFVLHENKHDCKEAE---CEHTIHSPSGTISSPNWPDKYPSRKECTWDITATPGHRIKITFNEFEIEQHQECAYDHLEAFDGESDKSSILSRLCGSKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-TAEAGYSIELTFTTFEVEEEADCGYDYIELYDGHDTSAHKLGRFCGSGPREELYSAGDTVLIHFHSDDTISKKGFHIRYTST 946          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 420/891 (47.14%), Postives = 573/891 (64.31%), Query Frame = 3
Query:  798 IRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + + T +R        RH+++ +  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL +   NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       +IS  SR+WI +++ +     GF A Y+A+CGG++    G+I SPNYP+ Y+P+K+C+W+ITV  GY++ L F++F+IE+HD+C YD+LE+RDG  E   L+ + CGY  P  I++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ CACD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F         + C+YD++ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NTIGSY C CR G+ LH  K +CKE     C + I    G I SPN+P  YPS+  C W I  TPGH I++TF++FEIE HQEC YD L  +DG S K+  L R CGSK P P+ S  N + + F SD SVQR+GF+ T ++ C G+L A    + ++SHA +G   Y  + +C WL+ T     +++L F  FEVE E  C YD +++YDG    A  +G++CG+     + S    +LIHF SDDT+S KGF   Y + 
Sbjct:   16 LAQHTHLRQGHTHNANRHSSQAQVPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKVPEMLISTESRMWIEFRSSSNWVGKGFAAVYEAICGGDVTKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIERHDSCAYDYLEVRDGLSESSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECVKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLSKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQF---------EVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFVLHENKHDCKEAE---CEHTIHSPSGTISSPNWPDKYPSRKECTWDITATPGHRIKITFNEFEIEQHQECAYDHLEAFDGESDKSSILSRLCGSKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI-TAEAGYSIELTFTTFEVEEEADCGYDYIELYDGHDTSAHKLGRFCGSGPREELYSAGDTVLIHFHSDDTISKKGFHIRYTST 889          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007253.1 (pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1 gene:ENSPMAG00000006538.1 transcript:ENSPMAT00000007253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 424/871 (48.68%), Postives = 582/871 (66.82%), Query Frame = 3
Query:  858 RKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTI--RPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKH-GCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            R R  RAAT+   R W  G+IPY +  NF+   KA   +AMRHWE +TC++FI +R+ ++SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+  N+  GQ++NF KME  EVDSL E+YD+ SIMHYA+ TFS+     TI  RP     RP IGQR  LS GDI Q  KLY CP CG+TL E   NFSSP   N   +     C W+ISVT GE+++LN +   + +S  C  +Y+E+RDG +  + L+GR C      P++S  S +WI +++ +     GF A+Y+A+CGGE++   G+I SPNYP+ Y+P+K+C+WKI+V  G+ + L F++F+IEKHD C YD+LE+RDG ++  +L+ + CGY+ P  IK+++N++++KF+SDSSV K GF A F +E DEC    + GC   CVNTLG+Y CACD GYEL  D ++CE ACGG + + NG++ SP +P  YPPNK C+W+++A  + +I   F  F++EG +  C+YDY+ +  G  +  K  GK+CG + P  ITS  N L + F SD+TV KKGFK++F++D++EC   NG C+H C+NT+GSY C CR G+ LH    +CKE +  GC ++I  A G I SPN+P  YP++  C W+I  TPGH ++LTFS+FE+E HQEC YD L VYDG+S K   LGRFCGSK P  + S  N + + F SD SVQ+RGF+   +++C GKL A   P+ ++SHA +G   Y    +C W++ T      V+L FL FE+E E  C YD +++YDG S  A  +G++CG+  P  + S   +++I F SDDT+  KGF A Y + 
Sbjct:    7 RSRAPRAATARSERIWPGGVIPYIVGGNFTGSQKAMFRQAMRHWEKHTCVTFI-ERTDEESYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIKANIQPGQEYNFLKMEPGEVDSLGESYDFDSIMHYARNTFSRGIFLDTILPRPDDSGVRPAIGQRTRLSQGDIAQARKLYRCPACGETLQESVGNFSSPGFPN--GYPSYSHCVWKISVTPGEKITLNFTSLDVFKSRLCWYDYIEVRDGFWRKAPLLGRVCGDKLPEPLVSTSSWMWIEFRSSSNWVGRGFSAAYEAICGGEVNRENGQIQSPNYPDDYRPSKECVWKISVTEGFIVGLTFQAFEIEKHDNCAYDYLEVRDGDNDSSQLIGRYCGYEKPDDIKSSSNKLWMKFVSDSSVNKAGFAANFFKEIDECARPDNGGCEQNCVNTLGSYRCACDPGYELAPDKRSCEAACGGFLNKLNGTMTSPGWPKEYPPNKHCVWQVVAPAQYRISLQFEFFELEGNDV-CKYDYVEIRSGLSSESKLHGKFCGTELPDVITSQNNNLRLEFKSDNTVSKKGFKVHFFSDKDECSQHNGGCQHDCINTLGSYSCQCRNGFMLHENGHDCKEVSTAGCEHKINSAEGVISSPNWPDKYPNRRECTWEISATPGHRVKLTFSEFEVEQHQECAYDHLEVYDGSSEKAPILGRFCGSKKPEAVLSTLNKMYLRFMSDASVQKRGFQAIHSTVCGGKLRADVAPRELYSHAQFGDNNYPGQLDCDWVI-TAEDGYGVELTFLTFEIEEEADCGYDYMELYDGYSADALRLGRFCGSGPPEEVYSSGDSIMIRFHSDDTIGKKGFHARYTST 871          

HSP 2 Score: 58.151 bits (139), Expect = 1.225e-8
Identity = 31/114 (27.19%), Postives = 52/114 (45.61%), Query Frame = 3
Query: 3147 FSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQ 3488
            FS   +   Y    +C+W + ++     + L F   +V     C YD +++ DG    AP++G+ CG  +P  + S S  + I F S      +GF A Y A+     N ++ Q
Sbjct:  225 FSSPGFPNGYPSYSHCVWKI-SVTPGEKITLNFTSLDVFKSRLCWYDYIEVRDGFWRKAPLLGRVCGDKLPEPLVSTSSWMWIEFRSSSNWVGRGFSAAYEAICGGEVNRENGQ 337          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010323.1 (pep scaffold:Pmarinus_7.0:GL476365:125003:472029:-1 gene:ENSPMAG00000009333.1 transcript:ENSPMAT00000010323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 6.325e-45
Identity = 150/511 (29.35%), Postives = 227/511 (44.42%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGF-TAYFQQEHDEC---KNMKHGC---SHVCVNTLGAYMCACDIGYELQA----------DGK--------TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKL----GKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF----YTDRNECEDKNGECEH-------FCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG---------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNIN 3185
            A CGG +    G I+SPNYPE Y P K+C W++TV     I+L F SF  E      YDFL I DG      L++ + G ++PG I++T N M++ F SD S+   GF   Y ++  + C    N+++G    + V + +   Y   CD GY +Q           DG+        +C   CGG    S G + SP YP NY   + C+  I   K   IF  +  F+   K      D ++VYDGP  +   L    G + GK  P    S+++++TI F        +G+   +     T    C   + E  H       F  N+I  +   C PGY L G +  +  TV                 C   +T   G I SP YP  Y +  +C W+II   G  IQ+ F +F  E +    +D L +YDG  + + +LG F G+  P  + S  N + + + +D S+   GF + +++I    L +  EP    +    G  + +N
Sbjct: 1428 APCGGNLTEPTGFILSPNYPEPYPPGKECDWQVTVTADNVISLTFISFDTETS----YDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSLSLSGFHIEYKEKPQESCFDPGNIQNGSRLGTDVKLRSTITYF--CDAGYTIQGYSTLLCVMSEDGRPMWNRPLPSCHAPCGGKATASEGVVLSPGYPRNYSSPQHCVHTITVPKDFVIFGQYATFETSVK------DVVHVYDGPTQSFFLLSALSGSHTGKVIP---LSSSHQITIVFSPSKGSSARGYHFVYRAVPRTSATHCTSIS-EPLHGRRIGLDFSANSIVRF--ECNPGYTLKGAQAIQCTTVANALAQWNDSLPTCYAPCGGNLTIYTGTILSPGYPEMYDNNLDCVWRIIVPEGDGIQVQFVNFATEHN----WDTLDIYDGPDVNSPKLGSFSGTTVPTFINSSSNQLYLHYQTDLSLGIVGFHVKYSAI---GLSSCSEPNTPSNGIKMGNSFLVN 1913          

HSP 2 Score: 160.999 bits (406), Expect = 6.034e-40
Identity = 131/459 (28.54%), Postives = 202/459 (44.01%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQ--------QEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADG------------------KTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYT--DRNECEDKNGECEHFCVNT---IG-SYYCHCRPGYQLHGKK--NCKEKT-----------VDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSD 3059
            A CGG +    G I+SP YPE Y  N  C+W+I VP G  I ++F +F  E +    +D L+I DG D     L    G  +P  I +++NQ+Y+ + +D S+   GF   +         + +     +K G S + VN + ++   C+ G++LQ  G                    C   CGG + E NG + SP++P NYP N +C W+I       ++  F  F  E       +DY+ +          +G++ G   P  + STT+  T+ F+SD +  K GFKI FY   +   C D       F V +   +G S    C  GY L G+    C+              +  C   +T   G + SP +P  YP+  +C W +    GH + + F+    E      YD + ++DG      QLG+F G+     + S  N IL+ F SD
Sbjct: 1779 APCGGNLTIYTGTILSPGYPEMYDNNLDCVWRIIVPEGDGIQVQFVNFATEHN----WDTLDIYDGPDVNSPKLGSFSGTTVPTFINSSSNQLYLHYQTDLSLGIVGFHVKYSAIGLSSCSEPNTPSNGIKMGNSFL-VNDIMSF--ECEPGFKLQTQGHKHIMCMPGPVRRWNFPPPICTAVCGGTMTEFNGIILSPDFPGNYPSNVECHWKIELPIGYGVYLQFENFTTE-----LDHDYLEIRTEIAQVSSTIGRFSGPTVPAALLSTTHRTTMHFHSDYSQSKPGFKI-FYEAYELQNCPDPKPFRNGFVVGSNFGVGHSISFECFSGYVLIGQSILTCQHGVNRNWDHPFPSCIAPCGGNVTGMSGTVYSPGFPDEYPNFQDCVWMVKVAYGHGVYINFTLLRTEP----VYDFITIWDGPEQNAPQLGQFSGNTALESVYSTSNQILLKFHSD 2220          

HSP 3 Score: 159.844 bits (403), Expect = 1.671e-39
Identity = 168/649 (25.89%), Postives = 256/649 (39.45%), Query Frame = 3
Query: 1821 VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVP-IGYSIALKFESFKIEKHDTCVYDFLEIRDGHD--EQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC----------KNMKHGCSH---------VCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYT-DRNECEDK----NGE---------------CEHFCVNTIGS--YYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTF-SDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS----------------------------------------------ICDGKL------IATEEPQFIFSHAAYG---TP-----YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNL--LIHFVSDDTVSAKGFKAEY 3446
             CG  +    G I SPN+P  Y  N QC+W IT       I + FE F +E+     +D L + DG +  + + +L  + G  +P  + +    M++   +D S    GF   +++  +            +    G SH              +G     C    +  A+   C   C        G + SPNYP +Y  N  CIW I+A   ++I   F +F+VE      Q+D++ V DG  ++   LG + G   P  + S +N   + F SD +   +GF I++ T   N+C D     NG                CE   + T GS    C  R G  +   +N   K    C   +T   G I SP +P  Y    +CEW I    GH I+L F S F+ E +    YD L +YDGAS  +   G F G++ P  + S  N++L+ FT+D S    GF+I + S                                              ICD  L       + + P   + HA+ G   +P     Y    NC W +E ++    VQ  F  F +E     ++D + I +  S   P+      T  P L     GN    + F+SD ++S +GF   +
Sbjct:  385 TCGAALTGPSGTITSPNFPVQYDNNAQCVWTITASRPSKVIEINFEEFDLERG----FDTLTVGDGEEVGDPRMVLHVLTGTSVPDLVVSMTGHMWLHLQTDDSAGSLGFKIIYREIAERSCGDPGVPQHGRREGSGFSHRDSLTFECQAAFELVGEKTITCQSNNQWSANVPHCIFPCVFNFTSPIGIVLSPNYPEHYGSNMNCIWLIVAPAGSRIRLVFADFEVES-----QFDFLAVKDGDRHDAPLLGTFSGADVPGNLVSASNTFRLEFLSDHSTPGRGFNISYTTFGHNDCYDPGNPVNGRRFGTKFHLGSMVSFTCEKGFIRTEGSEILTCVSRDG-NIEWNENVP-KCEAPCGGHLTSLAGIILSPGWPGLYKDSLSCEWIIEAQQGHAIRLIFKSRFQTEVN----YDVLQIYDGASTSSPLTGSFHGTQVPEFLASTGNTLLLHFTTDNSRSNVGFQILYESITLSTHLCLDPGVPVHGQRHGTEMSVGSMVTFSCNSGYTLSHEEALICDKNLQWSHPMASCDAPCGGYIHASSGIILSPGYPDYYPNTLNCTWTVE-VSHGKGVQFTFHTFHLE----SSHDYLLITENGSFSQPLARLTGSTLPPVLHAGVYGNFQAQLRFISDFSMSYEGFNITF 1013          

HSP 4 Score: 154.836 bits (390), Expect = 5.553e-38
Identity = 127/475 (26.74%), Postives = 214/475 (45.05%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQ-EHDECKNMK---------------HGCSHVCVN---TLGAYMCACDIGYELQADGK--TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFY-----------------TDRNECEDKNGECEHF-CVNTIGSYY-----CHCRPGYQLHGKKNCKEKTVDGCTYEI-TDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGA-SIKNKQLGRFCGS-KTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            AVCGG +    G I+SP++P  Y  N +C WKI +PIGY + L+FE+F  E      +D+LEIR    +    + +  G  +P  + +T ++  + F SD S  K GF  +++  E   C + K               H  S  C +    +G  +  C  G     D    +C   CGG +   +G+++SP +P  YP  + C+W +  +    ++ NFT    E       YD+I ++DGPE N  +LG++ G    + + ST+N++ + F+SD +     F +++Y                 T   + E + G+  H+ C       Y     C  R   Q+       E      T E+ T++ G I SP+YP  YP    C W I     + + L    F+ E      YD+L ++DG  S ++ +L    G    P+ + S  + + + + SD +  ++GF+I + +
Sbjct: 1953 AVCGGTMTEFNGIILSPDFPGNYPSNVECHWKIELPIGYGVYLQFENFTTELD----HDYLEIRTEIAQVSSTIGRFSGPTVPAALLSTTHRTTMHFHSDYSQSKPGFKIFYEAYELQNCPDPKPFRNGFVVGSNFGVGHSISFECFSGYVLIGQSILTCQHGVNRNWDHPFPSCIAPCGGNVTGMSGTVYSPGFPDEYPNFQDCVWMVKVAYGHGVYINFTLLRTEPV-----YDFITIWDGPEQNAPQLGQFSGNTALESVYSTSNQILLKFHSDFSTGGF-FVLSYYAYQLRVCQLPPSVPHAETLMQDKELEIGDTVHYRCEAGFTMLYSDVLTCQLRARLQMDTTPPACEALCP--TNEVRTESVGVILSPSYPANYPYLQTCLWTISVEKTYNVTLFIELFQSEKQ----YDELEIFDGGQSSQSPRLLALSGDYSAPISVTSTGHQVHLRWASDQATSKKGFRIRYTA 2411          

HSP 5 Score: 152.14 bits (383), Expect = 3.267e-37
Identity = 132/475 (27.79%), Postives = 209/475 (44.00%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPG-PIKTTNNQMYIKFMSDSSVEKQGFTAYF---------------------QQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGK--TCENACGGLIK-ESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKK---LGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTD-RNECEDKNGECEHFCVNT------IGSYYCHCRPGYQLHGKKNC--------------KEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF 3095
            A CG     ++G ++SPNYP  Y    +CI+ I    G  I L  ++F++ + D     FL++ DG+     L+      +  G  + +T+N++++KF +DS   ++GF   +                     +Q H     + +GC +   N  G+    C  G     D +  +C   CGG I+  ++G + SP YP+ Y  N +C W I A+    I  +F  FD E       +D + V+DGP    +    L +  G   P  I S+ + L++ F SD  + K GF I F +     C D           T      I ++   C+PGYQL G+                     +  C   +T+  G I SPNYP  YP    C+W++  T  ++I LTF  F+ E+    +YD L +YDG    +  +    GSK P  ++S  NS+ + F SD S+   GF I +
Sbjct: 1078 AECGMSSIGTDGELLSPNYPGSYDRKHECIYTIETEAGSGIRLMAKTFRVAEGD-----FLKVYDGNSSLAPLIGTYSKTEFQGLSLNSTSNRLWLKFDTDSEGTEKGFRLIYSSFELTHCKEPGSPEFGYKIREQGHFAGGTVAYGC-NPGYNLHGSSTLTCMTGSRRTWDHQLPSCVAECGGKIQGATSGRILSPGYPAPYGHNLQCTWEIHANAGYTISLHFVVFDTEAA-----HDLLKVWDGPSVPSQAGVLLKELSGSVLPDDIHSSQSSLSLHFQSDFFISKTGFAIQFSSAVARACRDPGVPTNSTRSGTGREPGNIITF--QCQPGYQLQGEATIVCMHGENHYYWQPDPPTCIAPCGGNLTEPTGFILSPNYPEPYPPGKECDWQVTVTADNVISLTFISFDTET----SYDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSLSLSGFHIEY 1535          

HSP 6 Score: 144.436 bits (363), Expect = 7.986e-35
Identity = 130/484 (26.86%), Postives = 208/484 (42.98%), Query Frame = 3
Query: 1803 VASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIK-TTNNQMYIKFMSDSSVEKQGF----TAYFQQEHDECKNMK---HG---CSHVCVNTLGAYMCACDIGYELQADGK------------------TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYT-DRNECEDKNGECE------HFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG---------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            + S  A CGG+  ASEG ++SP YP  Y   + C+  ITVP  + I  ++ +F     +T V D + + DG  +   LLS + G      I  ++++Q+ I F        +G+     A  +     C ++    HG         N++  +   C+ GY L+                      TC   CGG +    G++ SP YP  Y  N  C+WRII  +   I   F  F  E       +D +++YDGP+ N  KLG + G   P  I S++N+L + + +D ++   GF + +     + C + N           F VN I S+   C PG++L  + +     + G               C   +T+ +G I SP++P  YPS   C WKI    G+ + L F +F      E  +D L +    +  +  +GRF G   P  + S  +   + F SD S  + GFKI + +
Sbjct: 1597 LPSCHAPCGGKATASEGVVLSPGYPRNYSSPQHCVHTITVPKDFVIFGQYATF-----ETSVKDVVHVYDGPTQSFFLLSALSGSHTGKVIPLSSSHQITIVFSPSKGSSARGYHFVYRAVPRTSATHCTSISEPLHGRRIGLDFSANSIVRF--ECNPGYTLKGAQAIQCTTVANALAQWNDSLPTCYAPCGGNLTIYTGTILSPGYPEMYDNNLDCVWRIIVPEGDGIQVQFVNFATEHN-----WDTLDIYDGPDVNSPKLGSFSGTTVPTFINSSSNQLYLHYQTDLSLGIVGFHVKYSAIGLSSCSEPNTPSNGIKMGNSFLVNDIMSF--ECEPGFKLQTQGHKHIMCMPGPVRRWNFPPPICTAVCGGTMTEFNGIILSPDFPGNYPSNVECHWKIELPIGYGVYLQFENFTT----ELDHDYLEIRTEIAQVSSTIGRFSGPTVPAALLSTTHRTTMHFHSDYSQSKPGFKIFYEA 2062          

HSP 7 Score: 142.124 bits (357), Expect = 3.826e-34
Identity = 137/480 (28.54%), Postives = 199/480 (41.46%), Query Frame = 3
Query: 1818 AVCGGEIH-ASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHD---EQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQE-HDECKN-------MKHGCSHVCVNTLGAYMCACDIGYELQA-----------------DGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNE-CED----KNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCK-EKTVDG--------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTP--VPMKSQHNSILITFTSDGSVQRRGFKITFNSI 3104
            A CGG+I  A+ GRI+SP YP  Y  N QC W+I    GY+I+L F  F  E      +D L++ DG     +   LL ++ G  +P  I ++ + + + F SD  + K GF   F       C++        + G      N +      C  GY+LQ                  D  TC   CGG + E  G + SPNYP  YPP K+C W++  +    I   F  FD E       YD++++YDGP ++   +    G K P  I ST N + +AF SD ++   GF I +     E C D    +NG      V    +    C  GY + G        + DG              C  + T + G + SP YP  Y S  +C   I      +I   ++ FE         D + VYDG +     L    GS T   +P+ S H  I I F+       RG+   + ++
Sbjct: 1251 AECGGKIQGATSGRILSPGYPAPYGHNLQCTWEIHANAGYTISLHFVVFDTEA----AHDLLKVWDGPSVPSQAGVLLKELSGSVLPDDIHSSQSSLSLHFQSDFFISKTGFAIQFSSAVARACRDPGVPTNSTRSGTGREPGNII---TFQCQPGYQLQGEATIVCMHGENHYYWQPDPPTCIAPCGGNLTEPTGFILSPNYPEPYPPGKECDWQVTVTADNVISLTFISFDTE-----TSYDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSLSLSGFHIEYKEKPQESCFDPGNIQNGSRLGTDVKLRSTITYFCDAGYTIQGYSTLLCVMSEDGRPMWNRPLPSCHAPCGGKATASEGVVLSPGYPRNYSSPQHCVHTITVPKDFVIFGQYATFETS-----VKDVVHVYDGPTQSFFLLSALSGSHTGKVIPLSSSHQ-ITIVFSPSKGSSARGYHFVYRAV 1712          

HSP 8 Score: 133.265 bits (334), Expect = 1.892e-31
Identity = 137/487 (28.13%), Postives = 210/487 (43.12%), Query Frame = 3
Query: 1803 VASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKT---TNNQMYIKFMSDSSVEKQGFTAYFQQEHDE-CKN-------MKHGCSHVCVNTLGAYMCACDIGYEL--------QADGK--------TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKK-PPQPITSTTNELTIAFYSDSTVQKKGFKINFYT-DRNECEDKNG--------ECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKT-------------VDGCTYEITDA-HGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQ---LGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            +AS  A CGG IHAS G I+SP YP++Y     C W + V  G  +   F +F +E      +D+L I + +    + L+++ G  +P  +      N Q  ++F+SD S+  +GF   F + + E CK+        + G +    + L     +C  GY L        Q  G+         C   CG     ++G L SPNYP +Y    +CI+ I     + I      F V       + D++ VYDG  +    +G Y   +     + ST+N L + F +DS   +KGF++ + + +   C++           E  HF   T+      C PGY LHG       T             V  C  +I  A  G I SP YP  Y     C W+I    G+ I L F  F+ E+     +D L V+DG S+ ++    L    GS  P  + S  +S+ + F SD  + + GF I F+S
Sbjct:  899 MASCDAPCGGYIHASSGIILSPGYPDYYPNTLNCTWTVEVSHGKGVQFTFHTFHLESS----HDYLLITE-NGSFSQPLARLTGSTLPPVLHAGVYGNFQAQLRFISDFSMSYEGFNITFTEYNLEPCKDPGMPAYSRREGSTFTVGDVLSF---SCFAGYRLVGMPKLTCQGGGRHVWSSPLPRCVAECGMSSIGTDGELLSPNYPGSYDRKHECIYTIETEAGSGIRLMAKTFRVA------EGDFLKVYDGNSSLAPLIGTYSKTEFQGLSLNSTSNRLWLKFDTDSEGTEKGFRLIYSSFELTHCKEPGSPEFGYKIREQGHFAGGTVAY---GCNPGYNLHGSSTLTCMTGSRRTWDHQLPSCVAECGGKIQGATSGRILSPGYPAPYGHNLQCTWEIHANAGYTISLHFVVFDTEA----AHDLLKVWDGPSVPSQAGVLLKELSGSVLPDDIHSSQSSLSLHFQSDFFISKTGFAIQFSS 1364          

HSP 9 Score: 131.339 bits (329), Expect = 7.201e-31
Identity = 123/470 (26.17%), Postives = 192/470 (40.85%), Query Frame = 3
Query: 2289 CGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIF-FNFTEFDVEGKEKDCQYDYINVYDGPENNQKK--LGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFY-TDRNECED----KNGECEHFCVNTIGSYYCHCRPGYQLHGKKN--CKEKT---------VDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSV--------------------------QRRGFKITFNSI----CDGKLIATEEPQF--------------------------------IFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            CG  +   +G++ SPN+P  Y  N +C+W I AS+ +K+   NF EFD+E       +D + V DG E    +  L    G   P  + S T  + +   +D +    GFKI +       C D    ++G  E    +   S    C+  ++L G+K   C+            +  C +  T   G + SPNYP  Y S  NC W I+   G  I+L F+DFE+ES     +D L V DG       LG F G+  P  + S  N+  + F SD S                           +R G K    S+    C+   I TE  +                                 I     +   Y  + +C W++E   Q   ++L F   +   + +  YD ++IYDG+S  +P+ G + GT +P  + S    LL+HF +D++ S  GF+  Y ++
Sbjct:  386 CGAALTGPSGTITSPNFPVQYDNNAQCVWTITASRPSKVIEINFEEFDLERG-----FDTLTVGDGEEVGDPRMVLHVLTGTSVPDLVVSMTGHMWLHLQTDDSAGSLGFKIIYREIAERSCGDPGVPQHGRREGSGFSHRDSLTFECQAAFELVGEKTITCQSNNQWSANVPHCIFPCVFNFTSPIGIVLSPNYPEHYGSNMNCIWLIVAPAGSRIRLVFADFEVESQ----FDFLAVKDGDRHDAPLLGTFSGADVPGNLVSASNTFRLEFLSDHSTPGRGFNISYTTFGHNDCYDPGNPVNGRRFGTKFHLGSMVSFTCEKGFIRTEGSEILTCVSRDGNIEWNENVPKCEAPCGGHLTSLAGIILSPGWPGLYKDSLSCEWIIEA-QQGHAIRLIF---KSRFQTEVNYDVLQIYDGASTSSPLTGSFHGTQVPEFLASTGNTLLLHFTTDNSRSNVGFQILYESI 842          

HSP 10 Score: 126.331 bits (316), Expect = 2.899e-29
Identity = 134/490 (27.35%), Postives = 209/490 (42.65%), Query Frame = 3
Query: 1815 QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQ---EHDECKNMK---HGCSHVCVNTLGAYMC-ACDIGYELQAD--------------GKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTN---ELTIAFYSDSTVQKKGFKINFYTDRN--ECEDKNG------ECEHFCVNTIGSYYCHCRPGYQLHG--KKNCK-----------EKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTP---VPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEP 3137
            +A CGG + +  G I+SP +P  YK +  C W I    G++I L F+S F+ E +    YD L+I DG      L     G Q+P  + +T N + + F +D+S    GF   ++        C +     HG  H    ++G+ +  +C+ GY L  +                +C+  CGG I  S+G + SP YP  YP    C W +  S    + F F  F +E       +DY+ + +    +Q  L +  G   P  + +      +  + F SD ++  +GF I F T+ N   C+D         E   F V  + S+ C    GY+L G  K  C+            + V  C        GE+ SPNYP +Y  K  C + I T  G  I+L    F +        D L VYDG S     +G +  SKT    + + S  N + + F +D     +GF++ ++S    +L   +EP
Sbjct:  730 EAPCGGHLTSLAGIILSPGWPGLYKDSLSCEWIIEAQQGHAIRLIFKSRFQTEVN----YDVLQIYDGASTSSPLTGSFHGTQVPEFLASTGNTLLLHFTTDNSRSNVGFQILYESITLSTHLCLDPGVPVHGQRHGTEMSVGSMVTFSCNSGYTLSHEEALICDKNLQWSHPMASCDAPCGGYIHASSGIILSPGYPDYYPNTLNCTWTVEVSHGKGVQFTFHTFHLESS-----HDYLLITENGSFSQ-PLARLTGSTLPPVLHAGVYGNFQAQLRFISDFSMSYEGFNITF-TEYNLEPCKDPGMPAYSRREGSTFTVGDVLSFSCFA--GYRLVGMPKLTCQGGGRHVWSSPLPRCVAECGMSSIGTDGELLSPNYPGSYDRKHECIYTIETEAGSGIRLMAKTFRVAEG-----DFLKVYDGNSSLAPLIGTY--SKTEFQGLSLNSTSNRLWLKFDTDSEGTEKGFRLIYSSF---ELTHCKEP 1196          

HSP 11 Score: 95.5153 bits (236), Expect = 6.980e-20
Identity = 102/402 (25.37%), Postives = 166/402 (41.29%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYF--------------------QQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADG--KTCENAC--GGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQK-KLGKYCGK-KPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSY-----YCHCRPGYQLHGKKNCK-EKTVDG---------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHII 2882
            A CGG +    G + SP +P+ Y   + C+W + V  G+ + + F   + E     VYDF+ I DG ++    L +  G      + +T+NQ+ +KF SD S       +Y+                    Q +  E  +  H         L + +  C +   LQ D     CE  C    +  ES G + SP+YP+NYP  + C+W I   K     +N T F +E  + + QYD + ++DG +++Q  +L    G    P  +TST +++ + + SD    KKGF+I +  +   C           ++  G +     +  C  GY L GK +    K   G               C   ++ A+GEI + NY +       C     T PG  +
Sbjct: 2125 APCGGNVTGMSGTVYSPGFPDEYPNFQDCVWMVKVAYGHGVYINFTLLRTEP----VYDFITIWDGPEQNAPQLGQFSGNTALESVYSTSNQILLKFHSDFSTGGFFVLSYYAYQLRVCQLPPSVPHAETLMQDKELEIGDTVHYRCEAGFTMLYSDVLTCQLRARLQMDTTPPACEALCPTNEVRTESVGVILSPSYPANYPYLQTCLWTISVEKT----YNVTLF-IELFQSEKQYDELEIFDGGQSSQSPRLLALSGDYSAPISVTSTGHQVHLRWASDQATSKKGFRIRYTAEY--CSIPAAPAHGSVMSQSGGHLNSVVWWACDRGYTLIGKSSAVCIKAPQGFHMWDSAVPTCQAISCGIPVSPANGEILTVNYSIGGRVTYGCNRGYTTGPGDTL 2515          

HSP 12 Score: 65.0846 bits (157), Expect = 1.267e-10
Identity = 36/114 (31.58%), Postives = 61/114 (53.51%), Query Frame = 3
Query: 1815 QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQ 2156
            +  CG  +  + G I SPNYP  Y  +  C W +    G +I+L F  F++E+     +D LE+ +G D     L+   G  +P P+ ++ N + + F+S+S+   +GFTA +Q
Sbjct:   71 EGACGRTLRENSGVISSPNYPSEYGNDADCTWIVLAEQGDTISLVFNDFQLEER----FDSLEV-EGADPSSIWLT---GVGLPSPMISSKNWLRLHFVSNSNNSLRGFTAQYQ 176          

HSP 13 Score: 63.929 bits (154), Expect = 2.592e-10
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 3
Query: 3105 CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            C G L  TE   FI S   Y  PY   + C W + T+     + L F+ F+ E     +YD + IYDG    +P+I    G+ +P  I S   ++ + F SDD++S  GF  EY   P+
Sbjct: 1430 CGGNL--TEPTGFILS-PNYPEPYPPGKECDWQV-TVTADNVISLTFISFDTE----TSYDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSLSLSGFHIEYKEKPQ 1540          

HSP 14 Score: 63.5438 bits (153), Expect = 3.600e-10
Identity = 30/94 (31.91%), Postives = 56/94 (59.57%), Query Frame = 3
Query: 3174 YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            Y+ N +C+W +  + +   +Q++F++F  E      +D++ IYDG  V +P +G + GT++PT I S S  L +H+ +D ++   GF  +Y A+
Sbjct: 1801 YDNNLDCVWRI-IVPEGDGIQVQFVNFATEHN----WDTLDIYDGPDVNSPKLGSFSGTTVPTFINSSSNQLYLHYQTDLSLGIVGFHVKYSAI 1889          

HSP 15 Score: 56.6102 bits (135), Expect = 4.058e-8
Identity = 35/110 (31.82%), Postives = 53/110 (48.18%), Query Frame = 3
Query: 2766 CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF 3095
            C   + +  G I SPNYP  Y + ++C W ++   G  I L F+DF++E      +D L V +GA   +  L    G   P PM S  N + + F S+ +   RGF   +
Sbjct:   74 CGRTLRENSGVISSPNYPSEYGNDADCTWIVLAEQGDTISLVFNDFQLEER----FDSLEV-EGADPSSIWL---TGVGLPSPMISSKNWLRLHFVSNSNNSLRGFTAQY 175          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001629.1 (pep scaffold:Pmarinus_7.0:GL476369:34656:293612:-1 gene:ENSPMAG00000001441.1 transcript:ENSPMAT00000001629.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 2.900e-44
Identity = 152/508 (29.92%), Postives = 222/508 (43.70%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGF-TAYFQQEHDECKNMKHGCSHVCVNT---LGAYMC-ACDIGYELQA----------DGK--------TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGP----ENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF----YTDRNEC----EDKNGE--CEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG---------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNIN 3185
            A CG  +    G I+SPNYP  Y   K+C W++TV   Y I+L F  F +E +    YDFL I DG      L++ + G ++PG I++T N M++ F SD SV   GF   Y ++  + C +  H  +   + T   LG+ +   C  GY +Q           DGK         C   CGG    S+G + SP+YPSNY   + C++ I       +F  F  F           D++ VYDGP    +      G + G+  P    ST++++TI F  +     KGF   +     T   +C    E + G      F  N++  +   C PGY L+G    K   V                 C    T+  G I SP YP  Y +  NC W+I+   G  IQ+    F  E +    +D L VYDGA+  + +LG F G+  P  + S  N + + F SD SV   GF + + +I    L +  EP    +    G  Y +N
Sbjct: 1417 APCGVNLTGPSGIILSPNYPLPYPHGKECNWRVTVTAEYVISLTFIRFNMETN----YDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSVSTNGFHIEYREKPRESCFDPGHIQNGSRIGTDMKLGSTITYFCSAGYIIQGYSTLVCMMKDDGKPGWNRPTPVCSAPCGGKSSGSDGVVLSPSYPSNYTGGQNCLYSISVHNNFVVFGQFVYFQTSLN------DFVEVYDGPSQQSQLLSSLTGSHTGEALP---LSTSHQITIRFSPNKNTTAKGFHFIYQAVPRTSSTQCSSVPEPRFGRRVGSDFSANSVVKF--ECSPGYALNGVSAVKCTMVPNSLAQWNHSFPTCIVPCGGNSTERSGTILSPGYPEPYDNNLNCVWRILVPEGAGIQIQVVSFATEHN----WDSLEVYDGANADSPRLGSFSGTTLPSLINSTSNQLYLHFQSDLSVGAAGFHLIYTAI---GLTSCPEPVVPSNSIKIGDRYLVN 1902          

HSP 2 Score: 162.54 bits (410), Expect = 1.983e-40
Identity = 146/507 (28.80%), Postives = 217/507 (42.80%), Query Frame = 3
Query: 1713 ARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPG-PIKTTNNQMYIKFMSDSSVEKQGFTAYF------QQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGK----------------TCENACGGLIK-ESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKK---LGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTD-RNECED----KNGECEHFCVNTIGSYYCHCRPGYQLHGKKN--CKEKT------------VDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF 3095
            ARA +   +  G R+W      AP      +    A CG    A+EG ++SP +P+ Y  N +CI+ + V  G  I L   +F++   D+     L+I DG D   RL++     ++ G  I +T+N ++++F +DS     GF   +      Q E        +          G     C+ GY L  + +                +C+  CGG IK ES+G + SP YP+ Y  N  C W + A     I  +F  FD E       +D + V+DGP    +    L +  G   P  I S+ + L++ F SD  + K GF I F +     C D     NG           S    C+PGY+L G     C +K                C   +T   G I SPNYP+ YP    C W++  T  ++I LTF  F +E++    YD L +YDG    +  +    GSK P  ++S  NS+ + F SD SV   GF I +
Sbjct: 1045 ARALV--CLGGGRRLW-----DAP------LPRCVAECGRSSTANEGVLLSPKHPQKYDDNHECIYSVQVKPGMGIRLTARTFRLGPGDS-----LKIYDGRDGSARLMNAFTTSELNGKTINSTSNHLWLEFNTDSQGTDIGFQILYSSFKLTQCEDPGVPEFGYKVRDQGYFAGGTITYGCNPGYTLHGNKRLTCMSGERRAWDHPLPSCQAECGGEIKGESSGRILSPGYPAPYGHNLDCFWTLEAKPAHTISLHFVVFDTEAA-----HDLLKVWDGPSVPSQAGVLLKELSGSVLPDDIHSSQSSLSLHFQSDFFISKTGFAIQFSSAVAKSCRDPGVPANGTRIGVGREVGESVSFQCQPGYELQGAATITCMQKQNRYYWHPSPPSCTAPCGVNLTGPSGIILSPNYPLPYPHGKECNWRVTVTAEYVISLTFIRFNMETN----YDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSVSTNGFHIEY 1524          

HSP 3 Score: 162.54 bits (410), Expect = 2.291e-40
Identity = 132/472 (27.97%), Postives = 204/472 (43.22%), Query Frame = 3
Query: 1821 VCGGEIHASEGRIISPNYPEFYKPNKQCIWKIT-VPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDE--QKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC----------KNMKHGCSH---------VCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYT-DRNECEDK----NGE---------------CEHFCVNTIG--SYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI 3104
             CG  +    G I SPN+P  Y  N QC+W IT V  G +I + FE F++E+     +D L + DG  E   +  ++ + G  IP  + +T  QM++   +D SV   GF   FQ+  +            +    G SH              +G     C    +  A+   C   C       NG + SPNYP  Y  N  C+W ++A  +++I   F +FD+E      Q+D++ V  G   +   LG + G + P  + ST   L + F SD +   +GF I + T   NEC D     NG                CE   + T G     C  + G  +   +    +    C   ++   G I SP +P  Y    +CEW I    GH I++ F  F+ E +    YD L ++DG +  +  +G + G++ P  + S  N++L+ FT+D S    GF I + SI
Sbjct:  372 TCGSHLEGPSGVITSPNFPLKYDNNAQCMWTITAVNPGKTIQINFEKFELERD----FDMLTVGDGLTEGDPETAIAVLTGTNIPDVVVSTTGQMWLHLQTDESVNSLGFKIIFQEIAERSCGDPGVPQHGRREGSGFSHRDSLTFECQAAFELVGEKTITCQSNNQWSANVPHCIFPCFVNFTSPNGEVLSPNYPEGYGNNVNCVWLVLAEPRSRIHLLFHDFDIES-----QFDFLTVKAGERADTTVLGTFTGTEAPFHLASTGQVLRLEFQSDHSASGRGFNITYATFGHNECYDPGVPMNGRRFGDNFLLGSSVSFVCEEGFIKTQGFEEITCVTQGGSVIWNGQIPTCEATAPCGGLLSAPVGNILSPGWPGQYKDSLSCEWLIEAQQGHAIKIKFVRFQTEVN----YDVLQIHDGRTEGSPVVGSYHGTQVPQFLLSSGNTLLLIFTTDSSRSSFGFHIQYESI 830          

HSP 4 Score: 152.14 bits (383), Expect = 3.614e-37
Identity = 130/480 (27.08%), Postives = 212/480 (44.17%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFT----AYFQQEHDECKNMKHGCSHVCVNTLG---AYMCACDIGYELQADG----------------KTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINV--YDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNEC--------------EDKNGE----CEHFCV---NTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEI-TDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYD----GASIKNKQLGRFCGS-KTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            A CGG      G ++SP +P  Y  N  C WKI +PIG+ I   F +F  E     ++D+LEI+ G  E   ++ +  G  IP  + +T +   + F SD S  KQGF     AY  Q   + +   +G  +V  N  G   +    C  GY L                     +CE  CG  +   +G+++SP +P+ YP  + C W I+      IF NFT    E       YD+I V  +DGP+    +LG + G    + + ST++++ + F+SD +     F INF   + +               ED+  E     ++ C+     +GS    C+ G +L              T EI  ++ G I SP YP  YP+   C W +    G+ I L    F+ E      YD+L +YD    G + + ++L    G   +P+ + S  N + + +++D +  ++GF+I++ +
Sbjct: 1940 ARCGGTFDDFNGVVLSPGFPGNYPSNLDCTWKINLPIGFGIYFTFLNFSTEP----IHDYLEIKSGPAEAGTVIGRFSGPLIPASLISTMHVTTLYFHSDYSQNKQGFKISYEAYELQNCPDPRPFTNG--YVVGNNFGVGQSISFECFPGYVLIGSAVLTCQHGHSRHWSYPIPSCEAPCGSNVTGLSGTVYSPGFPNEYPNFQDCYWLIMVPPGNGIFLNFTVLQTEPV-----YDFITVWYWDGPDQRAPQLGLFSGNTAMESLYSTSDKILVKFHSDFSTSGL-FIINFSAYQLQSCQLPPLVANAEILMEDETFEIGDIIKYRCLLGFTLVGSEVLTCQLGTRLQANVASPTCQALCSTNEIRRESSGVILSPGYPSNYPNLQTCGWMLSVEKGYTITLYVEFFQSEKQ----YDELEIYDVVTQGPTSQGRRLAALSGDYSSPLNVTSASNQMFVRWSADHATSKKGFRISYTA 2403          

HSP 5 Score: 146.362 bits (368), Expect = 2.041e-35
Identity = 132/463 (28.51%), Postives = 196/463 (42.33%), Query Frame = 3
Query: 1851 GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFT-AYFQQEHDECKN---------------MKHGCSHVC----VNTLGAYMCACDI-GYELQADGK--TCENA--CGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYT---DRNECEDK----NGE--CEHFCVNTIGSYYCHCRPGYQL----------HGKKNCKEKTVDG-CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKS---QHNSILITFTSDGSVQRRGFKITF 3095
            G ++SPNYPE Y  N  C+W +       I L F  F IE      +DFL ++ G      +L    G + P  + +T   + ++F SD S   +GF   Y    H+EC +               +    S VC    + T G     C   G  +  +G+  TCE    CGGL+    G++ SP +P  Y  +  C W I A +   I   F  F  E       YD + ++DG       +G Y G + PQ + S+ N L + F +DS+    GF I + +   DR+ C D     NG+     F +    +Y   CRPGY L          + + N      D  C   I    G I SP YP  YP+  NC W I  + G  +Q  F  F++E+     +D L++ +  S  ++ L R  GS  P  + +    +    + F SD S+   GF +TF
Sbjct:  555 GEVLSPNYPEGYGNNVNCVWLVLAEPRSRIHLLFHDFDIESQ----FDFLTVKAGERADTTVLGTFTGTEAPFHLASTGQVLRLEFQSDHSASGRGFNITYATFGHNECYDPGVPMNGRRFGDNFLLGSSVSFVCEEGFIKTQGFEEITCVTQGGSVIWNGQIPTCEATAPCGGLLSAPVGNILSPGWPGQYKDSLSCEWLIEAQQGHAIKIKFVRFQTE-----VNYDVLQIHDGRTEGSPVVGSYHGTQVPQFLLSSGNTLLLIFTTDSSRSSFGFHIQYESIPVDRHSCLDPGIPVNGQRMGNDFSIRATVTY--SCRPGYALSHTNPLRCEANRRWNHPLPACDAPCGGYIQGHSGIILSPGYPDYYPNSLNCTWTIEVSHGKGVQFVFHTFQVEN----LHDYLLITENGSF-SQPLARLTGSTLPPVLHAGVYGNFQAQLRFISDFSMSYEGFNMTF 1001          

HSP 6 Score: 120.553 bits (301), Expect = 1.356e-27
Identity = 164/690 (23.77%), Postives = 258/690 (37.39%), Query Frame = 3
Query: 1725 ISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMC-----------ACDIGYEL--------QADGK------TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTN---ELTIAFYSDSTVQKKGFKINFYTD--RNECEDKNGEC------EHFCVNTIGSYYCHCRPGYQLHGKKNCK-------------EKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSK-----------------------TPVPMKSQHNSILITFTSDGSVQRRGFKI---------TFNSICD--------------------------------GKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSV---MAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            I+ +   GS IW     Q P+          A CGG + A  G I+SP +P  YK +  C W I    G++I +KF  F+ E +    YD L+I DG  E   ++    G Q+P  + ++ N + + F +DSS    GF      +++     +H C    +   G  M            +C  GY L        +A+ +       C+  CGG I+  +G + SP YP  YP +  C W I  S    + F F  F VE       +DY+ + +    +Q  L +  G   P  + +      +  + F SD ++  +GF + F  +     CED               V  + ++   C PGY+L G +                 + V  C    T   G + SP +P  Y     C + +   PG  I+LT   F +        D L +YDG     + +  F  S+                       T +  +  ++S  +T   D  V   G+K+         T    C+                                G  I  E    I S   Y  PY  N +C W LE      T+ L F+ F+ E      +D +K++DG SV      ++ +  G+ +P  I S   +L +HF SD  +S  GF  ++
Sbjct:  698 ITCVTQGGSVIW---NGQIPT------CEATAPCGGLLSAPVGNILSPGWPGQYKDSLSCEWLIEAQQGHAIKIKFVRFQTEVN----YDVLQIHDGRTEGSPVVGSYHGTQVPQFLLSSGNTLLLIFTTDSSRSSFGF----HIQYESIPVDRHSCLDPGIPVNGQRMGNDFSIRATVTYSCRPGYALSHTNPLRCEANRRWNHPLPACDAPCGGYIQGHSGIILSPGYPDYYPNSLNCTWTIEVSHGKGVQFVFHTFQVENL-----HDYLLITENGSFSQP-LARLTGSTLPPVLHAGVYGNFQAQLRFISDFSMSYEGFNMTFLAEYPLEPCEDPGTPTFSRRSGRSLDVGDVLAF--SCLPGYRLVGARALVCLGGGRRLWDAPLPRCVAECGRSSTANEGVLLSPKHPQKYDDNHECIYSVQVKPGMGIRLTARTFRLGPG-----DSLKIYDGRDGSARLMNAFTTSELNGKTINSTSNHLWLEFNTDSQGTDIGFQILYSSFKLTQCEDPGVPEFGYKVRDQGYFAGGTITYGCNPGYTLHGNKRLTCMSGERRAWDHPLPSCQAECGGEIKGESSGRILS-PGYPAPYGHNLDCFWTLEA-KPAHTISLHFVVFDTE----AAHDLLKVWDGPSVPSQAGVLLKELSGSVLPDDIHSSQSSLSLHFQSDFFISKTGFAIQF 1351          

HSP 7 Score: 109.768 bits (273), Expect = 2.883e-24
Identity = 119/479 (24.84%), Postives = 184/479 (38.41%), Query Frame = 3
Query: 1824 CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQE------------------HDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIF---FNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYY-------CHCRPGYQLHGKKN-------------------CKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITT-PGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQ--LGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICD 3110
            CGG +    G I SPN+P  Y  +  C W +    G +I+L F  F++E      YD LE+ +G D     L+   G  +P PI ++ N M ++FMSD    ++GF+A +Q                    + E   ++   S   V ++ A  C     + L    +  E  C  ++ +   S     + ++    +KC       +  +IF   F ++ F V  +  D +   + +    + NQK+L                NE  I   S S                 C D  GE EH     IGS +         C+ GY L G  +                   CK KT   C   +    G I SPN+P+ Y + + C W I    PG  IQ+ F  FE+E      +D L V DG +  + +  +    G+  P  + S    + +   +D SV   GFKI F  I +
Sbjct:   64 CGGTMRGPGGMISSPNFPSEYDNDADCTWIVLAEQGDTISLVFTDFQLEDQ----YDLLEV-EGADPHSIWLT---GMNLPSPIISSKNWMRLRFMSDKDRRQRGFSAQYQVNVCMTNNEEWPSLKAREYTYLEVVYVRSAISSASVYSITALRC-----HNLYESIRVSE-MCATVLGDDQVSTEKLEFSTHVIKKQKCYMHAQHHRSFRIFNRLFTYS-FKVMKRAVDLKSRGVKLPPSKDINQKQL--------------VLNEGGITQASSS-----------------CPDP-GEPEH--ATRIGSDFRLGAIVQFSCKEGYVLQGSSSILCQKVNDVFAAWSDSRPLCKAKT---CGSHLEGPSGVITSPNFPLKYDNNAQCMWTITAVNPGKTIQINFEKFELERD----FDMLTVGDGLTEGDPETAIAVLTGTNIPDVVVSTTGQMWLHLQTDESVNSLGFKIIFQEIAE 486          

HSP 8 Score: 93.9745 bits (232), Expect = 1.765e-19
Identity = 115/476 (24.16%), Postives = 188/476 (39.50%), Query Frame = 3
Query: 2289 CGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAK-IFFNFTEFDVEGKEKDCQYDYINVYDG--PENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFY-TDRNECED----KNGECEHFCVNTIGSYYCHCRPGYQLHGKKN--CKEKT---------VDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKI------------------------------------------------ITTPGHIIQLTFSD------------FEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVP-----MKSQHNSILITFTSDGSVQRRGFKITFNSI--CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            CG  ++  +G + SPN+P  Y  N +C+W I A    K I  NF +F++E   +D  +D + V DG    + +  +    G   P  + STT ++ +   +D +V   GFKI F       C D    ++G  E    +   S    C+  ++L G+K   C+            +  C    T  +GE+ SPNYP  Y +  NC W +                                                + + G +++L F              +    H EC YD  +  +G    +  L    GS          +K+Q    +   T  GSV   G   T  +   C G L A   P        +   Y  + +C WL+E   Q   +++KF+ F+ E      YD ++I+DG +  +P++G Y GT +P  + S    LL+ F +D + S+ GF  +Y ++P
Sbjct:  373 CGSHLEGPSGVITSPNFPLKYDNNAQCMWTITAVNPGKTIQINFEKFELE---RD--FDMLTVGDGLTEGDPETAIAVLTGTNIPDVVVSTTGQMWLHLQTDESVNSLGFKIIFQEIAERSCGDPGVPQHGRREGSGFSHRDSLTFECQAAFELVGEKTITCQSNNQWSANVPHCIFPCFVNFTSPNGEVLSPNYPEGYGNNVNCVWLVLAEPRSRIHLLFHDFDIESQFDFLTVKAGERADTTVLGTFTGTEAPFHLASTGQVLRLEFQSDHSASGRGFNITYATFGHNEC-YDPGVPMNGRRFGDNFL---LGSSVSFVCEEGFIKTQGFEEITCVTQGGSVIWNGQIPTCEATAPCGGLLSA---PVGNILSPGWPGQYKDSLSCEWLIEA-QQGHAIKIKFVRFQTE----VNYDVLQIHDGRTEGSPVVGSYHGTQVPQFLLSSGNTLLLIFTTDSSRSSFGFHIQYESIP 831          

HSP 9 Score: 92.8189 bits (229), Expect = 4.173e-19
Identity = 86/304 (28.29%), Postives = 137/304 (45.07%), Query Frame = 3
Query: 1803 VASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEI--RDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQ---GFTAYFQQE--------------HDECKNMKHGCSHVCV---NTLGAYMCACDIGYELQAD--GKTCENACGG--LIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYD----GPENNQKKLGKYCGK-KPPQPITSTTNELTIAFYSDSTVQKKGFKINF 2621
            + S +A CG  +    G + SP +P  Y   + C W I VP G  I L F   + E     VYDF+ +   DG D++   L    G      + +T++++ +KF SD S        F+AY  Q                DE   +     + C+     +G+ +  C +G  LQA+    TC+  C    + +ES+G + SP YPSNYP  + C W +   K   I        VE  + + QYD + +YD    GP +  ++L    G    P  +TS +N++ + + +D    KKGF+I++
Sbjct: 2107 IPSCEAPCGSNVTGLSGTVYSPGFPNEYPNFQDCYWLIMVPPGNGIFLNFTVLQTEP----VYDFITVWYWDGPDQRAPQLGLFSGNTAMESLYSTSDKILVKFHSDFSTSGLFIINFSAYQLQSCQLPPLVANAEILMEDETFEIGDIIKYRCLLGFTLVGSEVLTCQLGTRLQANVASPTCQALCSTNEIRRESSGVILSPGYPSNYPNLQTCGWMLSVEKGYTI-----TLYVEFFQSEKQYDELEIYDVVTQGPTSQGRRLAALSGDYSSPLNVTSASNQMFVRWSADHATSKKGFRISY 2401          

HSP 10 Score: 73.559 bits (179), Expect = 3.169e-13
Identity = 39/111 (35.14%), Postives = 64/111 (57.66%), Query Frame = 3
Query: 3123 ATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            +TE    I S   Y  PY+ N NC+W +  + +   +Q++ + F  E      +DS+++YDG++  +P +G + GT++P+LI S S  L +HF SD +V A GF   Y A+
Sbjct: 1774 STERSGTILS-PGYPEPYDNNLNCVWRI-LVPEGAGIQIQVVSFATEHN----WDSLEVYDGANADSPRLGSFSGTTLPSLINSTSNQLYLHFQSDLSVGAAGFHLIYTAI 1878          

HSP 11 Score: 68.5514 bits (166), Expect = 9.779e-12
Identity = 54/158 (34.18%), Postives = 75/158 (47.47%), Query Frame = 3
Query: 1815 QAVCG-GEIH-ASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRD----GHDEQKRLLSKICG-YQIPGPIKTTNNQMYIKFMSDSSVEKQGF-TAYFQQEHDECKNMKHG--CSHVCVNTLGAYMCACDIGYEL 2258
            QA+C   EI   S G I+SP YP  Y   + C W ++V  GY+I L  E F+ EK     YD LEI D    G   Q R L+ + G Y  P  + + +NQM++++ +D +  K+GF  +Y  Q      +  HG   S            AC  GY L
Sbjct: 2286 QALCSTNEIRRESSGVILSPGYPSNYPNLQTCGWMLSVEKGYTITLYVEFFQSEKQ----YDELEIYDVVTQGPTSQGRRLAALSGDYSSPLNVTSASNQMFVRWSADHATSKKGFRISYTAQYCSTPASPSHGLVLSQTGGQLGSGVRWACHTGYRL 2439          

HSP 12 Score: 63.929 bits (154), Expect = 2.749e-10
Identity = 35/109 (32.11%), Postives = 52/109 (47.71%), Query Frame = 3
Query: 3135 PQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            P  I     Y  PY   + C W + T+  +  + L F+ F +E      YD + IYDG    +P+I    G+ +P  I S   ++ + F SDD+VS  GF  EY   P+
Sbjct: 1426 PSGIILSPNYPLPYPHGKECNWRV-TVTAEYVISLTFIRFNME----TNYDFLHIYDGPGSSSPLIASLQGSKLPGRIESTGNSMFMAFRSDDSVSTNGFHIEYREKPR 1529          

HSP 13 Score: 58.5362 bits (140), Expect = 1.072e-8
Identity = 31/116 (26.72%), Postives = 60/116 (51.72%), Query Frame = 3
Query: 3102 ICDGKLIAT--EEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAP--MIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFK 3437
            +C  K   +  E P  + +   +   Y+ N  C+W +  +N   T+Q+ F  FE+E +    +D + + DG +   P   I    GT++P ++ S +G + +H  +D++V++ GFK
Sbjct:  367 LCKAKTCGSHLEGPSGVITSPNFPLKYDNNAQCMWTITAVNPGKTIQINFEKFELERD----FDMLTVGDGLTEGDPETAIAVLTGTNIPDVVVSTTGQMWLHLQTDESVNSLGFK 478          

HSP 14 Score: 57.3806 bits (137), Expect = 2.801e-8
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 3
Query: 2751 KTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF 3095
            +  + C   +    G I SPN+P  Y + ++C W ++   G  I L F+DF++E      YD L V +GA   +  L    G   P P+ S  N + + F SD   ++RGF   +
Sbjct:   59 RARESCGGTMRGPGGMISSPNFPSEYDNDADCTWIVLAEQGDTISLVFTDFQLEDQ----YDLLEV-EGADPHSIWL---TGMNLPSPIISSKNWMRLRFMSDKDRRQRGFSAQY 165          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006495.1 (pep scaffold:Pmarinus_7.0:GL479301:959:30909:1 gene:ENSPMAG00000005870.1 transcript:ENSPMAT00000006495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 1.338e-37
Identity = 102/332 (30.72%), Postives = 153/332 (46.08%), Query Frame = 3
Query: 1824 CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGF--------TAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKT----------------CENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYT-DRNECEDKNGECEHFCVN---TIGSYYC-HCRPGYQLHG 2732
            CGG +   +G I++P +PE Y  N  C+WKITVP G  + +   SF  E++    +D LEI DG D     L    G  IP  + +T+N +Y+ F SD SV   GF         A   +       +K G  ++  + +   M  C+ GY LQ                     C   CGG++ E  G + SP +P NYP N  C W+++       +F F  F  E       +D++ +  GP   Q+ +G++ G +PP P  STT++ T+ F SD +  K+GF+++F     + C D N       +    T+GS     C PGY L G
Sbjct:  103 CGGNLTELKGAILTPGFPEPYDNNLNCVWKITVPEGAGVKMHVFSFATEQN----WDALEIYDGGDANSPRLGSFSGTSIPAVLNSTSNSLYLHFHSDISVSAAGFHIEYTAVGLASCPEPELPTNGVKVGDRYLVNDVV---MFQCEQGYTLQGPTHATCMPGPVRRWNFPPPLCIAQCGGVLTELTGVILSPGFPGNYPSNLDCTWKVLLPMGYGAYFAFVNFSTEPL-----HDFVEILSGPPEAQEAIGRFSGARPPAPALSTTHDTTVHFQSDYSQNKQGFRLSFQAYQLSSCPDPNPFRNGLVMGAEYTVGSSVSFRCLPGYTLVG 422          

HSP 2 Score: 114.39 bits (285), Expect = 5.761e-27
Identity = 99/390 (25.38%), Postives = 162/390 (41.54%), Query Frame = 3
Query: 2079 TTNNQMYIKFMSDSSVEKQGFTAYFQQ----EHDECKNM-------KHGCSHVCVNTLGAYMCACDIGYELQADGK------------------TCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF-YTDRNECEDK----NGE--CEHFCVNTIGSYYCHCRPGYQLHGKKN--CKEKTV-----------DGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            ++ NQ+ + F S      +GF   +Q       D+C ++       + G S    + L      C+ GY LQ                      TC   CGG + E  G++ +P +P  Y  N  C+W+I   + A +  +   F  E       +D + +YDG + N  +LG + G   P  + ST+N L + F+SD +V   GF I +       C +     NG    + + VN +  +   C  GY L G  +  C    V             C   +T+  G I SP +P  YPS  +C WK++   G+     F +F  E      +D + +  G     + +GRF G++ P P  S  +   + F SD S  ++GF+++F +
Sbjct:    7 SSGNQITLTFTSSHDASGKGFHFVYQAVPRTSSDQCSSVPEPKFGQRLGNSFSVDSVL---RFECNSGYILQGARAIQCQKVPNSLAQWNESYPTCVVPCGGNLTELKGAILTPGFPEPYDNNLNCVWKITVPEGAGVKMHVFSFATEQN-----WDALEIYDGGDANSPRLGSFSGTSIPAVLNSTSNSLYLHFHSDISVSAAGFHIEYTAVGLASCPEPELPTNGVKVGDRYLVNDVVMF--QCEQGYTLQGPTHATCMPGPVRRWNFPPPLCIAQCGGVLTELTGVILSPGFPGNYPSNLDCTWKVLLPMGYGAYFAFVNFSTEP----LHDFVEILSGPPEAQEAIGRFSGARPPAPALSTTHDTTVHFQSDYSQNKQGFRLSFQA 382          

HSP 3 Score: 80.8777 bits (198), Expect = 4.457e-16
Identity = 64/246 (26.02%), Postives = 106/246 (43.09%), Query Frame = 3
Query: 2547 STTNELTIAFYSDSTVQKKGFKINF----YTDRNEC----EDKNGE--CEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG---------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLE 3209
            S+ N++T+ F S      KGF   +     T  ++C    E K G+     F V+++  + C+   GY L G +  + + V                 C   +T+  G I +P +P  Y +  NC WKI    G  +++    F  E +    +D L +YDG    + +LG F G+  P  + S  NS+ + F SD SV   GF I + ++    L +  EP+   +    G  Y +N   ++  E
Sbjct:    7 SSGNQITLTFTSSHDASGKGFHFVYQAVPRTSSDQCSSVPEPKFGQRLGNSFSVDSVLRFECNS--GYILQGARAIQCQKVPNSLAQWNESYPTCVVPCGGNLTELKGAILTPGFPEPYDNNLNCVWKITVPEGAGVKMHVFSFATEQN----WDALEIYDGGDANSPRLGSFSGTSIPAVLNSTSNSLYLHFHSDISVSAAGFHIEYTAV---GLASCPEPELPTNGVKVGDRYLVNDVVMFQCE 243          

HSP 4 Score: 80.4925 bits (197), Expect = 6.882e-16
Identity = 40/113 (35.40%), Postives = 57/113 (50.44%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQ 2156
            A CGG +    G I+SP +P  Y  N  C WK+ +P+GY     F +F  E     ++DF+EI  G  E +  + +  G + P P  +T +   + F SD S  KQGF   FQ
Sbjct:  273 AQCGGVLTELTGVILSPGFPGNYPSNLDCTWKVLLPMGYGAYFAFVNFSTEP----LHDFVEILSGPPEAQEAIGRFSGARPPAPALSTTHDTTVHFQSDYSQNKQGFRLSFQ 381          

HSP 5 Score: 73.1738 bits (178), Expect = 1.225e-13
Identity = 43/117 (36.75%), Postives = 65/117 (55.56%), Query Frame = 3
Query: 3105 CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            C G L  TE    I +   +  PY+ N NC+W + T+ +   V++    F  E      +D+++IYDG    +P +G + GTS+P ++ S S +L +HF SD +VSA GF  EY AV
Sbjct:  103 CGGNL--TELKGAILT-PGFPEPYDNNLNCVWKI-TVPEGAGVKMHVFSFATEQN----WDALEIYDGGDANSPRLGSFSGTSIPAVLNSTSNSLYLHFHSDISVSAAGFHIEYTAV 211          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008884.1 (pep scaffold:Pmarinus_7.0:GL477160:356:88814:-1 gene:ENSPMAG00000008042.1 transcript:ENSPMAT00000008884.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 2.547e-36
Identity = 129/471 (27.39%), Postives = 194/471 (41.19%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPI-KTTNNQMYIKFMSDSSVEKQGF-TAYFQQEHDECKN-----MKHGCSHVCVNTLGAYMCACDIGYELQADGKT------------------CENACGGLIKE-SNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTD-RNECEDK----NGECEHFCVNTIGSYYCHCRPGYQLHG--KKNCKEKT------------VDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF 3095
            A CG  +   +G ++SPNYP  Y  N +C++ I V  G+ + L    F++ + D      L + DG D   R+L    G  +   I  +T+N ++++F SD  V   GF   Y   E   C++       H  +        +    CD GY     G+T                  C   CGG I   S G++ SP YP+ Y  N  C W I  +    I  +F  FD E       +D + ++DG   +   L +  G   P  + ST + +T+ F +D  + + GF + F +   +EC D     NG           S    C PGY L G  +  C +              V  C   +T   G I SPNYP  YP    C W I      ++ L+F    +E++    YD L  YDG  +    LG F G + P  ++S  N + + F SD ++   GF I +
Sbjct:  412 AECGTSLRGDDGVLLSPNYPLVYGNNHECVYDIAVAPGHGVQLAAVHFRLGRGDA-----LTVYDGLDGSSRVLGDFTGTAMQDSIINSTSNHLHLEFNSDGDVVDGGFRLVYTSFELLRCEDPGVPEFGHVVADEGHFAGSSVTFGCDPGY--TPHGRTVVTCLTGERRVWDFPLPSCLAECGGAIAGVSGGTILSPGYPNAYEHNLHCEWTIEVNPGFTISLHFQVFDTEAS-----HDELRIWDGSAESGILLRELSGPVLPDTVHSTLHLVTLHFNTDFFISRPGFALRFTSSVASECRDPGVPTNGSRSGDGRRPGDSVLFQCDPGYALQGPPRMTCVQAESRFFWQPSLPICVAPCGGNLTGPAGFILSPNYPQPYPPSHECHWTITVNEDFVVALSFLSLNLEAN----YDFLHAYDGGDVLAPLLGSFHGLQLPGRVESGGNVMHLAFHSDKTINAGGFHIEY 866          

HSP 2 Score: 145.976 bits (367), Expect = 9.943e-36
Identity = 131/492 (26.63%), Postives = 209/492 (42.48%), Query Frame = 3
Query: 1815 QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQ---EHDECKNMK---HGCSHVCVNTLGAYM-CACDIGYELQAD--------------GKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTT---NELTIAFYSDSTVQKKGFKINFYT-DRNECEDKNGECEHFCVNTIGSYYCH-----------CRPGYQLHGKKNC-------------KEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVP-MKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEP 3137
            +A CG  + A  G I SP +P  YK +  C W I V  G +I + F+S F+ E +    YD LE+ DG      +L    G Q+P  + ++ N +++ F +DSS    GF  ++++   +   C ++    HG       ++G+ +  +C+ G+ L  D                TC+  CGG IK S G++ SP +P+ YP +  C W +  S    + F F    +E      Q+DY+ V +   +    L +  G   P P+++      +  + F SD ++  +GF I F   +   C D         V  +GS               C  GY+L G                   + V  C   +    G + SPNYP+ Y +   C + I   PGH +QL    F +        D L VYDG    ++ LG F G+      + S  N + + F SDG V   GF++ + S    +L+  E+P
Sbjct:   64 EAPCGSHLTAPSGTIFSPGWPSSYKDSLTCEWVIEVNKGNAIKITFQSRFQTEPN----YDVLEVHDGSSAYSPVLGAFHGTQVPLFLVSSGNHLFLLFTTDSSHSGMGFQLHYERVTWDAHSCPDLPVPVHGRRLGGDFSIGSSVEFSCEPGFSLSHDLPLTCQDNHQWTQQLPTCDALCGGYIKASTGTILSPRFPNFYPNSLNCTWTVEVSHGKGVKFTFHTLHLE-----SQHDYLLVTES-GSFASPLARITGAALPPPLSAGMLGNYQAQLRFVSDFSMSYEGFNITFSEYELEPCRDPG-------VPALGSRLGSGLLVGDAVVFLCDAGYRLEGAARLVCLGGGRQAWSAPLPRCVAECGTSLRGDDGVLLSPNYPLVYGNNHECVYDIAVAPGHGVQLAAVHFRLGRG-----DALTVYDGLDGSSRVLGDFTGTAMQDSIINSTSNHLHLEFNSDGDVVDGGFRLVYTSF---ELLRCEDP 530          

HSP 3 Score: 145.206 bits (365), Expect = 1.786e-35
Identity = 128/483 (26.50%), Postives = 203/483 (42.03%), Query Frame = 3
Query: 1818 AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKT---TNNQMYIKFMSDSSVEKQGFTAYFQQ-EHDECKNMKHGCSHVCVNTLG-----------AYMCACDIGYELQADGKT----------------CENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQP-ITSTTNELTIAFYSDSTVQKKGFKINFYT-DRNECEDKN--------GECEHFCVNTIGSYYCHCRPGYQLHGK---------KNCKEKTVDGCTYEITDA-----HGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS 3101
            A+CGG I AS G I+SP +P FY  +  C W + V  G  +   F +  +E      +D+L + +        L++I G  +P P+      N Q  ++F+SD S+  +GF   F + E + C++         V  LG           A +  CD GY L+   +                 C   CG  ++  +G L SPNYP  Y  N +C++ I  +    +      F +       + D + VYDG + + + LG + G       I ST+N L + F SD  V   GF++ + + +   CED           +  HF  +++      C PGY  HG+         +   +  +  C  E   A      G I SP YP  Y    +CEW I   PG  I L F  F+ E+    ++D+L ++DG++     L    G   P  + S  + + + F +D  + R GF + F S
Sbjct:  238 ALCGGYIKASTGTILSPRFPNFYPNSLNCTWTVEVSHGKGVKFTFHTLHLESQ----HDYLLVTES-GSFASPLARITGAALPPPLSAGMLGNYQAQLRFVSDFSMSYEGFNITFSEYELEPCRDPG-------VPALGSRLGSGLLVGDAVVFLCDAGYRLEGAARLVCLGGGRQAWSAPLPRCVAECGTSLRGDDGVLLSPNYPLVYGNNHECVYDIAVAPGHGVQLAAVHFRLG------RGDALTVYDGLDGSSRVLGDFTGTAMQDSIINSTSNHLHLEFNSDGDVVDGGFRLVYTSFELLRCEDPGVPEFGHVVADEGHFAGSSV---TFGCDPGYTPHGRTVVTCLTGERRVWDFPLPSCLAECGGAIAGVSGGTILSPGYPNAYEHNLHCEWTIEVNPGFTISLHFQVFDTEA----SHDELRIWDGSAESGILLRELSGPVLPDTVHSTLHLVTLHFNTDFFISRPGFALRFTS 695          

HSP 4 Score: 118.627 bits (296), Expect = 3.275e-27
Identity = 113/402 (28.11%), Postives = 163/402 (40.55%), Query Frame = 3
Query: 1803 VASYQAVCGGEIHA-SEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQE-HDECKNMKHGCSHVCVNTLGA-----------YMCACDIGYELQADGKT-----------------CENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFY-TDRNECED----KNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG---------------CTYEITDAHGEIKSPNYPVTYPSKSNCEWKI 2858
            + S  A CGG I   S G I+SP YP  Y+ N  C W I V  G++I+L F+ F  E      +D L I DG  E   LL ++ G  +P  + +T + + + F +D  + + GF   F      EC++         V T G+            +  CD GY LQ   +                  C   CGG +    G + SPNYP  YPP+ +C W I  ++   +  +F   ++E       YD+++ YDG +     LG + G + P  + S  N + +AF+SD T+   GF I +    R  C D     NG      +    S    C  GY LHG         D                C    T   G I SPNYP  Y    +C + +
Sbjct:  580 LPSCLAECGGAIAGVSGGTILSPGYPNAYEHNLHCEWTIEVNPGFTISLHFQVFDTEAS----HDELRIWDGSAESGILLRELSGPVLPDTVHSTLHLVTLHFNTDFFISRPGFALRFTSSVASECRDPG-------VPTNGSRSGDGRRPGDSVLFQCDPGYALQGPPRMTCVQAESRFFWQPSLPICVAPCGGNLTGPAGFILSPNYPQPYPPSHECHWTITVNEDFVVALSFLSLNLE-----ANYDFLHAYDGGDVLAPLLGSFHGLQLPGRVESGGNVMHLAFHSDKTINAGGFHIEYREKPRESCFDPGSIANGSRLGSDLRLGSSVTFSCGTGYSLHGYSTLLCIMGDDGRPAWNRPLPACRAPCGGHSTGQEGSILSPNYPGNYSVMQSCFYSV 965          

HSP 5 Score: 68.1662 bits (165), Expect = 9.003e-12
Identity = 41/119 (34.45%), Postives = 58/119 (48.74%), Query Frame = 3
Query: 3105 CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            C G L  T    FI S   Y  PY  +  C W + T+N+   V L FL   +E      YD +  YDG  V+AP++G + G  +P  + S    + + F SD T++A GF  EY   P+
Sbjct:  761 CGGNL--TGPAGFILS-PNYPQPYPPSHECHWTI-TVNEDFVVALSFLSLNLE----ANYDFLHAYDGGDVLAPLLGSFHGLQLPGRVESGGNVMHLAFHSDKTINAGGFHIEYREKPR 871          

HSP 6 Score: 58.151 bits (139), Expect = 1.265e-8
Identity = 36/145 (24.83%), Postives = 68/145 (46.90%), Query Frame = 3
Query: 3015 MKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFL-HFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            M++Q    +     DG++          + C   L A   P        + + Y  +  C W++E +N+   +++ F   F+ EP     YD ++++DGSS  +P++G + GT +P  + S   +L + F +D + S  GF+  Y
Sbjct:   37 MRTQGYESITCVLQDGNIHWSSTIPKCEAPCGSHLTA---PSGTIFSPGWPSSYKDSLTCEWVIE-VNKGNAIKITFQSRFQTEPN----YDVLEVHDGSSAYSPVLGAFHGTQVPLFLVSSGNHLFLLFTTDSSHSGMGFQLHY 173          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO41783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3J5])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 392/880 (44.55%), Postives = 545/880 (61.93%), Query Frame = 3
Query:  840 LKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPR-PPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESL--DCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVP-IGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKD-CQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTP-YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTS---MPTLITSQSGNLLIHFVSDDTVSAKGFKAEYL 3449
            +KR T   R RRAAT+F  R W  G+IP+ I   ++ E KATI++AMRHWEN+TCLSFI + + ++ +I F +  CGCCSYVGR+     Q ISIGKNCDK GI++HE+GH++GFWHEHTRPDRD  V+I+ EN+  G+  NF+K+   E+DS  E YDY+SIMHY K TF+ +    TI PK      P IGQR  LS GDIRQT K+Y CP+CG+TL E S  F+SP   + +       C+WRISVT GER+ LN + FH+ ++    C  +++E+RDG    S+LIGR+C       I S GSR+WI++K+       GF A Y+  CGG I  + G I SP YP +Y  +K+C+W I +P  G  + ++F +F +E H+ C YD+L++ DG DE    + K CG +IPG +++ ++ + IKF SD+S+ K GF   F  E +EC N   GCS +C NTLG Y CAC  GYEL +DGK CE ACGG++   NG++ SP+YP++YP NK+C+WRI      +I   F +F +EG     C+YDY+ V D   +  K LG+YCG K P+ +TS +N + + F SD T  ++GF   +Y D +EC ++ G C+H CVNTIGSY C C+PG+ LH  + +CKE +  G T  +T   G I SPN+P  Y  K +C WKI  TPG  ++L F   +IE  +EC YD + V+ G   + + LGR CG+  P P +S+ + +LI F SD  + +RGFK  + + C   L A  + +  +SH AYG   Y     C W L   N    ++L+F  F++E E  C+YD V I DG+S  +P++G+ CG+S    P    S    + I FV+D T   KGF AEY+
Sbjct:    1 MKRVT---RQRRAATAFVGRLWPGGVIPFEIADEYTGEQKATILQAMRHWENFTCLSFI-EHTEEEDFIYFHKGRCGCCSYVGRKGNGR-QGISIGKNCDKFGIIVHEIGHLVGFWHEHTRPDRDQFVEIIRENIKKGEGHNFQKLTKAEIDSRGEEYDYKSIMHYGKNTFATSLNHVTILPKRSGDMVPAIGQREHLSLGDIRQTIKMYRCPECGRTLQEPSGAFTSPGYPSPYPL--GRHCEWRISVTPGERIVLNFTVFHLKKTSFNKCKNDFVEVRDGHGRESNLIGRFCGTRVPPSIWSTGSRLWIKFKSDGVESRPGFKAVYETRCGGPIRKAHGTIQSPKYPSWYPSSKECVWTIALPGKGSRVGMRFVAFDVEDHEQCHYDYLQLFDGQDEWAPSIGKFCGKEIPGEVRSNSSYLTIKFKSDASINKPGFYLSFFSERNECNNNNGGCSQICQNTLGNYKCACYPGYELHSDGKNCEAACGGVLSNGNGTITSPSYPASYPKNKRCLWRITGPSGQRISLKFNDFRLEGNGNGVCRYDYVEVRD---HENKILGRYCGSKNPETVTSPSNVMWVEFRSDHTQSRRGFSAKYYADEDECRERKGGCQHICVNTIGSYRCTCKPGFVLHPDQHSCKEASDCGST--VTSLTGLIMSPNFPGVYQHKKDCTWKITVTPGSHVELNFRFLQIEEAKECRYDYVEVFSGTGHQAESLGRICGNNLPSPFRSRAHKMLIKFHSDSLIAKRGFKARYTAHCGANLNAVSQKRIFYSHPAYGDDNYGPKMKCNWTLTARNG--FIKLRFKEFDIEKEAYCSYDYVNIRDGNSTSSPLLGKQCGSSGKKGPLEFVSTGNKMYIEFVTDVTNQHKGFIAEYV 866          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO43471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYJ3])

HSP 1 Score: 324.324 bits (830), Expect = 8.230e-98
Identity = 216/615 (35.12%), Postives = 311/615 (50.57%), Query Frame = 3
Query:  858 RKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKA---------------CCPRPPIGQRIMLSPGDIRQTNKLYNCP---KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRI---SVTEGERVSLNISEFHI----PESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPE--NNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF 2621
            R+R  RAA + K   W +G +PY I   F+   +  I+ AMR+WE  TCL F+P R+  + YI    K  GCCS VGR      Q + +G  C   G ++HELGHVIGFWHE  RPDRDD+V++L +N+V G+  NF K+    V+SL++ +DYQSIM Y    FS +N   T++ K                   R    Q   LS  DI QTN LY C    + G+ L+E      SP     +  S   D  W I    +   + ++L    F +    P+      +YLEIR+G  E +  + + C   A  P +    R  +  +  A +     V      C   +    G I SP YP  Y  N  CIW+I+VP G+ IAL F  F   + D C  D+LE+R+G     +L+S  CG   P  + T+ N + I   S  +  K G  A F+  +  C+    GCSH C NT G Y C+C  GY L  D +TC++ CGG++    G + SPNYPS+YP    C+W+I++ K   +   F  F++E  E  CQYDY+++    +  +  + +G++CG   P  +    +E+ I F SDSTVQ+KGF+  +
Sbjct:    1 RRRVSRAAIANKEGLWKNGTVPYIIGPFFTDAVRGRILNAMRNWEKQTCLRFVP-RTDQRDYIEIRLKP-GCCSAVGRVGGR--QEVFLGYGCHGFGTILHELGHVIGFWHEQMRPDRDDYVEVLHQNIVEGEKHNFAKLPVSSVNSLDQIFDYQSIMLYGTNDFS-SNYGRTLKAKLSRFVWKQQGGIDYFQLHTREGASQ---LSRRDIIQTNLLYKCALSHENGEILVESRGRLMSPNFPRPYPRS--RDLSWTILPRRMRSNDVLALVFEFFLVGTAKPDGECENGDYLEIREGKGELAPYLVKLCG--ARKPFVIAVPRDSLYVRLHATNDTVAIVTP--TSCYIMLSDLNGTISSPGYPTPYPDNTDCIWQISVPTGHRIALAFIDFDFRQEDGCT-DYLEMREGEKATSQLVSVHCGRDFPQNLTTSGNHLRIATHSGQAGRKGG--AGFKARYQACERDNGGCSHNCTNTYGDYFCSCPQGYYLDKDQRTCKDLCGGILYGPKGIIQSPNYPSSYPSRVGCLWQILSPKGKHVKLTFETFELE-SEAHCQYDYVDIRAKYQISDKLRPVGRFCGNARPPAMEPKEDEIWINFQSDSTVQRKGFRAQY 597          

HSP 2 Score: 184.111 bits (466), Expect = 5.938e-49
Identity = 134/436 (30.73%), Postives = 204/436 (46.79%), Query Frame = 3
Query: 1830 GEIHA-SEGRIISPNYPEFYKPNKQCIWKITVPIGYS---IALKFESFKI---EKHDTCVY-DFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQL-HGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNK--QLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI 3104
            GEI   S GR++SPN+P  Y  ++   W I      S   +AL FE F +   +    C   D+LEIR+G  E    L K+CG + P  I    + +Y++                               H   +T+                      +C  ++ + NG++ SP YP+ YP N  CIW+I      +I   F +FD   +++D   DY+ + +G +   + +  +CG+  PQ +T++ N L IA +S    +K G    F      CE  NG C H C NT G Y+C C  GY L   ++ CK    D C   +    G I+SPNYP +YPS+  C W+I++  G  ++LTF  FE+ES   C YD + +     I +K   +GRFCG+  P  M+ + + I I F SD +VQR+GF+  +  +
Sbjct:  219 GEILVESRGRLMSPNFPRPYPRSRDLSWTILPRRMRSNDVLALVFEFFLVGTAKPDGECENGDYLEIREGKGELAPYLVKLCGARKPFVIAVPRDSLYVRL------------------------------HATNDTVAI----------------VTPTSCYIMLSDLNGTISSPGYPTPYPDNTDCIWQISVPTGHRIALAFIDFDF--RQEDGCTDYLEMREGEKATSQLVSVHCGRDFPQNLTTSGNHLRIATHSGQAGRKGG--AGFKARYQACERDNGGCSHNCTNTYGDYFCSCPQGYYLDKDQRTCK----DLCGGILYGPKGIIQSPNYPSSYPSRVGCLWQILSPKGKHVKLTFETFELESEAHCQYDYVDIRAKYQISDKLRPVGRFCGNARPPAMEPKEDEIWINFQSDSTVQRKGFRAQYTFV 600          

HSP 3 Score: 103.219 bits (256), Expect = 1.398e-22
Identity = 78/278 (28.06%), Postives = 115/278 (41.37%), Query Frame = 3
Query: 2754 TVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRG---FKITFNS--------------------------------------ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKI---YDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            T   C   ++D +G I SP YP  YP  ++C W+I    GH I L F DF+      CT D L + +G    ++ +   CG   P  + +  N + I  T  G   R+G   FK  + +                                      +C G L     P+ I     Y + Y     CLW + +   +  V+L F  FE+E E  C YD V I   Y  S  + P +G++CG + P  +  +   + I+F SD TV  KGF+A+Y  V
Sbjct:  330 TPTSCYIMLSDLNGTISSPGYPTPYPDNTDCIWQISVPTGHRIALAFIDFDFRQEDGCT-DYLEMREGEKATSQLVSVHCGRDFPQNLTTSGNHLRIA-THSGQAGRKGGAGFKARYQACERDNGGCSHNCTNTYGDYFCSCPQGYYLDKDQRTCKDLCGGILYG---PKGIIQSPNYPSSYPSRVGCLWQILSPKGK-HVKLTFETFELESEAHCQYDYVDIRAKYQISDKLRP-VGRFCGNARPPAMEPKEDEIWINFQSDSTVQRKGFRAQYTFV 600          

HSP 4 Score: 73.1738 bits (178), Expect = 3.514e-13
Identity = 54/234 (23.08%), Postives = 98/234 (41.88%), Query Frame = 3
Query: 2778 ITDAHGEIKSPNYPVTYPSKSNCEWKII---TTPGHIIQLTFSDFEIESHQ---EC-TYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLI--HFVSDDTVSAKGFKAEYLA 3452
            + ++ G + SPN+P  YP   +  W I+        ++ L F  F + + +   EC   D L + +G       L + CG++ P  +    +S+ +   +          I   + C    I   +     S   Y TPY  N +C+W + ++     + L F+ F+   E+ CT D +++ +G    + ++  +CG   P  +T+   +L I  H          GFKA Y A
Sbjct:  222 LVESRGRLMSPNFPRPYPRSRDLSWTILPRRMRSNDVLALVFEFFLVGTAKPDGECENGDYLEIREGKGELAPYLVKLCGARKPFVIAVPRDSLYVRLHATNDT----VAIVTPTSC---YIMLSDLNGTISSPGYPTPYPDNTDCIWQI-SVPTGHRIALAFIDFDFRQEDGCT-DYLEMREGEKATSQLVSVHCGRDFPQNLTTSGNHLRIATHSGQAGRKGGAGFKARYQA 446          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO42421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T1])

HSP 1 Score: 156.377 bits (394), Expect = 2.159e-43
Identity = 87/201 (43.28%), Postives = 116/201 (57.71%), Query Frame = 3
Query:  876 AATSFKFRTWTHGIIPYYIQANFSSETKAT--IMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNC 1472
            A  S   + W  G++ Y +   F   ++A   + +A+  +E YTC+ F  K ++D  Y+   ++  GC S+VGR+     Q +S+   C  KG +IHELGH +GF+HE TRPDRDD+V IL EN+ +G   NF K  + EVDSL   YDY SIMHY    FS AN + TI  K   P    GQR  LSP DI+Q N LY C
Sbjct:    3 ARGSITQKLWPGGVVVYELDPRFERSSRAMEKLTQAISDYEKYTCIRFRKKTANDNDYVYIKDRG-GCRSHVGRKGGK--QYLSLSSGCWHKGTIIHELGHALGFFHEQTRPDRDDYVTILFENIRLGMASNFMKHSAGEVDSLGTPYDYGSIMHYGPKIFS-ANGKPTIVAKK--PGVKFGQRDGLSPIDIKQVNLLYKC 197          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO30194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H5])

HSP 1 Score: 154.836 bits (390), Expect = 5.718e-43
Identity = 86/191 (45.03%), Postives = 110/191 (57.59%), Query Frame = 3
Query:  903 WTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANK-EWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNC 1472
            W +G IP+ I     ++ K  I KA+RHW   TCL F  KR+ D  YI F  +T GC SYVGR   +  Q IS+G  C+  G +IHE+GH IGFWHE +R DRDD++ I+ EN++      F KM    +DS+  AYD+ SIMHY    FS+  K    IR K       IGQR  LS  DI Q + +YNC
Sbjct:    4 WPNGEIPFRISTRLPTKFKKEIRKAIRHWRRKTCLRFRNKRADDTDYIKFVYET-GCWSYVGRAGGE--QKISVGPGCEFVGTIIHEIGHAIGFWHEQSRRDRDDYIRIIRENILPDALDQFNKMPKRLMDSMGYAYDFYSIMHYGAKFFSRNGKPTIKIRKKYRDLDAKIGQRKGLSWIDIAQVHAMYNC 191          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO44472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVK4])

HSP 1 Score: 155.606 bits (392), Expect = 1.322e-42
Identity = 81/238 (34.03%), Postives = 135/238 (56.72%), Query Frame = 3
Query: 2766 CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS--ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPEN------QCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            C   I  A+G I SP YP  YP+  +C W I  + G+ I   F DF++E H +C  D + +YDG+S+   +LG +CG++ PVP++S+ +S+ I F+SD   + +GFK  +NS  +C G     E      +   Y   Y IN +C++ +       T++  F+ F +EP +      +C +D V+++DG +VMAP +G++CG+     + S    +L+  +SD +V++KGFK  Y A+
Sbjct:    3 CGGRIMRANGYILSPRYPNAYPANQDCTWIITASRGYEISFAFLDFQLEGHPKCLNDWVKIYDGSSVMAPRLGHYCGNQLPVPVRSRGSSLYIHFSSDDVTELKGFKAMYNSSLVCGG---TYEGLHGSLTSPNYPNNYYINSDCVYKI-VAPVGYTIKATFVDFALEPASGRQPVGRC-FDYVQVFDGDTVMAPSLGKFCGSLARFHLVSTGNVMLVRLISDRSVNSKGFKLAYSAI 235          

HSP 2 Score: 126.716 bits (317), Expect = 1.184e-32
Identity = 85/270 (31.48%), Postives = 125/270 (46.30%), Query Frame = 3
Query: 1824 CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVE---GKEKDCQ-YDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF 2621
            CGG I  + G I+SP YP  Y  N+ C W IT   GY I+  F  F++E H  C+ D+++I DG       L   CG Q+P P+++  + +YI F SD   E +GF A +                                             CGG  +  +GSL SPNYP+NY  N  C+++I+A     I   F +F +E   G++   + +DY+ V+DG       LGK+CG      + ST N + +   SD +V  KGFK+ +
Sbjct:    3 CGGRIMRANGYILSPRYPNAYPANQDCTWIITASRGYEISFAFLDFQLEGHPKCLNDWVKIYDGSSVMAPRLGHYCGNQLPVPVRSRGSSLYIHFSSDDVTELKGFKAMYNSSL----------------------------------------VCGGTYEGLHGSLTSPNYPNNYYINSDCVYKIVAPVGYTIKATFVDFALEPASGRQPVGRCFDYVQVFDGDTVMAPSLGKFCGSLARFHLVSTGNVMLVRLISDRSVNSKGFKLAY 232          

HSP 3 Score: 119.013 bits (297), Expect = 6.406e-30
Identity = 68/230 (29.57%), Postives = 108/230 (46.96%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA--VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHD------TCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGF 2141
            KCG  ++  +    SP   N   +    DC W I+ + G  +S    +F +     C  ++++I DG    +  +G YC      P+ S+GS ++I + +   +   GF A Y +  VCGG      G + SPNYP  Y  N  C++KI  P+GY+I   F  F +E          C +D++++ DG       L K CG      + +T N M ++ +SD SV  +GF
Sbjct:    2 KCGGRIMRANGYILSPRYPN--AYPANQDCTWIITASRGYEISFAFLDFQLEGHPKCLNDWVKIYDGSSVMAPRLGHYCGNQLPVPVRSRGSSLYIHFSSDDVTELKGFKAMYNSSLVCGGTYEGLHGSLTSPNYPNNYYINSDCVYKIVAPVGYTIKATFVDFALEPASGRQPVGRC-FDYVQVFDGDTVMAPSLGKFCGSLARFHLVSTGNVMLVRLISDRSVNSKGF 228          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 851.662 bits (2199), Expect = 0.000e+0
Identity = 445/994 (44.77%), Postives = 620/994 (62.37%), Query Frame = 3
Query:  495 ELELKENFRFLDPCKANAFMGDIALTDDEKMRM--LERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            E E  E+  + DPCKA  F GDIAL D+E +RM  ++R I L++ +      + + S     H+  +K       SL+   E ++        Y    L  +  +  T ++   +   K    + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E + NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       ++S  SR+WI +++ +     GF A Y+A+CGGEI    G+I SPNYP+ Y+P+K+C+W+ITV  GY++ L F++F++E+HD+C YD+LE+RDG  E   L+ + CGY  P  +++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ C CD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NT+GSY C CR G+ LH  K +CKE     C ++I    G + SPN+P  YPS+  C W I  TPGH ++++F++FEIE HQEC YD L  +DG S     LGR CG K P P+ S  N + + F SD SVQR+GF+   ++ C G+L A    + ++SHA +G   Y  + +C WLL T  +  +++L F+ FEVE E  C YD +++++G    A  +G++CG+     I S    +LI F SDDT+S KGF   Y + 
Sbjct:   45 EEERAESIDYKDPCKAAVFWGDIAL-DEEDLRMFQIDRTIDLTQHTHTHSHRQGHTSGGVGEHESVKKG------SLYLLLERIRR-------YGFDHLPKNNSKDSTSIKTQTVNNGK--VGKSRIPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYRCPVCGETLQESTGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEITKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEVERHDSCAYDYLEVRDGPLETSPLIGRFCGYDKPEDVRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNGGCEQRCVNTLGSFKCVCDPGYELAPDKKSCEAACGGLLSKLNGTISTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEV-CKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNVRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRHGFVLHENKHDCKEAE---CEHKIHSPSGTLSSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDTAAILGRLCGGKIPEPLVSTSNKMYLRFISDASVQRKGFQAAHSTECGGRLKAEAHQKNLYSHAQFGDNNYPGHTDCEWLL-TSEEGYSIELTFITFEVEEEADCGYDFIELFNGYDANAHRLGRFCGSGPREGIYSPGDVMLIRFHSDDTISKKGFHLRYTST 1013          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: bmp1a (bone morphogenetic protein 1 [Source:NCBI gene;Acc:100125511])

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 426/870 (48.97%), Postives = 572/870 (65.75%), Query Frame = 3
Query:  861 KRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG-CSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            +R +RAATS   R W  G+IPY I  NFS   +A   +AMRHWE +TC++FI +R+ ++SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ +N+  GQ++NF KME  EVDSL E YD+ SIMHYA+ TFS+     TI P+      RPPIGQR  LS GDI Q  KLY C KCG++L + S NFSSP   N   +S  + C WRISVT GE++ LN +   +  S  C  +++EIRDG +  + L GR+C      PIIS  SR+WI +++ +     GF A Y+A+CGG++    G+I SPNYP+ Y+PNK CIWKI+V  GY + L F+SF+IE+HD+C YD+LE+RDG  E   LL + CGY  P  IKT++N +++KF+SD SV K GF A F +E DEC    +G C   CVNTLG+Y CACD GYEL AD ++CE ACGG I + NGS+ SP +P  YPPNK CIW+++A  + +I   F  F+ EG +  C+YD++ V  G   + K  GK+CG + P+ ITS  N + I F SD+TV KKGFK  F++D++EC  +NG C+H CVNT GSY C CR G+ LH  K +CKE    GC + +    G I SPN+P  YPSK  C W + TTPGH I++ F++ ++E+H +C YD + +YDG   K   LGRFCGSK P P+ S  N + I F SD SVQ++GF  + ++ C G L A  + + +FSHA +G   Y    +C W++ +  +   V+L F  FE+E E  C YD ++++DG+   +P +G+YCG+  P  I S   +++I F SDDT++ KGF   Y + 
Sbjct:  100 QRRKRAATSRPERVWPEGVIPYVISGNFSGSQRAVFRQAMRHWEKHTCVTFI-ERTQEESYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIKDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKLYKCSKCGESLQDSSGNFSSPGFPN--GYSAYMHCIWRISVTPGEKIILNFTSMDLYRSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPEPIISTDSRLWIEFRSSSNWVGKGFSAVYEAICGGDVKRDNGQIQSPNYPDDYRPNKACIWKISVSEGYHVGLTFQSFEIERHDSCAYDYLEVRDGISENSPLLGRFCGYDKPDDIKTSSNHLWMKFVSDGSVNKAGFAANFFKEMDECSKPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPREYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDV-CKYDFVEVRSGLSADSKPHGKFCGSEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHDCVNTFGSYRCQCRSGFVLHENKHDCKEA---GCDHTVNSVSGAITSPNWPDKYPSKKACTWALSTTPGHRIKIAFNEIDMEAHLDCAYDHIQIYDGRDAKAPSLGRFCGSKKPQPIISSGNKLFIRFFSDNSVQKKGFDASHSAECGGILKAEVKTKDLFSHAQFGDNNYPGASDCEWVI-SAEKGYGVELIFQTFEIEEEADCGYDYMELFDGADTKSPRLGRYCGSGPPEEIYSAGDSIVIKFHSDDTINKKGFHVRYTST 960          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 414/873 (47.42%), Postives = 568/873 (65.06%), Query Frame = 3
Query:  852 TNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDEC-KNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
              + R  RAATS   R W  G+IPY I  NF+   +A   +AMRHWE  TC++FI K + ++SYI+FT + CGCCSYVGRR  + PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRDDHV I+ +N+  GQ++NF KME  EV+SL E YD+ SIMHYA+ TFS+     TI P       RP IGQR  LS GDI Q  KLY CP CG+TL E + NFSSP   N   +     C WRISVT GE++ LN +   + +S  C  +Y+E+RDG +  + L+GR+C       ++S  SR+WI +++ +     GF A Y+A+CGGEI    G+I SPNYP+ Y+P+K+C+W+ITV  GY++ L F++F++E+HD+C YD+LE+RDG  E   L+ + CGY  P  +++T+N +++KF+SD +V K GF A F +E DEC K    GC   CVNTLG++ C CD GYEL  D K+CE ACGGL+ + NG++ +P +P  YPPNK C+W+++A  + +I   F  F++EG E  C+YDY+ V  G  ++ K  GKYCG + P+ ITS  N + I F SD+TV KKGFK +F++D++EC   NG C+H C+NT+GSY C CR G+ LH  K +CKE     C ++I    G + SPN+P  YPS+  C W I  TPGH ++++F++FEIE HQEC YD L  +DG S     LGR CG K P P+ S  N + + F SD SVQR+GF+   ++ C G+L A    + ++SHA +G   Y  + +C WLL T  +  +++L F+ FEVE E  C YD +++++G    A  +G++CG+     I S    +LI F SDDT+S KGF   Y + 
Sbjct:   51 VGKSRIPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIEK-TDEESYIVFTYRPCGCCSYVGRRG-NGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYRCPVCGETLQESTGNFSSPGYPN--GYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEITKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEVERHDSCAYDYLEVRDGPLETSPLIGRFCGYDKPEDVRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNGGCEQRCVNTLGSFKCVCDPGYELAPDKKSCEAACGGLLSKLNGTISTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEV-CKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNVRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRHGFVLHENKHDCKEAE---CEHKIHSPSGTLSSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDTAAILGRLCGGKIPEPLVSTSNKMYLRFISDASVQRKGFQAAHSTECGGRLKAEAHQKNLYSHAQFGDNNYPGHTDCEWLL-TSEEGYSIELTFITFEVEEEADCGYDFIELFNGYDANAHRLGRFCGSGPREGIYSPGDVMLIRFHSDDTISKKGFHLRYTST 914          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: bmp1b (bone morphogenetic protein 1 [Source:NCBI gene;Acc:100125512])

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 431/984 (43.80%), Postives = 601/984 (61.08%), Query Frame = 3
Query:  522 FLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK--ACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG-CSHVCVNTLGAYMCACDIGYELQADGKTCEN-ACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLH-GKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYG-TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            + DPCKA AF+GDIAL         E D+ + +++I S + +  ++++  + +  R                                                 R +   +R+R RRAATS   R W +GIIPY I  NFS   +A   +AMRHWE +TC++FI +R++++SYI+FT + CGCCSYVGRR    PQAISIGKNCDK GIV+HELGHVIGFWHEHTRPDRD+HV I+ +N+  GQ++NF KME  EVDSL E YD+ SIMHYA+ TFS+     TI P+      RP IGQR  LS GDI Q  KLY C +CG++L E + NFSSP       +S    C WRISVT GE+V+ NI +     S D   +       V+      GR+C  A    I+S  SR+W+ +++ +     GF A Y+AVCGG++    G+I SPNYP+ Y+ NK C+W+ITVP  +++ L F+SF+IEKHD+C YD++E+RDG      LL + CGY  PG +K+++N++++KF+SD SV K GF A F +E DEC     G C   C+NTLG+Y CACD GYEL AD ++C+  ACGG I   NGSL++P +P +YPPNK C+W+++A  + +I   F  F+ EG +  C+YD++ V  G   + +  G++CG + P  ITS  N L I F SD+TV KKGFK +F++D +EC   NG C+H CVNT GSY C CR G+ LH  K++CKE    GC + ++   G I SPN+P  YPSK  C W + TTPGH I++ F++ ++E+H EC YD L ++DG   +   LGRFCG+K P  + S  N + + F SD SVQ+RGF+ ++ + C G L A  E + ++SHA +G   Y    +CLW++ T  +   V++ F  FE+E E  C YD V++YDG+ V  P +G+YCG+  P  + S    +++ F SDD++S KGF A Y + 
Sbjct:   38 YKDPCKAAAFLGDIALD--------EEDVRIFQDAISSHKAQHTDTNSATTSEDSR-------------------------------------------------RFQHSKSRRRRRRAATSRPERVWPNGIIPYMISGNFSGSQRAIFRQAMRHWEKHTCVTFI-ERTTEESYIVFTYRPCGCCSYVGRRGGG-PQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIVRDNIQAGQEYNFLKMEPDEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPAIGQRTKLSKGDISQACKLYKCARCGESLQESTGNFSSPGFP--IGYSAYSHCVWRISVTPGEKVTKNIRK-----SFDEPADRKHFSLSVWV---FAGRFCGDALPDTIVSTDSRLWVEFRSSSSWVGKGFSAVYEAVCGGKVERDHGQIQSPNYPDDYQSNKMCVWRITVPESFNVGLSFQSFEIEKHDSCAYDYVEVRDGGSGSDPLLGRFCGYDKPGDLKSSSNKLWLKFVSDGSVNKAGFAASFFKEMDECSRPDRGHCEQRCLNTLGSYRCACDPGYELAADRRSCQTAACGGFITSLNGSLNTPGWPGDYPPNKNCVWQLVAPTQYRITLLFDGFETEGNDV-CKYDFVEVRSGMSPDSQLHGRFCGAERPDAITSLHNNLRIEFKSDNTVSKKGFKAHFFSDIDECSKANGGCQHECVNTFGSYTCQCRSGFMLHDNKQDCKEA---GCDHVVSSVSGTISSPNWPDRYPSKKACTWSLSTTPGHRIKIVFNEVDMETHLECAYDHLEIFDGKDDRTPTLGRFCGTKKPAAVVSSSNKMFLRFLSDNSVQKRGFETSYRAECGGNLKAAVETKDLYSHAQFGDNNYPGGSDCLWVI-TAEKGYGVEMIFQVFEIEEEVDCGYDYVELYDGTDVKCPRLGRYCGSGAPEDVYSAGDAIVLKFHSDDSISRKGFHARYTST 947          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: cubn (cubilin [Source:NCBI gene;Acc:105353827])

HSP 1 Score: 317.005 bits (811), Expect = 2.556e-88
Identity = 199/668 (29.79%), Postives = 310/668 (46.41%), Query Frame = 3
Query: 1473 PKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV-----CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIK-NKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFK---ITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLW-LLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            P CG  L     N +SP       +    DC W ++V  G  ++      ++    +C+ ++LEIRDG+     ++G++C+    +P+ + G   W+ + +     + GF  +Y        CGG    SEG IISPN+P  Y  N+QCI+ I +P    +AL F    +E H  C +D++E+RDG  E   L+ K CG  +P PI +++N ++I+F SD++V + GF A                    V TL                      ACGG +  S G   SP +P+NYP NK C W I   +   +  +F  FDVEG    C +D++ V DG  ++   LGK+CG   P  + ST   + I F +D++V   GF+  +                                          +  ++GC   +T   G I SP +P +YP  +NC W I   PG++I+LTF+ F +E H +C YD L VYD  +++  K++GR+CG   P  + S    + + F SD S+   GF    ++ N+  D     T  P   F+   Y   Y  N++C + ++  +N Q+ +     H E  P + C +D V+I DG    +P+IG++CG   P  + S S  L + F SD T S  GF A +
Sbjct:  570 PVCGGELTAPYGNLNSPGYPGN--YPPGRDCYWMVTVNPGLLITFAFGTLNLESHPNCSYDFLEIRDGLLPGDPVLGKFCSTGTPAPLQTTGPFAWLHFHSDLSVSDRGFHITYTTSPSDPGCGGTFTDSEGVIISPNWPNNYAHNRQCIYLIQLPANEKVALNFTHMDLETHSGCSFDYVEVRDGRVEAAPLIGKYCGTSLPAPIVSSSNTLWIRFKSDNTVTRSGFRA--------------------VYTL----------------------ACGGTLSGS-GQFRSPYHPNNYPHNKLCEWVINQPEGYVVTLDFLSFDVEGGS--CLFDFVEVRDGSSSSSPLLGKFCGTNIPARLQSTQRSMYIQFRTDASVSNHGFEAVY------------------------------------------DSAIEGCGDTLTGPSGTITSPGHPTSYPHGANCTWFISVQPGNLIRLTFNSFNLEYHYDCNYDYLEVYDNGTVETGKKIGRYCGRSVPPSLTSSERQLTLLFVSDYSLSLEGFSASYVSINATTDCGETFT-SPTGFFTSPNYPDYYPNNRDCTFKIIVELNMQILLNFTNFHLEGFPPS-CNFDFVEIRDGGYETSPLIGKFCGEQKPPALVSHSNRLWVRFHSDSTTSHSGFTAHW 1146          

HSP 2 Score: 314.694 bits (805), Expect = 1.417e-87
Identity = 196/636 (30.82%), Postives = 297/636 (46.70%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDT-CVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKK-PPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEP-ENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLA 3452
            +C W I +  G +V L  S+FH+  S  C+ +YL + DG    + L+ + C       I S   +++I+ +  +     GF+ASY + C G + +    G + SPN+P  Y  N  C W I    G +I   F +F +E   T C YD++++ +G +EQ  L+   CG   P    TT + + + F +DSS+   GF   + Q                                         N CG  +    GS  SP YP+ YP N++CIW I  S  + I     EFDVE   +DC +D + VY GP+ +  +L K C     P  ++ST N LT+ F SD+ V  +GF  ++                                           +   GC   IT   GEI SP YP +YP+  +C W I     H + L F+D +IE H  CT+D + ++DG SI +  L   CGS  P  + S  N+I + F SD S   RGF   F+  C G  I T++     +   Y  PY  NQNC W ++       V L F  FE+E  ++ C++D+V+I DG + +AP IG++CG+ +P  +TS S  ++++F++D +VS +GF+A Y A
Sbjct: 1178 ECYWNIRINHGNQVELRFSDFHLESSQGCSFDYLAVHDGDSAGAPLLAKLCGTELPPSINSSSHQLYIKLRTDSSVNTGGFLASYNSRCEGILISGRHRGMVESPNFPNTYPANAMCSWTIQASSGNTINYTFIAFDLEASFTSCTYDYIKLYNGPNEQAPLIGTYCGQAPPPASSTTGSALTLVFRTDSSIFMSGFQMMWFQ-----------------------------------------NGCGEELTGPGGSFSSPGYPNKYPENRECIWYITTSAGSSITLTIHEFDVE-FHQDCSFDVLEVYGGPDLSAPQLAKLCTTTTSPMQVSSTGNLLTVRFKSDAYVSGRGFNASW------------------------------------------AEVQGGCGGPITAPSGEIHSPLYPNSYPANVDCSWVISVDHNHRVFLNFTDLDIELHTNCTWDYVAIHDGPSISSPLLAHICGSSLPTSITSTQNTIYVRFRSDSSRDHRGFSARFSEAC-GATIVTDDVGGAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAIDSNCSHDAVEILDGDNYLAPSIGRFCGSVVPHPVTSFSSAMVVNFITDVSVSRRGFRAVYSA 1728          

HSP 3 Score: 312.383 bits (799), Expect = 9.311e-87
Identity = 197/660 (29.85%), Postives = 300/660 (45.45%), Query Frame = 3
Query: 1473 PKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYD-GPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESH-QECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            P CG T  +      SP   N +  +    C + I +   E+V+LN +   +     C+ +Y+E+RDG  E + LIG+YC  +  +PI+S  + +WIR+K+      +GF A Y   CGG +  S G+  SP +P  Y  NK C W I  P GY + L F SF +E   +C++DF+E+RDG      LL K CG  IP  +++T   MYI+F +D+SV   GF A +    +                                        CG  +   +G++ SP +P++YP    C W I       I   F  F++E    DC YDY+ VYD G     KK+G+YCG+  P  +TS+  +LT+ F SD ++  +GF  ++ +                                ++   +C E          T   G   SPNYP  YP+  +C +KII      I L F++F +E     C +D + + DG    +  +G+FCG + P  + S  N + + F SD +    GF   ++    G           FS   Y  PY+ N  C W +  IN    V+L+F  F +E    C++D + ++DG S  AP++ + CGT +P  I S S  L I   +D +V+  GF A Y
Sbjct:  688 PGCGGTFTDSEGVIISPNWPNNYAHN--RQCIYLIQLPANEKVALNFTHMDLETHSGCSFDYVEVRDGRVEAAPLIGKYCGTSLPAPIVSSSNTLWIRFKSDNTVTRSGFRAVYTLACGGTLSGS-GQFRSPYHPNNYPHNKLCEWVINQPEGYVVTLDFLSFDVEG-GSCLFDFVEVRDGSSSSSPLLGKFCGTNIPARLQSTQRSMYIQFRTDASVSNHGFEAVYDSAIE---------------------------------------GCGDTLTGPSGTITSPGHPTSYPHGANCTWFISVQPGNLIRLTFNSFNLE-YHYDCNYDYLEVYDNGTVETGKKIGRYCGRSVPPSLTSSERQLTLLFVSDYSLSLEGFSASYVS--------------------------------INATTDCGET--------FTSPTGFFTSPNYPDYYPNNRDCTFKIIVELNMQILLNFTNFHLEGFPPSCNFDFVEIRDGGYETSPLIGKFCGEQKPPALVSHSNRLWVRFHSDSTTSHSGFTAHWDGTQTGCGGTLTTATGGFSSPNYPLPYHPNAECYWNIR-INHGNQVELRFSDFHLESSQGCSFDYLAVHDGDSAGAPLLAKLCGTELPPSINSSSHQLYIKLRTDSSVNTGGFLASY 1262          

HSP 4 Score: 306.22 bits (783), Expect = 8.576e-85
Identity = 200/664 (30.12%), Postives = 302/664 (45.48%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA---VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSV-MAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            +CG  L   + +FS P       +   + C W +     + + +    FH+ +S  C  ++L+I DG    S +IG+YC + A + + S  + ++  +++ + +   GF  ++QA   VCGGE+ A  G + SP YP  Y P + C W +TV  G  I   F +  +E H  C YDFLEIRDG      +L K C    P P++TT    ++ F SD SV  +GF                   H+   T                     +  CGG   +S G + SPN+P+NY  N++CI+ I      K+  NFT  D+E     C +DY+ V DG       +GKYCG   P PI S++N L I F SD+TV + GF+                           Y   C  G  L G                    G+ +SP +P  YP    CEW I    G+++ L F  F++E    C +D + V DG+S  +  LG+FCG+  P  ++S   S+ I F +D SV   GF+  ++S  +G       P    +   + T Y    NC W +      L ++L F  F +E    C YD +++YD  +V     IG+YCG S+P  +TS    L + FVSD ++S +GF A Y+++
Sbjct:  453 ECGGDLSGPAGSFSYPNTPGHDEYDHQVSCTWVLRTDPNKILRVTFPYFHLEQSTGCIFDFLQIHDGDSPFSYMIGKYCGQTAPAELHSSHNALYFWFRSDSSNSGGGFTVTWQAEDPVCGGELTAPYGNLNSPGYPGNYPPGRDCYWMVTVNPGLLITFAFGTLNLESHPNCSYDFLEIRDGLLPGDPVLGKFCSTGTPAPLQTTGPFAWLHFHSDLSVSDRGF-------------------HITYTT------------------SPSDPGCGGTFTDSEGVIISPNWPNNYAHNRQCIYLIQLPANEKVALNFTHMDLE-THSGCSFDYVEVRDGRVEAAPLIGKYCGTSLPAPIVSSSNTLWIRFKSDNTVTRSGFR-------------------------AVYTLAC--GGTLSGS-------------------GQFRSPYHPNNYPHNKLCEWVINQPEGYVVTLDFLSFDVEG-GSCLFDFVEVRDGSSSSSPLLGKFCGTNIPARLQSTQRSMYIQFRTDASVSNHGFEAVYDSAIEGCGDTLTGPSGTITSPGHPTSYPHGANCTWFISVQPGNL-IRLTFNSFNLEYHYDCNYDYLEVYDNGTVETGKKIGRYCGRSVPPSLTSSERQLTLLFVSDYSLSLEGFSASYVSI 1030          

HSP 5 Score: 290.041 bits (741), Expect = 1.387e-79
Identity = 194/652 (29.75%), Postives = 303/652 (46.47%), Query Frame = 3
Query: 1518 SPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESL-DCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGF-VASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQI-PGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKI-ITTPGHIIQLTFSDFEIES-HQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFN---SICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLL-IHFVSDDTVSAKGFKAEY 3446
            SP   N  T+     C W I  + G  ++     F +  S   CT +Y+++ +G  E + LIG YC +A      + GS + + ++  +    +GF +  +Q  CG E+    G   SP YP  Y  N++CIW IT   G SI L    F +E H  C +D LE+  G D     L+K+C     P  + +T N + ++F SD+ V  +GF A + +                                        +  CGG I   +G +HSP YP++YP N  C W I      ++F NFT+ D+E    +C +DY+ ++DGP  +   L   CG   P  ITST N + + F SDS+   +GF   F                                      + C      G T    D  G I SP YP  YP   NC W I    P + + L+F+DFE+E+    C++D + + DG +     +GRFCGS  P P+ S  +++++ F +D SV RRGF+  ++   S C G+++        F+   Y   Y  N  C+W + + +    VQL FL F ++ ++ C  D ++I +G+S  A ++G++CG+S+P+  TS SG++L + FVSD + S  GF+A +
Sbjct: 1281 SPNFPN--TYPANAMCSWTIQASSGNTINYTFIAFDLEASFTSCTYDYIKLYNGPNEQAPLIGTYCGQAPPPASSTTGSALTLVFRTDSSIFMSGFQMMWFQNGCGEELTGPGGSFSSPGYPNKYPENRECIWYITTSAGSSITLTIHEFDVEFHQDCSFDVLEVYGGPDLSAPQLAKLCTTTTSPMQVSSTGNLLTVRFKSDAYVSGRGFNASWAE---------------------------------------VQGGCGGPITAPSGEIHSPLYPNSYPANVDCSWVISVDHNHRVFLNFTDLDIE-LHTNCTWDYVAIHDGPSISSPLLAHICGSSLPTSITSTQNTIYVRFRSDSSRDHRGFSARF-------------------------------------SEAC------GATIVTDDVGGAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAIDSNCSHDAVEILDGDNYLAPSIGRFCGSVVPHPVTSFSSAMVVNFITDVSVSRRGFRAVYSASTSSCGGEMVMQSG---AFNSPNYPDAYPPNLECVWTIRS-SPGNRVQLSFLTFHLQGDSSCENDYLEIREGNSTGA-LVGRFCGSSLPSNYTSVSGHILWVKFVSDSSDSGAGFRATF 1842          

HSP 6 Score: 279.256 bits (713), Expect = 4.554e-76
Identity = 189/674 (28.04%), Postives = 306/674 (45.40%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYS-IALKFESFKIEKHDT-CVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNE-LTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI-------------CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            CG  +   S    SP   N  ++   +DC W ISV    RV LN ++  I    +CT +Y+ I DG   +S L+   C  +  + I S  + I++R+++ +   + GF A +   CG  I   +  G I SP YP  Y PN+ C W I     ++ + L F  F++E  D+ C +D +EI DG +     + + CG  +P P+ + ++ M + F++D SV ++GF A +                                           ++CGG +   +G+ +SPNYP  YPPN +C+W I +S   ++  +F  F ++G +  C+ DY+ + +G  +    +G++CG   P   TS +   L + F SDS+    GF+  F                                  L+G              ++T   G+I SP YP TYP+ ++  W I       +Q+ F D +IE   +C YD L ++DG  + +  LG FCG   P  ++S  +++ + F +D  V  RGF + + ++             C G+L+A E P F+FS A  G  Y  NQ C WL+ +      V+   L  ++E    C +D + I DG++ ++P+I   CG   P    S   ++ IHF SD  VS +GF A Y
Sbjct: 1500 CGGPITAPSGEIHSPLYPN--SYPANVDCSWVISVDHNHRVFLNFTDLDIELHTNCTWDYVAIHDGPSISSPLLAHICGSSLPTSITSTQNTIYVRFRSDSSRDHRGFSARFSEACGATIVTDDVGGAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAIDSNCSHDAVEILDGDNYLAPSIGRFCGSVVPHPVTSFSSAMVVNFITDVSVSRRGFRAVYSAS---------------------------------------TSSCGGEMVMQSGAFNSPNYPDAYPPNLECVWTIRSSPGNRVQLSFLTFHLQG-DSSCENDYLEIREG-NSTGALVGRFCGSSLPSNYTSVSGHILWVKFVSDSSDSGAGFRATFS--------------------------------HLYG-------------IDVTGESGQIASPLYPRTYPNNAHYRWTINVEGDSYVQIRFLDMDIEDLYDCYYDHLKIFDGPDVYHYPLGTFCGLALPHLIRSSGSTVTLLFKTDTVVGGRGFLLEWTAVQNSGPSPTIPPGACGGQLVAGETPAFLFSPAWPGQ-YPPNQECTWLIRSPGS--VVEFNVLSLDIEGSTPCYFDRMVIRDGATSVSPVIASLCGREPPGSFHSTGDSMFIHFSSDSQVSGQGFNASY 2082          

HSP 7 Score: 277.33 bits (708), Expect = 1.508e-75
Identity = 196/666 (29.43%), Postives = 303/666 (45.50%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISP--IISKGSRIWIRYKNQAPSRNTGFVASY---QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAK-IFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSIL-ITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            CG+ L     +FSSP   N++  +   +C W I+ + G  ++L I EF +    DC+ + LE+  G   ++  + + C     SP  + S G+ + +R+K+ A     GF AS+   Q  CGG I A  G I SP YP  Y  N  C W I+V   + + L F    IE H  C +D++ I DG      LL+ ICG  +P  I +T N +Y++F SDSS + +GF+A F              S  C    GA +   D+G                      G++ SP YP+ YPPN+ C W I A +    +  +FT+F++E  + +C +D + + DG       +G++CG   P P+TS ++ + + F +D +V ++GF+  +                                            +   C  E+    G   SPNYP  YP    C W I ++PG+ +QL+F  F ++    C  D L + +G S     +GRFCGS  P    S    IL + F SD S    GF+ TF+ +  G  +  E  Q   +   Y   Y  N +  W +  +     VQ++FL  ++E    C YD +KI+DG  V    +G +CG ++P LI S    + + F +D  V  +GF  E+ AV
Sbjct: 1383 CGEELTGPGGSFSSPGYPNKYPEN--RECIWYITTSAGSSITLTIHEFDVEFHQDCSFDVLEVYGGPDLSAPQLAKLCT-TTTSPMQVSSTGNLLTVRFKSDAYVSGRGFNASWAEVQGGCGGPITAPSGEIHSPLYPNSYPANVDCSWVISVDHNHRVFLNFTDLDIELHTNCTWDYVAIHDGPSISSPLLAHICGSSLPTSITSTQNTIYVRFRSDSSRDHRGFSARF--------------SEAC----GATIVTDDVG----------------------GAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAIDSNCSHDAVEILDGDNYLAPSIGRFCGSVVPHPVTSFSSAMVVNFITDVSVSRRGFRAVY------------------------------------------SASTSSCGGEMVMQSGAFNSPNYPDAYPPNLECVWTIRSSPGNRVQLSFLTFHLQGDSSCENDYLEIREGNS-TGALVGRFCGSSLPSNYTSVSGHILWVKFVSDSSDSGAGFRATFSHLY-GIDVTGESGQ--IASPLYPRTYPNNAHYRWTIN-VEGDSYVQIRFLDMDIEDLYDCYYDHLKIFDGPDVYHYPLGTFCGLALPHLIRSSGSTVTLLFKTDTVVGGRGFLLEWTAV 1958          

HSP 8 Score: 272.707 bits (696), Expect = 4.990e-74
Identity = 192/640 (30.00%), Postives = 293/640 (45.78%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNI-SEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQ-AVCGGEIHASEGRIISPNYPEFYKPN-KQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPP-QPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVT-YPSKSNCEWKIITTPGHI---IQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTP-VPMKSQHNSILITFTSDGSVQRRGFKITFN-SICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            +DC W I V  GE V ++  +EF+I  +  C  +YLEIRDG   NSDL+ R C     S   S GS + +R++      + GF A Y  A+CGG      G I SP +P    P+   C W +  P G+ + L+F +F ++    C  D++EIR+ ++    LL++ CG  +P PI T+++  ++KF+SD+S    GF  +F+   +                                       ACGG +   +G++ SPNYP+ YP ++ C W ++A    ++     +  +E     C +DY+ V +G   +  +L ++CG  P    + S+ N + I F +D+++   GF  ++ +D                                       E  V G   +   + G   SP Y V+ Y +  NCEW +I  P HI   I +   D  +E+HQ C  D L    G S     L +FCG  TP VP+    + + + F SD S    GFK  +  S C G     E    + S   Y   Y     C WLLE      T+ L F +F +E  + C++DSV I++G S  +P+IGQYCGT+ P  I S S  L I F++D +VS  GF A +
Sbjct: 2234 IDCIWVIKVPNGEAVQIDFENEFYIESTASCLYDYLEIRDGSTLNSDLVSRLCGSTRPSTQHSTGSAMLLRFRTDGSVTHIGFKAKYSIAICGGTFIGQTGSIHSPGFPGSNYPDMSSCEWYLEGPTGHYLTLRFSNFSLQTSSGCSQDYVEIRE-YNATGPLLNRHCGDDLPAPIDTSDSFAFVKFVSDASTSAPGFQLFFEASVE---------------------------------------ACGGELNALSGTISSPNYPNLYPHSRVCRWEVVAPPDRRVTLTINDLRLEASGTSCMFDYVEVLNGLGADAPRLQRFCGTVPAGTQVHSSGNSMAIVFRTDASISNGGFMASYSSD---------------------------------------EPAVCGGILD-NPSGGNFTSPGYLVSNYSNNLNCEW-LIQNPHHINSSIVVLIEDLHLENHQTCESDYLQFRLGDS-NGDLLAKFCGQTTPSVPIVVSTSELWVHFQSDSSQGDLGFKAKYMFSECGGWQTGEEG---VLSSPNYPAMYPSPSRCAWLLEAPVGS-TITLTFTYFNLEHHSTCSWDSVTIFNGGSPGSPIIGQYCGTTSPGTIQSGSNTLAIVFLADHSVSKGGFLASW 2787          

HSP 9 Score: 268.855 bits (686), Expect = 8.081e-73
Identity = 191/672 (28.42%), Postives = 298/672 (44.35%), Query Frame = 3
Query: 1479 CGKTLLEYSD-NFSSPERENEWTFSGALDCQWRISVTE--GERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAIS-PIISKGSRIWIRYKNQAPSRNTGFVASYQ-AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFT-EFDVEGKEKDCQYDYINVYDG-PENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI-CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHK 3470
            CG  L   S  NF+SP       +S  L+C+W I         + + I + H+     C  +YL+ R G   N DL+ ++C +   S PI+   S +W+ +++ +   + GF A Y  + CGG     EG + SPNYP  Y    +C W +  P+G +I L F  F +E H TC +D + I +G      ++ + CG   PG I++ +N + I F++D SV K GF A +  +                                        + CGG+I    G++ SPN+P N+P + +C W+IIA +   +   F+ +F +      CQ  YI V+ G  +  +  L  +CG   P PI +  N +T  F S S    KGF  +F T                                              C    +   G + SPNYP  YP  SNC + I      +I LTF  F++E+H  C YD L +Y+   + +  +   CGS  P P+ S    +L+ F SD      GF   + +I C G   +T     + S A     Y+ N NC + +  +     V L+F  F +E  + C YDSV ++DG   +AP++G++CGT++P  + S S  L I F++D +V+  G++A Y     P +
Sbjct: 2560 CGGILDNPSGGNFTSPGYLVS-NYSNNLNCEWLIQNPHHINSSIVVLIEDLHLENHQTCESDYLQFRLGD-SNGDLLAKFCGQTTPSVPIVVSTSELWVHFQSDSSQGDLGFKAKYMFSECGGWQTGEEGVLSSPNYPAMYPSPSRCAWLLEAPVGSTITLTFTYFNLEHHSTCSWDSVTIFNGGSPGSPIIGQYCGTTSPGTIQSGSNTLAIVFLADHSVSKGGFLASWSTD---------------------------------------SSGCGGIIHGDTGTIKSPNFPQNFPAHVECSWQIIAHEGNHLEMTFSPDFQIPDSSGTCQESYIKVWSGRTQTPEALLASHCGSVAPGPIVAPYNMITTRFQS-SGDTAKGFSYSFSTR---------------------------------------------CGANFSAPSGRVVSPNYPADYPDNSNCNYTIDAGEQTVIILTFQVFQLEAHSTCFYDGLKIYN-LPVSSTAVATLCGSSVPGPI-STFGPMLVHFYSDSISTDTGFMAEYTAIPCGGFFNSTT--GTVSSPALSIINYHHNTNCTFHIR-VRADRVVNLRFNTFHLEASSSCRYDSVSVHDGQDSLAPLLGRFCGTALPPDLRSSSNELFIVFITDSSVNGIGWRATYAETLGPEQ 3139          

HSP 10 Score: 265.388 bits (677), Expect = 1.101e-71
Identity = 191/663 (28.81%), Postives = 299/663 (45.10%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRD-GHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPE-NQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYL 3449
             CG TL   S  F SP   N +  +    C+W I+  EG  V+L+   F + E   C  +++E+RDG   +S L+G++C     + + S    ++I+++  A   N GF A Y +    CG  +    G I SP +P  Y     C W I+V  G  I L F SF +E H  C YD+LE+ D G  E  + + + CG  +P  + ++  Q+ + F+SD S+  +GF+A                S+V +N                         CG       G   SPNYP  YP N+ C ++II     +I  NFT F +EG    C +D++ + DG       +GK+CG++ P  + S +N L                + F++D                            G+  H      + T  GC   +T A G   SPNYP+ Y   + C W I    G+ ++L FSDF +ES Q C++D L V+DG S     L + CG++ P  + S  + + I   +D SV   GF  ++NS C+G LI+      + S   +   Y  N  C W ++  +   T+   F+ F++E     CTYD +K+Y+G +  AP+IG YCG + P   ++    L + F +D ++   GF+  + 
Sbjct:  802 ACGGTL-SGSGQFRSPYHPNNYPHNKL--CEWVINQPEGYVVTLDFLSFDV-EGGSCLFDFVEVRDGSSSSSPLLGKFCGTNIPARLQSTQRSMYIQFRTDASVSNHGFEAVYDSAIEGCGDTLTGPSGTITSPGHPTSYPHGANCTWFISVQPGNLIRLTFNSFNLEYHYDCNYDYLEVYDNGTVETGKKIGRYCGRSVPPSLTSSERQLTLLFVSDYSLSLEGFSA----------------SYVSINA---------------------TTDCGETFTSPTGFFTSPNYPDYYPNNRDCTFKIIVELNMQILLNFTNFHLEGFPPSCNFDFVEIRDGGYETSPLIGKFCGEQKPPALVSHSNRL---------------WVRFHSDSTTSHS----------------------GFTAH-----WDGTQTGCGGTLTTATGGFSSPNYPLPYHPNAECYWNIRINHGNQVELRFSDFHLESSQGCSFDYLAVHDGDSAGAPLLAKLCGTELPPSINSSSHQLYIKLRTDSSVNTGGFLASYNSRCEGILISGRHRGMVES-PNFPNTYPANAMCSWTIQASSGN-TINYTFIAFDLEASFTSCTYDYIKLYNGPNEQAPLIGTYCGQAPPPASSTTGSALTLVFRTDSSIFMSGFQMMWF 1379          

HSP 11 Score: 238.424 bits (607), Expect = 3.621e-63
Identity = 179/651 (27.50%), Postives = 278/651 (42.70%), Query Frame = 3
Query: 1566 QWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV-------------CGGEIHASE--GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNF-TEFDVEGKEKDCQY-DYINVYDGPENNQKKLG-KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEI--TDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTF-SDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFN-SICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLA 3452
            +W I+V     V +   +  I +  DC  ++L+I DG       +G +C  A    I S GS + + +K        GF+  + AV             CGG++ A E    + SP +P  Y PN++C W I  P G  +     S  IE    C +D + IRDG      +++ +CG + PG   +T + M+I F SDS V  QGF A + +                                           CGG +    G L+SP+YP NY P   C W ++ +   +I   F + F + G    C   D++ V +GP+ +   LG + CG  PP  + +T N++   F SD + +  GFK+ F      C                                        G   E+   D  G I SPNYP  YP   +C W I    G  +Q+ F ++F IES   C YD L + DG+++ +  + R CGS  P    S  +++L+ F +DGSV   GFK  ++ +IC G  I   +   I S    G+ Y    +C W LE       + L+F +F ++  + C+ D V+I +  +   P++ ++CG  +P  I +      + FVSD + SA GF+  + A
Sbjct: 1873 RWTINVEGDSYVQIRFLDMDIEDLYDCYYDHLKIFDGPDVYHYPLGTFCGLALPHLIRSSGSTVTLLFKTDTVVGGRGFLLEWTAVQNSGPSPTIPPGACGGQLVAGETPAFLFSPAWPGQYPPNQECTWLIRSP-GSVVEFNVLSLDIEGSTPCYFDRMVIRDGATSVSPVIASLCGREPPGSFHSTGDSMFIHFSSDSQVSGQGFNASYSK------------------------------------------GCGGFLHVDRGVLNSPHYPQNYQPGLNCSWFVMVTPGFRISVTFQSPFQISGSGTSCNSGDFLEVRNGPDASSPLLGERLCGSTPPSLLQTTDNQIYFNFVSDGSTEASGFKLTFEAHSKAC----------------------------------------GGFIELRDLDPPGYITSPNYPQNYPQNIDCIWVIKVPNGEAVQIDFENEFYIESTASCLYDYLEIRDGSTLNSDLVSRLCGSTRPSTQHSTGSAMLLRFRTDGSVTHIGFKAKYSIAICGGTFIG--QTGSIHSPGFPGSNYPDMSSCEWYLEGPTGHY-LTLRFSNFSLQTSSGCSQDYVEIRE-YNATGPLLNRHCGDDLPAPIDTSDSFAFVKFVSDASTSAPGFQLFFEA 2436          

HSP 12 Score: 230.335 bits (586), Expect = 1.329e-60
Identity = 183/662 (27.64%), Postives = 288/662 (43.50%), Query Frame = 3
Query: 1554 ALDCQWRISVTEGERVSLNI-SEFHIPES-LDC-TINYLEIRDGVYENSDLIG-RYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA---VCGGEIHASE----GRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXX-XXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYD----GPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIE-SHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQ----HNSILITFTSDGSVQRRGFKITFNS----ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLET---INQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTL-ITSQSGNLLIHFVSDDTVSAKGFKAEYL 3449
             L+C W + VT G R+S+   S F I  S   C + ++LE+R+G   +S L+G R C     S + +  ++I+  + +   +  +GF  +++A    CGG I   +    G I SPNYP+ Y  N  CIW I VP G ++ + FE+ F IE   +C+YD+LEIRDG      L+S++CG   P    +T + M ++F +D SV   GF A +                                             CGG      GS+HSP    SNYP    C W +       +   F+ F ++     C  DY+ + +    GP      L ++CG   P PI ++ +   + F SD++    GF++ F                                          E +V+ C  E+    G I SPNYP  YP    C W+++  P   + LT +D  +E S   C +D + V +G      +L RFCG+   VP  +Q     NS+ I F +D S+   GF  +++S    +C G L       F  S     + Y+ N NC WL++    IN  + V ++ LH E     +  Y   ++ D +     ++ ++CG + P++ I   +  L +HF SD +    GFKA+Y+
Sbjct: 2109 GLNCSWFVMVTPGFRISVTFQSPFQISGSGTSCNSGDFLEVRNGPDASSPLLGERLCGSTPPSLLQTTDNQIYFNFVSDGSTEASGFKLTFEAHSKACGGFIELRDLDPPGYITSPNYPQNYPQNIDCIWVIKVPNGEAVQIDFENEFYIESTASCLYDYLEIRDGSTLNSDLVSRLCGSTRPSTQHSTGSAMLLRFRTDGSVTHIGFKAKYSIA-----------------------------------------ICGGTFIGQTGSIHSPGFPGSNYPDMSSCEWYLEGPTGHYLTLRFSNFSLQ-TSSGCSQDYVEIREYNATGP-----LLNRHCGDDLPAPIDTSDSFAFVKFVSDASTSAPGFQLFF------------------------------------------EASVEACGGELNALSGTISSPNYPNLYPHSRVCRWEVVAPPDRRVTLTINDLRLEASGTSCMFDYVEVLNGLGADAPRLQRFCGT---VPAGTQVHSSGNSMAIVFRTDASISNGGFMASYSSDEPAVCGGILDNPSGGNFT-SPGYLVSNYSNNLNCEWLIQNPHHINSSIVVLIEDLHLENHQTCESDYLQFRLGDSN---GDLLAKFCGQTTPSVPIVVSTSELWVHFQSDSSQGDLGFKAKYM 2674          

HSP 13 Score: 223.787 bits (569), Expect = 1.436e-58
Identity = 177/644 (27.48%), Postives = 270/644 (41.93%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFES-FKIEKHDTCVY--DFLEIRDGHDEQKRLLS-KICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIK----ESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNF-TEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVT-YPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS---ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLW-LLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGN-LLIHFVSDDTVSAKGFKAEY 3446
            +C W I  + G  V  N+    I  S  C  + + IRDG    S +I   C R       S G  ++I + + +     GF ASY   CGG +H   G + SP+YP+ Y+P   C W + V  G+ I++ F+S F+I    T     DFLE+R+G D    LL  ++CG   P  ++TT+NQ+Y  F+SD S E  GF   F+                                           ACGG I+    +  G + SPNYP NYP N  CIW I       +  +F  EF +E     C YDY+ + DG   N   + + CG   P    ST + + + F +D +V   GFK  +                                            ++  C        G I SP +P + YP  S+CEW +    GH + L FS+F +++   C+ D + + +  +     L R CG   P P+ +  +   + F SD S    GF++ F +    C G+L A        S   Y   Y  ++ C W ++   ++++T+ +  L  E      C +D V++ +G    AP + ++CGT         SGN + I F +D ++S  GF A Y
Sbjct: 1999 ECTWLIR-SPGSVVEFNVLSLDIEGSTPCYFDRMVIRDGATSVSPVIASLCGREPPGSFHSTGDSMFIHFSSDSQVSGQGFNASYSKGCGGFLHVDRGVLNSPHYPQNYQPGLNCSWFVMVTPGFRISVTFQSPFQISGSGTSCNSGDFLEVRNGPDASSPLLGERLCGSTPPSLLQTTDNQIYFNFVSDGSTEASGFKLTFEAH---------------------------------------SKACGGFIELRDLDPPGYITSPNYPQNYPQNIDCIWVIKVPNGEAVQIDFENEFYIE-STASCLYDYLEIRDGSTLNSDLVSRLCGSTRPSTQHSTGSAMLLRFRTDGSVTHIGFKAKY--------------------------------------------SIAICGGTFIGQTGSIHSPGFPGSNYPDMSSCEWYLEGPTGHYLTLRFSNFSLQTSSGCSQDYVEIRE-YNATGPLLNRHCGDDLPAPIDTSDSFAFVKFVSDASTSAPGFQLFFEASVEACGGELNALSG---TISSPNYPNLYPHSRVCRWEVVAPPDRRVTLTINDLRLEAS-GTSCMFDYVEVLNGLGADAPRLQRFCGTVPAGTQVHSSGNSMAIVFRTDASISNGGFMASY 2552          

HSP 14 Score: 222.631 bits (566), Expect = 3.098e-58
Identity = 154/548 (28.10%), Postives = 239/548 (43.61%), Query Frame = 3
Query: 1815 QAVCGGEIHASEGRIISPNYP--EFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQ--LTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            Q  CGG++    G    PN P  + Y     C W +       + + F  F +E+   C++DFL+I DG      ++ K CG   P  + +++N +Y  F SDSS    GFT  +Q E                                       +  CGG +    G+L+SP YP NYPP + C W +  +    I F F   ++E    +C YD++ + DG       LGK+C    P P+ +T     + F+SD +V  +GF I + T  ++                                         GC    TD+ G I SPN+P  Y     C + I       + L F+  ++E+H  C++D + V DG       +G++CG+  P P+ S  N++ I F SD +V R GF+  +   C G L  + +    F    +   Y  N+ C W+   INQ     V L FL F+VE    C +D V++ DGSS  +P++G++CGT++P  + S   ++ I F +D +VS  GF+A Y
Sbjct:  451 QQECGGDLSGPAGSFSYPNTPGHDEYDHQVSCTWVLRTDPNKILRVTFPYFHLEQSTGCIFDFLQIHDGDSPFSYMIGKYCGQTAPAELHSSHNALYFWFRSDSSNSGGGFTVTWQAE---------------------------------------DPVCGGELTAPYGNLNSPGYPGNYPPGRDCYWMVTVNPGLLITFAFGTLNLE-SHPNCSYDFLEIRDGLLPGDPVLGKFCSTGTPAPLQTTGPFAWLHFHSDLSVSDRGFHITYTTSPSD----------------------------------------PGCGGTFTDSEGVIISPNWPNNYAHNRQCIYLIQLPANEKVALNFTHMDLETHSGCSFDYVEVRDGRVEAAPLIGKYCGTSLPAPIVSSSNTLWIRFKSDNTVTRSGFRAVYTLACGGTLSGSGQ----FRSPYHPNNYPHNKLCEWV---INQPEGYVVTLDFLSFDVE-GGSCLFDFVEVRDGSSSSSPLLGKFCGTNIPARLQSTQRSMYIQFRTDASVSNHGFEAVY 910          

HSP 15 Score: 222.246 bits (565), Expect = 4.491e-58
Identity = 161/642 (25.08%), Postives = 277/642 (43.15%), Query Frame = 3
Query: 1560 DCQWRISVTEG-ERVSLNISEFHIPESLD--CTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQ-MYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLH-FEVEPENQC--TYDSVKIYDGSSVMAPMIGQ-YCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLA 3452
            +C W I   E    V+L+ ++F + E++D  C+ + +EI DG    +  IGR+C      P+ S  S + + +         GF A Y A    CGGE+    G   SPNYP+ Y PN +C+W I    G  + L F +F ++   +C  D+LEIR+G +    L+ + CG  +P    + +   +++KF+SDSS    GF A F              SH+               Y +   G++ + A     +    + H               W I     + +   F + D+E    DC YD++ ++DGP+     LG +CG   P  I S+ + +T+ F +D+ V  +GF + +   +N                         PG        C  + V G T         + SP +P  YP    C W +I +PG +++      +IE    C +D++++ DGA+  +  +   CG + P    S  +S+ I F+SD  V  +GF  +++  C G L        + +   Y   Y    NC W +  +     + + F   F++        + D +++ +G    +P++G+  CG++ P+L+ +    +  +FVSD +  A GFK  + A
Sbjct: 1640 NCSWFIKAQEPFNHVTLSFTDFEL-EAIDSNCSHDAVEILDGDNYLAPSIGRFCGSVVPHPVTSFSSAMVVNFITDVSVSRRGFRAVYSASTSSCGGEMVMQSGAFNSPNYPDAYPPNLECVWTIRSSPGNRVQLSFLTFHLQGDSSCENDYLEIREG-NSTGALVGRFCGSSLPSNYTSVSGHILWVKFVSDSSDSGAGFRATF--------------SHL---------------YGIDVTGESGQIASPLYPRTYPNNAHYR-------------WTINVEGDSYVQIRFLDMDIE-DLYDCYYDHLKIFDGPDVYHYPLGTFCGLALPHLIRSSGSTVTLLFKTDTVVGGRGFLLEWTAVQNSGPSPT-----------------IPPG-------ACGGQLVAGETPAF------LFSPAWPGQYPPNQECTW-LIRSPGSVVEFNVLSLDIEGSTPCYFDRMVIRDGATSVSPVIASLCGREPPGSFHSTGDSMFIHFSSDSQVSGQGFNASYSKGCGGFLHVDRG---VLNSPHYPQNYQPGLNCSWFV-MVTPGFRISVTFQSPFQISGSGTSCNSGDFLEVRNGPDASSPLLGERLCGSTPPSLLQTTDNQIYFNFVSDGSTEASGFKLTFEA 2201          

HSP 16 Score: 216.083 bits (549), Expect = 3.184e-56
Identity = 173/652 (26.53%), Postives = 264/652 (40.49%), Query Frame = 3
Query: 1563 CQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQ---AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFE-SFKI-EKHDTCVYDFLEIRDGHDEQ-KRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPV-TYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI------CDGKLIATEEPQFIFSHAAYGTP-------YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            C W +    G  ++L  + F++     C+ + + I +G    S +IG+YC   +   I S  + + I +         GF+AS+    + CGG IH   G I SPN+P+ +  + +C W+I    G  + + F   F+I +   TC   ++++  G  +  + LL+  CG   PGPI    N +  +F S     K GF+  F                                             CG      +G + SPNYP++YP N  C + I A ++  I   F  F +E     C YD + +Y+ P ++   +   CG   P PI ST   + + FYSDS     GF                                              E T   C        G + SP   +  Y   +NC + I      ++ L F+ F +E+   C YD + V+DG       LGRFCG+  P  ++S  N + I F +D SV   G++ T+         C G L               G+P       Y  + NC+W +E +     + L F  FE+E    C YD VK+YDG ++  P++G +CGTS+P    S    L I FV+D +V  +GF A Y AVP
Sbjct: 2704 CAWLLEAPVGSTITLTFTYFNLEHHSTCSWDSVTIFNGGSPGSPIIGQYCGTTSPGTIQSGSNTLAIVFLADHSVSKGGFLASWSTDSSGCGGIIHGDTGTIKSPNFPQNFPAHVECSWQIIAHEGNHLEMTFSPDFQIPDSSGTCQESYIKVWSGRTQTPEALLASHCGSVAPGPIVAPYNMITTRFQSSGDTAK-GFSYSFSTR------------------------------------------CGANFSAPSGRVVSPNYPADYPDNSNCNYTIDAGEQTVIILTFQVFQLEAHST-CFYDGLKIYNLPVSS-TAVATLCGSSVPGPI-STFGPMLVHFYSDSISTDTGFM--------------------------------------------AEYTAIPCGGFFNSTTGTVSSPALSIINYHHNTNCTFHIRVRADRVVNLRFNTFHLEASSSCRYDSVSVHDGQDSLAPLLGRFCGTALPPDLRSSSNELFIVFITDSSVNGIGWRATYAETLGPEQGCGGYLS--------MPMGMLGSPDPNLDGRYEPSMNCVWTIE-MPVNRAINLTFSSFELESSATCRYDYVKVYDGHNMDFPLVGTFCGTSIPAFFMSTGNFLTIQFVTDSSVQRQGFNATYRAVP 3256          

HSP 17 Score: 214.157 bits (544), Expect = 1.220e-55
Identity = 167/667 (25.04%), Postives = 286/667 (42.88%), Query Frame = 3
Query: 1476 KCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV-CGGEIHASEGRIISPNYPEF-YKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXX--XXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKT-PVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            +CG      S    SP    ++  +   +C + I   E   + L    F +     C  + L+I + +  +S  +   C  +   PI + G  + + + + + S +TGF+A Y A+ CGG  +++ G + SP      Y  N  C + I V     + L+F +F +E   +C YD + + DG D    LL + CG  +P  +++++N+++I F++DSSV   G+ A + +                  TLG                   E  CGG +    G L SP+   +    P+  C+W I       I   F+ F++E     C+YDY+ VYDG   +   +G +CG   P    ST N LTI F +DS+VQ++GF   +                FC                             G T   T     + SP++P TYP  ++C W +       I+++   F ++  Q C+ + L ++D       Q   FC S   P    S   ++L+ F SD  +   G   TF  I +      +E  ++ S   +   Y  + +C  +L+      ++   F  F+VE  + C +D ++I +GS+  +P+IG++CG+++P+ I  QS  L +H  SD + +  GF   + + P 
Sbjct: 2908 RCGANFSAPSGRVVSPNYPADYPDNS--NCNYTIDAGEQTVIILTFQVFQLEAHSTCFYDGLKIYN-LPVSSTAVATLCGSSVPGPISTFGPML-VHFYSDSISTDTGFMAEYTAIPCGGFFNSTTGTVSSPALSIINYHHNTNCTFHIRVRADRVVNLRFNTFHLEASSSCRYDSVSVHDGQDSLAPLLGRFCGTALPPDLRSSSNELFIVFITDSSVNGIGWRATYAE------------------TLGP------------------EQGCGGYLSMPMGMLGSPDPNLDGRYEPSMNCVWTIEMPVNRAINLTFSSFELE-SSATCRYDYVKVYDGHNMDFPLVGTFCGTSIPAFFMSTGNFLTIQFVTDSSVQRQGFNATYRA-----------VPLFC-----------------------------GGTLNATTTIQTLTSPSFPNTYPPHTSCRWTLDAPGQETIKVSVQTFVLQPDQSCSTNYLQIHDWPLGDFGQSHTFCASDMHPPDFYSYGRTVLVDFKSDHFMTGNGLSFTFQ-IANCSRTYEQEFGYLKS-PGWPDTYPHDVDCTIILKAPTNN-SISFFFNAFDVESHDSCNFDYLEIRNGSTASSPLIGRFCGSTLPSPIFPQSNTLYLHCKSDFSSTRDGFDVTWTSSPN 3490          

HSP 18 Score: 198.364 bits (503), Expect = 1.195e-50
Identity = 164/684 (23.98%), Postives = 278/684 (40.64%), Query Frame = 3
Query: 1464 YNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQA---VCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDT-CVYDFLEIRDGHDEQKRLLSKICGYQIPGP-IKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXK--KCIWRIIASK--KAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQ-PITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF---NSICDGKLIATEEPQFIFSHAAYGT--PYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQ-------CTYDSVKIYDG-SSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            Y+   CG T +  + +  SP       +     C+W +    G  ++L  S F +  S  C+ +Y+EIR+       L+ R+C     +PI +  S  ++++ + A +   GF   ++A    CGGE++A  G I SPNYP  Y  ++ C W++  P    + L     ++E   T C++D++E+ +G       L + CG    G  + ++ N M I F +D+S+   GF A +  +                                          CGG++   +G   +         +    C W I       + I     +  +E   + C+ DY+    G ++N   L K+CG+  P  PI  +T+EL + F SDS+    GFK  +    +EC                        G+Q                   T   G + SPNYP  YPS S C W +    G  I LTF+ F +E H  C++D + +++G S  +  +G++CG+ +P  ++S  N++ I F +D SV + GF  ++   +S C G +           H   GT    N  QN    +E   Q +  +   L     P+ Q       C    +K++ G +     ++  +CG+  P  I +    +   F S    +AKGF   +
Sbjct: 2320 YSIAICGGTFIGQTGSIHSPGFPGS-NYPDMSSCEWYLEGPTGHYLTLRFSNFSLQTSSGCSQDYVEIRE-YNATGPLLNRHCGDDLPAPIDTSDSFAFVKFVSDASTSAPGFQLFFEASVEACGGELNALSGTISSPNYPNLYPHSRVCRWEVVAPPDRRVTLTINDLRLEASGTSCMFDYVEVLNGLGADAPRLQRFCGTVPAGTQVHSSGNSMAIVFRTDASISNGGFMASYSSDEPA--------------------------------------VCGGILDNPSGGNFTSPGYLVSNYSNNLNCEWLIQNPHHINSSIVVLIEDLHLE-NHQTCESDYLQFRLG-DSNGDLLAKFCGQTTPSVPIVVSTSELWVHFQSDSSQGDLGFKAKYM--FSECG-----------------------GWQ-------------------TGEEGVLSSPNYPAMYPSPSRCAWLLEAPVGSTITLTFTYFNLEHHSTCSWDSVTIFNGGSPGSPIIGQYCGTTSPGTIQSGSNTLAIVFLADHSVSKGGFLASWSTDSSGCGGII-----------HGDTGTIKSPNFPQNFPAHVECSWQIIAHEGNHLEMTFSPDFQIPDSSGTCQESYIKVWSGRTQTPEALLASHCGSVAPGPIVAPYNMITTRFQSSGD-TAKGFSYSF 2905          

HSP 19 Score: 195.667 bits (496), Expect = 7.265e-50
Identity = 157/642 (24.45%), Postives = 265/642 (41.28%), Query Frame = 3
Query: 1560 DCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAV------CGGEIHASEGRIISP--NYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNG--SLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKK--PPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTL-ITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            +C + I V     V+L  + FH+  S  C  + + + DG    + L+GR+C  A    + S  + ++I +   +     G+ A+Y         CGG +    G + SP  N    Y+P+  C+W I +P+  +I L F SF++E   TC YD++++ DGH+    L+   CG  IP    +T N + I+F++DSSV++QGF A +                                       +     CGG +  +    +L SP++P+ YPP+  C W + A  +  I  +   F ++  ++ C  +Y+ ++D P  +  +   +C     PP    S    + + F SD  +   G    F                                       NC        TYE     G +KSP +P TYP   +C   +     + I   F+ F++ESH  C +D L + +G++  +  +GRFCGS  P P+  Q N++ +   SD S  R GF +T+ S  +G            S   Y   Y    +C W +     ++ V + F    ++    C  + +K+YDG    +  +G YCG         + S  + I F S  ++   GF+  +
Sbjct: 3047 NCTFHIRVRADRVVNLRFNTFHLEASSSCRYDSVSVHDGQDSLAPLLGRFCGTALPPDLRSSSNELFIVFITDSSVNGIGWRATYAETLGPEQGCGGYLSMPMGMLGSPDPNLDGRYEPSMNCVWTIEMPVNRAINLTFSSFELESSATCRYDYVKVYDGHNMDFPLVGTFCGTSIPAFFMSTGNFLTIQFVTDSSVQRQGFNATY---------------------------------------RAVPLFCGGTLNATTTIQTLTSPSFPNTYPPHTSCRWTLDAPGQETIKVSVQTFVLQ-PDQSCSTNYLQIHDWPLGDFGQSHTFCASDMHPPD-FYSYGRTVLVDFKSDHFMTGNGLSFTFQI------------------------------------ANCSR------TYE--QEFGYLKSPGWPDTYPHDVDCTIILKAPTNNSISFFFNAFDVESHDSCNFDYLEIRNGSTASSPLIGRFCGSTLPSPIFPQSNTLYLHCKSDFSSTRDGFDVTWTSSPNGCGGILYGDHGSLSSPNYPGTYPNQSHCEWNIVAPRGRV-VTVTFGQISIDDPGDCQNNFLKLYDGPDSSSLPVGPYCGVETNIAPFRASSHQVFIVFQSQFSILPSGFRLTW 3602          

HSP 20 Score: 192.2 bits (487), Expect = 7.494e-49
Identity = 128/440 (29.09%), Postives = 195/440 (44.32%), Query Frame = 3
Query: 2157 QEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENA---CGGLIKESNGSLHXXXXXXXXXXXKK--CIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSI-----CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEY 3446
            Q  DEC +        C++ + A+ C C      Q  G  C+     CGG +    GS   PN P +   + +  C W +       +   F  F +E +   C +D++ ++DG       +GKYCG+  P  + S+ N L   F SDS+    GF + +     + ED                                       C  E+T  +G + SP YP  YP   +C W +   PG +I   F    +ESH  C+YD L + DG    +  LG+FC + TP P+++      + F SD SV  RGF IT+ +      C G    +E    +     +   Y  N+ C++L++ +     V L F H ++E  + C++D V++ DG    AP+IG+YCGTS+P  I S S  L I F SD+TV+  GF+A Y
Sbjct:  411 QNVDECSSNPCQNGGTCMDGINAFTCTC----TSQWSGPLCQTPQQECGGDLSGPAGSFSYPNTPGHDEYDHQVSCTWVLRTDPNKILRVTFPYFHLE-QSTGCIFDFLQIHDGDSPFSYMIGKYCGQTAPAELHSSHNALYFWFRSDSSNSGGGFTVTW-----QAEDPV-------------------------------------CGGELTAPYGNLNSPGYPGNYPPGRDCYWMVTVNPGLLITFAFGTLNLESHPNCSYDFLEIRDGLLPGDPVLGKFCSTGTPAPLQTTGPFAWLHFHSDLSVSDRGFHITYTTSPSDPGCGGTFTDSEG---VIISPNWPNNYAHNRQCIYLIQ-LPANEKVALNFTHMDLETHSGCSFDYVEVRDGRVEAAPLIGKYCGTSLPAPIVSSSNTLWIRFKSDNTVTRSGFRAVY 799          

HSP 21 Score: 162.155 bits (409), Expect = 1.280e-39
Identity = 102/368 (27.72%), Postives = 172/368 (46.74%), Query Frame = 3
Query: 2361 KKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIE-SHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKIT-FNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLL-IHFVSDDTVSAKGFKAEYLAV 3455
             +C W I  +   ++   F++F +E   + C +DY+ V+DG       L K CG + P  I S++++L I   +DS+V   GF  ++          N  CE                G  + G+                   G ++SPN+P TYP+ + C W I  + G+ I  TF  F++E S   CTYD + +Y+G + +   +G +CG   P    +  +++ + F +D S+   GF++  F + C  +L     P   FS   Y   Y  N+ C+W + T +   ++ L    F+VE    C++D +++Y G  + AP + + C T+   +  S +GNLL + F SD  VS +GF A +  V
Sbjct: 1177 AECYWNIRINHGNQVELRFSDFHLE-SSQGCSFDYLAVHDGDSAGAPLLAKLCGTELPPSINSSSHQLYIKLRTDSSVNTGGFLASY----------NSRCE----------------GILISGRH-----------------RGMVESPNFPNTYPANAMCSWTIQASSGNTINYTFIAFDLEASFTSCTYDYIKLYNGPNEQAPLIGTYCGQAPPPASSTTGSALTLVFRTDSSIFMSGFQMMWFQNGCGEELTG---PGGSFSSPGYPNKYPENRECIWYI-TTSAGSSITLTIHEFDVEFHQDCSFDVLEVYGGPDLSAPQLAKLCTTTTSPMQVSSTGNLLTVRFKSDAYVSGRGFNASWAEV 1496          

HSP 22 Score: 139.813 bits (351), Expect = 1.112e-32
Identity = 99/386 (25.65%), Postives = 170/386 (44.04%), Query Frame = 3
Query: 1479 CGKTLLEYS--DNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISP-IISKGSRIWIRYKNQAPSRNTGFVASYQ-AVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPP-QPITSTTNELTIAFYSDSTVQKKGFKINF 2621
            CG TL   +     +SP   N  T+     C+W +     E + +++  F +     C+ NYL+I D    +      +CA     P   S G  + + +K+       G   ++Q A C        G + SP +P+ Y  +  C   +  P   SI+  F +F +E HD+C +D+LEIR+G      L+ + CG  +P PI   +N +Y+   SD S  + GF                                 D+ +       +  N CGG++   +GSL SPNYP  YP    C W I+A +   +   F +  ++    DCQ +++ +YDGP+++   +G YCG +    P  ++++++ I F S  ++   GF++ +
Sbjct: 3259 CGGTLNATTTIQTLTSPSFPN--TYPPHTSCRWTLDAPGQETIKVSVQTFVLQPDQSCSTNYLQIHDWPLGDFGQSHTFCASDMHPPDFYSYGRTVLVDFKSDHFMTGNGLSFTFQIANCSRTYEQEFGYLKSPGWPDTYPHDVDCTIILKAPTNNSISFFFNAFDVESHDSCNFDYLEIRNGSTASSPLIGRFCGSTLPSPIFPQSNTLYLHCKSDFSSTRDGF---------------------------------DVTW------TSSPNGCGGILYGDHGSLSSPNYPGTYPNQSHCEWNIVAPRGRVVTVTFGQISID-DPGDCQNNFLKLYDGPDSSSLPVGPYCGVETNIAPFRASSHQVFIVFQSQFSILPSGFRLTW 3602          

HSP 23 Score: 135.576 bits (340), Expect = 1.785e-31
Identity = 127/499 (25.45%), Postives = 204/499 (40.88%), Query Frame = 3
Query: 2022 EQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSH----VCVNTLGAYMC-ACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINF-------YTDRNECEDKNGECEH--FCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPV--TYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNS---ICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            ++  L SK C    P P   T    Y      +  +  G++    Q+ DEC     GCS      C+NT+G++ C +C  GYE   DG+ C  A   +   +NG  +                  +AS  +    N            C   YI    GP     ++   C           TN   +     ST    G+  N          D+N  E  +  C++   C++ I ++ C C    Q  G   C+    + C  +++   G    PN P    Y  + +C W + T P  I+++TF  F +E    C +D L ++DG S  +  +G++CG   P  + S HN++   F SD S    GF +T+ +   +C G+L A   P    +   Y   Y   ++C W++ T+N  L +   F    +E    C+YD ++I DG     P++G++C T  P  + +      +HF SD +VS +GF   Y   P 
Sbjct:  239 DECNLPSKPCSTNPPVPCHNTQGSFYCG-ACPAGWQGNGYSC---QDVDECLTNNGGCSTNPMVQCLNTMGSFHCGSCPPGYE--GDGRICTQA--DICSSNNGGCYP-----------------LASCSSSPGSNL-------PVCTCPSGYIGNGYGP-TGCTQISNIC----------QTNNPCVNGQCVSTTSSSGYICNCSPGWDGPICDQNVDECSSNPCQNGGTCMDGINAFTCTCT--SQWSGPL-CQTPQQE-CGGDLSGPAGSFSYPNTPGHDEYDHQVSCTWVLRTDPNKILRVTFPYFHLEQSTGCIFDFLQIHDGDSPFSYMIGKYCGQTAPAELHSSHNALYFWFRSDSSNSGGGFTVTWQAEDPVCGGELTA---PYGNLNSPGYPGNYPPGRDCYWMV-TVNPGLLITFAFGTLNLESHPNCSYDFLEIRDGLLPGDPVLGKFCSTGTPAPLQTTGPFAWLHFHSDLSVSDRGFHITYTTSPS 686          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000005882.1 (SMESG000005882.1)

HSP 1 Score: 2100.48 bits (5441), Expect = 0.000e+0
Identity = 1062/1065 (99.72%), Postives = 1062/1065 (99.72%), Query Frame = 3
Query:  375 MLRKFLTSFGYXXXXXXXXXXXXXXXXXHFPXXXXXXXIDELELKENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTYRFQYXXXXXXXXXXXXXXXEFIEHA 3569
            MLRKFLTSFGYLLKIFLVLLLISLSSTSHF NHNNNNNIDELELKENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQ ESN SSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHSPNYPSNYPPNKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTYRFQYQVQRSVNSVNSKRNNEFIEHA
Sbjct:    1 MLRKFLTSFGYLLKIFLVLLLISLSSTSHFSNHNNNNNIDELELKENFRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQLESNISSNHYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTEMRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHSPNYPSNYPPNKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTYRFQYQVQRSVNSVNSKRNNEFIEHA 1065          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000068883.1 (SMESG000068883.1)

HSP 1 Score: 114.39 bits (285), Expect = 4.657e-25
Identity = 126/553 (22.78%), Postives = 207/553 (37.43%), Query Frame = 3
Query: 1863 SPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEK-HDTCVYDFLEIRDGHDEQKRLLSKICGYQIP-GPIKTTNNQMYIKFMSDSS--VEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKE---SNGSLHXXXXXXXXXXXKKCIWRIIA--SKKAKIFFNFTEFDVEGKEK--DCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITT-PGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGS-KTPVPMKSQHNSILITFT-----SDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGS-SVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKP 3464
            +PN+P  Y  N    W    P+GY  ++   S  IE+ +D C YDF+            +   CG      P     N + ++F SD S      GF A+     +       GC      T+G Y                      G+IK     N  L+  N          C W+I A      K+ F      +EG+ +   C+YD+I +YDGP++ +  +   CG      IT+ +N + + F +D  +QK GFK+ F                     I S              +N   KTV       T+    ++SP YP   P       ++I       I +T  D +I     C+ DQ I+ D +     ++ +FC S  T     S H+ ++I +      +  S   R F+I++      +       + +         Y+ N  C   L T    L  Q  F +F +E  + C YD ++   G       ++ + CG+S+P    + S  + + FV+D +++  G+   Y+    P
Sbjct: 3113 TPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVSFSTNSSNSSDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFI----NPTPGPMLGCGGYMNATVGTY----------------------GVIKSLDLDNNGLYENNLL--------CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF-------------------TAIPS--------------QNHLIKTV-------TNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRFSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINHDGYDITYVVNRDP 3589          

HSP 2 Score: 108.227 bits (269), Expect = 3.368e-23
Identity = 75/242 (30.99%), Postives = 113/242 (46.69%), Query Frame = 3
Query: 2766 CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVP---MKSQHNSILITFTSDGSVQRRGFKITFNSI-----CDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLL---ETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPT-LITSQSGNLLIHFVSDDTVSAKGFKAEYLAV 3455
            C   +T++ G IKSP YP  YP  ++CEW II     IIQLT     +E H +C YD L +       +    + CG   P+    +    N + ++F SD SV + GF I +N I     C+G +  TE          Y  PY  N  C W +   E     LT +L F   E    + C YDS++I D ++V   ++ + CG   P+  I S    + + F +D   + +GF A+Y ++
Sbjct: 2749 CGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCG-LNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGS---IKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPF-DLERTSLHTCHYDSLRIIDSNAVT--LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI 2983          

HSP 3 Score: 104.375 bits (259), Expect = 4.975e-22
Identity = 81/271 (29.89%), Postives = 124/271 (45.76%), Query Frame = 3
Query: 1464 YNCPKCGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAIS--PIISKGSRIWIRYKNQAPSRNTGFVASYQAV-----CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFE-SFKIEKHD--TCVYDFLEIRDGHDEQKRLLSKICGYQIPG-PIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHG---CSHVCVNTLGAYMC 2234
            Y   +CG  L E      SP    ++      DC+W I   E   + L I   H+   LDC  ++L IR     +S    + C    IS   +    +R+ + + +       GFV  Y  +     C G I  +EG I SPNYP+ Y  N +C W I VP GY ++L F+  F +E+    TC YD L I D +     LLS++CG   P  PI ++ NQM + F +D +   +GF A ++       +++ G    ++V +   G+  C
Sbjct: 2744 YKFSRCGGLLTESFGYIKSPGYPEKY--PDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSN--AVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITC 3010          

HSP 4 Score: 97.8265 bits (242), Expect = 4.356e-20
Identity = 85/281 (30.25%), Postives = 115/281 (40.93%), Query Frame = 3
Query: 2289 CGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKP--PQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFS---DFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPV-PMKSQHNSILITFTSDGSVQRRGFKITFNSICDG 3113
            CGGL+ ES G + SP YP  YP N  C W IIA +   I        +E    DC YD++ +    E +     K CG  P   + ++   N + ++F+SD +V K GF I                           Y    P               D C   I +  G IKSPNYP  YPS   C W I    G+ + LTF    D E  S   C YD L + D  ++    L   CG+  P  P+ S  N + + F++D +    GF   + SIC G
Sbjct: 2749 CGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLE-HHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIE--------------------------YNFINPA--------------DTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAV--TLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGG 2986          

HSP 5 Score: 91.6633 bits (226), Expect = 3.682e-18
Identity = 127/499 (25.45%), Postives = 185/499 (37.07%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNISEFHIPESLDCTIN-YLEIRDGVYENSDLIGRYCARA--AISPIISKGSRIWIRYKNQAPSRNTG---FVASYQAV---CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQ---IPGPIKTTNNQMYIKFMSDSSVEKQGFTA-YFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGL--IKESNGSLHXXXXXXXXXXXKK-CIWRIIASKK---AKIFFNFTEFDVEGKEKDCQYD-YINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESH-QECTYDQLIVYDGASIKNKQLGRF 2990
            +DCQW      G  V L      +  S++C+    L+  +    + + + + C R     S II   +  +      A   N G   F  +Y+     C  E+  SEG I SPNYP FY  N +C W + V    SI LK   F+ E+   C YD++EI    +     L  +CG     I     + NN+M IKF +D +V  +GF A YF+                                            CGGL    ESN  L SPNYP  Y      C W ++A+      +IFF F  F+      +C  D  + + +G  NN       C K P  PI S  + L +     ST     FK  +                     +GS  C                    G  + + D  G   SP YP +     +C + I  +PG  I L+  +F  E+      +D + + +G +  +  LGRF
Sbjct: 1480 IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILKAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVRESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANLIQTRFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVIL--KSTSGNAIFKAAY--------------------GVGSSTC--------------------GGDFYLDD--GLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF 1890          

HSP 6 Score: 90.1225 bits (222), Expect = 9.792e-18
Identity = 136/564 (24.11%), Postives = 206/564 (36.52%), Query Frame = 3
Query: 1824 CGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTN-----NQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNF-TEFDVEGKE-KDCQYDYINVYDGPENNQKKLGKYCGKKPP-QPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGH--IIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTS-DGSVQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLET-INQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSM---PTLITSQSGNLLIHFVSDDT--VSAKGFKAEYLAVPKP 3464
            CGG +  S G I SP YPE Y  N  C W I  P    I L  ++  +E H  C YD L IR   +       K+CG     PI         N+M + F SD SV K GF                                  I Y       TC     G+I  + GS+ SPNYP  YP N +C W I   +  K+   F   FD+E      C YD + + D   N    L + CG  PP  PI S+ N++++ F +D     +GF   +                                           K++ G  Y++    GEI S N  +       CE+ I     H  ++ +  + F    H       L   +G  +  +   R CG            SI I +T+ +  ++   F+  +    + K+ +  +  ++     + +PY+ N N  W+    +    ++ L+ +  E    + C YD V     SS  +  I  +CG      P +I +    L++ F SD +   +  GF A     P P
Sbjct: 2749 CGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLN---PISNETLSFHRNRMRLSFHSDFSVSKNGFV---------------------------------IEYNFINPADTCN----GIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY-------------------------------------------KSICGGVYDL--RQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQ---RICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIE-RSYDGCNYDFVSFSTNSSNSSDAI--FCGNLTNISPFMIDTNV--LIVRFQSDISHYENHTGFVAFINPTPGP 3217          

HSP 7 Score: 89.3521 bits (220), Expect = 1.611e-17
Identity = 150/680 (22.06%), Postives = 266/680 (39.12%), Query Frame = 3
Query: 1545 FSGALDCQWRISVTEGERVSLNI-------SEFHIPESLDCTINYLEIRDGVYENSDLIGRYCA----RAAISPIISKGSRIWI--RYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCE---NACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKP-PQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLI-VYDGASIKNKQLGRFCG----SKTPVPMKSQHNSILITFTS-DGSVQRRGFKITF---NSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTLI----TSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTY 3494
             S +  C + I V + +++ +NI       S F IP     T   L+I DG   ++  I   C     R  I    +  +  ++  +Y+N      T   +S    CG    ++ G I SPNYP F   N  C W+I    G  I +K                  IR G  ++    +K+C  + P  +K    +  I  +    + K      F+++            HV    L +      + Y      + CE    +  G I+  N  L            + C W++ + + +KI     +FD+   +    Y ++ + D   ++   L K CG +   +  TS+   + I  Y+D +      + +          +    E+     I ++Y      Y  H               + +  +G I+S  +P +  +  +C+W   T PG  ++L F   E+ES   C+   ++  ++   +    + + C      K+ +   S HN  L  F++ D +   R F+ T+   N  C+ ++  +E    I     Y   Y  N  C W L+ + + +++ LK L FE E E+ C YD V+I+   +     +   CG  M  LI    +S +  +LI F +D TVS++GFKA+Y       + A +S  +
Sbjct: 1119 LSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQAT---LKIIDGAIGSAS-IANVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDE----TKLCNDKNP-VLKLVTAKKEINIVCSEQITKM---HVFEEQS----------VHVIFQNLASTKYRFRLYYT-----QDCEFPITSSSGRIESKNEML------------RYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---SSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH----------EGTVLEYQTQGCIETFY------YDPHES-------------DYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILKAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEG---IIQSPNYPNFYPHNLRCSWNLK-VRESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCG-KMANLIQTRFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQF 1705          

HSP 8 Score: 78.9518 bits (193), Expect = 2.824e-14
Identity = 73/239 (30.54%), Postives = 102/239 (42.68%), Query Frame = 3
Query: 2748 EKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPV---PMKSQHNSILITFTSDGSVQRRGFKITFNSICDGKLIATEEPQFIFSHA---AYGTPYNINQNCLWLL--ETINQQLTVQLKFLHFEVEPEN-QCTYD-SVKIYDG----SSVMA---------PMIGQYCGTSMPTLITSQSGNLLI 3395
            E T   C +E++ + G I+SPNYP  YP    C W +       I L   DFE E    C YD + ++   +    +L   CG    +      S +N +LI F +D +V  RGFK  +   C G  +A E  QF+ S      Y  P  I   C W L   T    L +   F+ FE    N  C+ D S+ I +G    SSV A         P+I    G  +  ++ S SGN + 
Sbjct: 1572 EFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVRESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANLIQTRFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI---CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISN--GHYLKVILKSTSGNAIF 1804          

HSP 9 Score: 75.485 bits (184), Expect = 2.941e-13
Identity = 62/222 (27.93%), Postives = 104/222 (46.85%), Query Frame = 3
Query: 1545 FSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPIISKGS-----RIWIRYKNQAPSRNTGFVASYQAV-CGGEIHASEGRIISPNYPEF------------YKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICG-YQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYF 2153
            +SG   C ++    E  +++++  +F I +  +C  ++++I      +  L  RYC     + +I+  S     +I + +K+ +    TGF A      CGG    +   II   YPE             Y+ NK C W+IT  +   I   F+ F +E H  C YD+LE+   HD Q +   + CG +   GP  T  +++ I+F+SD+SV  +GF   F
Sbjct:  883 YSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYC-NGNKNELITLNSNDETKKIIVTFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIG--YPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELI--HDNQTK---RFCGNHAESGP--TVTHKLVIRFVSDNSVSGEGFIMRF 1091          

HSP 10 Score: 73.559 bits (179), Expect = 1.222e-12
Identity = 61/235 (25.96%), Postives = 103/235 (43.83%), Query Frame = 3
Query: 1509 NFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLD-CTINYLEIRDGVYENSDLIGRYCARAA-ISPIISKGSRIWIRYKNQAP--SRNTGFVASYQAV------CGGEIHASEG-----RIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIE-----KHDTCVYDFLEIRDGHDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYF 2153
            NF SP   N        +  W  +   G   S+N+    I  S D C  +++        +SD I  +C     ISP +   + + +R+++       +TGFVA           CGG ++A+ G     + +  +    Y+ N  C W+I  P G+++ + FE+  I      +   C YD + I DG D  + ++  +CG      I T +N MY+ F +D +++K GF   F
Sbjct: 3115 NFPSPYHHNA-------NLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVSFSTNSSNSSDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF 3340          

HSP 11 Score: 72.0182 bits (175), Expect = 3.684e-12
Identity = 60/245 (24.49%), Postives = 110/245 (44.90%), Query Frame = 3
Query: 1485 KTLLEYSDNFSSPEREN----EWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCARAAISPI-ISKGSRIWIRYK-----NQAPSRNTGFVASYQA-VCGGEIHASEGRIISPNYPEF----YKPNKQCIWKITVPI-GYSIALKFESFKIEKHDTCVYDFLEIRDGH-DEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEHD 2168
            KT+  +S    SP   N    +  F G L     I+  E + +++ + +  I  S++C+++   I+D   ++ + I ++C   +   + IS   ++ I+Y+     N   + +  F  SY+   C     A  GRI+  N   F    Y  N  C   +  P         F+ F +E+  TC YD+++   G   EQ+ +L KICG  IP    T ++++ + F++D S+   G+   +    D
Sbjct: 3351 KTVTNFSQLLESPRYPNNSPYDLRFMGEL-----IAANETDHITITVKDLKIRFSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIV--NVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINHDGYDITYVVNRD 3588          

HSP 12 Score: 68.5514 bits (166), Expect = 4.065e-11
Identity = 55/202 (27.23%), Postives = 93/202 (46.04%), Query Frame = 3
Query: 1479 CG--KTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHI-----PESLDCTI-NYLEIRDGVYENSDLIGRYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASY---QAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDT-CVYDFLEIRDGHDEQKRLLSKI 2048
            CG  +  +E +    SP   + +T    + C+W + V     + L I  + +       + +C+  N L I +G+  NS +    C ++   PIIS G  + +  K  + S N  F A+Y    + CGG+ +  +G   SP YP     +  C++ I    G SI L  E F  E   +  ++DF++IR+G +E   LL + 
Sbjct: 1693 CGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNL-VANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILK--STSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF 1890          

HSP 13 Score: 67.781 bits (164), Expect = 5.694e-11
Identity = 63/237 (26.58%), Postives = 94/237 (39.66%), Query Frame = 3
Query: 2799 IKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIE-SHQECTYDQLIVYDGASIKNKQLGRFCGSKTPV-PMKSQHNSILITFTSDGS--VQRRGFKITFNSI------CDGKLIATEEPQFIFSHAAYGTP--YNINQNCLWLLETINQQLTVQLKFLHFEVEPENQ-----CTYDSVKIYDGSSVMAPMIGQYCGTSMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVP 3458
            +K+PN+P  Y   +N  W      G+I  +     +IE S+  C YD   V    +  N     FCG+ T + P     N +++ F SD S      GF    N        C G + AT     +           Y  N  C W +        V++ F +  +  E +     C YD + IYDG     P+I   CG      IT+QS  + + F +D  +   GFK  + A+P
Sbjct: 3111 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYD--FVSFSTNSSNSSDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGH-AVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAIP 3344          

HSP 14 Score: 64.6994 bits (156), Expect = 5.536e-10
Identity = 63/238 (26.47%), Postives = 107/238 (44.96%), Query Frame = 3
Query: 2796 EIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFC-GSKTPVPMKSQHNS---ILITFTSDGSVQRRGFKITFNSI-CDGKLIATEE-----PQFIFSHAAYG--TPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVK-IYDGSSVMAPMIGQYCGT---SMPTLITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPK 3461
            E +S NYP  Y   S+C ++       I  ++F DF+I    EC +D + +    S    Q  R+C G+K  +   + ++    I++TF S+ +    GF+   +   C G    T +     P+   + + Y   T Y  N+ C W + T      +   F  F +E    C YD ++ I+D  +       ++CG    S PT+    +  L+I FVSD++VS +GF   +  V +
Sbjct:  873 EFQSDNYPQNYSGNSHCVYQFYAETRKI-AISFLDFDINDDSECKFDFIKISGSNSGHLDQ--RYCNGNKNELITLNSNDETKKIIVTFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTF-LDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT------KRFCGNHAESGPTV----THKLVIRFVSDNSVSGEGFIMRFYTVKR 1096          

HSP 15 Score: 63.1586 bits (152), Expect = 1.785e-9
Identity = 75/290 (25.86%), Postives = 117/290 (40.34%), Query Frame = 3
Query: 1800 FVASYQAVCGGEIHASEGRII---SPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEI---RDGHDEQKRLLSKICGYQIPGPIKTTNN----QMYIKFMSDSSVEKQGFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNE 2639
            F  S +  CG  ++  E       S NYP+ Y  N  C+++        IA+ F  F I     C +DF++I     GH +Q+      C       I   +N    ++ + F S+S+    GF A       +      G S    N L        IGY                  ES+ +  + +  + Y  NK C W I       IF+ F +F +E    +C YDY+ +     +NQ K  ++CG       T  T++L I F SD++V  +GF + FYT + +
Sbjct:  852 FQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKISGSNSGHLDQR-----YCNGNKNELITLNSNDETKKIIVTFKSNSTFAGTGFRA-------KVSVFDCGGSFFLTNKL-------IIGY-----------------PESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLE-SHPNCAYDYLELI---HDNQTK--RFCGNHAESGPT-VTHKLVIRFVSDNSVSGEGFIMRFYTVKRD 1097          

HSP 16 Score: 59.6918 bits (143), Expect = 1.677e-8
Identity = 114/587 (19.42%), Postives = 216/587 (36.80%), Query Frame = 3
Query: 1563 CQWRISVTEGERVSLNISEFHIPESLDC-----TINYLEIRDGVYENSDLIGRY-CARAAISPIISKGSRIW----IRYKNQAPSRNTGFVASYQAVCGGEI-HASEGRIISPNYPEFYKPNKQCIWKITVP-IGYSIALKFESFKIEKHDTCVYDFLEIRDGHDEQKRLLSKICGYQIP---GPIKTTNNQMYIKFMSDSSVEKQ--GFTAYFQQEHDECKNMKHGCSHVCVNTLGAYMCACDIGYELQ--ADGKTCENACGGLIKESNGSLHXXXXXXXXXXXKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDYINVYDGPENNQKKLG--KYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKINFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDGCTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITF---NSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLET-INQQLTVQLKFL 3248
            C W I     E + + +  F +  S +C     T+ +   ++ ++  S+ +    C     S      + ++    I YK        GF  SY+  C  +  +  EG + +  YP     NK C + +    + Y + L         +  CV  FL+I         +   +CG  IP    PI T ++ + +    + S E +  GF   + ++ +E                      C   +EL    D +        ++  ++  LH   +        +C W   +    ++  +F +  +      C   ++  +DG     +K+G   +C K     I +  N LTI F +         K+           K G C                 G  LH ++                  G I SPNYP+ YP  S+C W+I       I+LTF D +++  + C+   L V      +N  +   C S T   + ++++++ I F ++    R+GFK+ +   + +C G+     +P+   +   Y    +    C W +   +++++ V++K L
Sbjct: 2082 CTWTILTDRTEALDIQMLNFDLESSYECKYENFTVEFTGSKNPIFSFSEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDHFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-----AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEE----------------------CGGRHELTRYQDSR--------IVDMNSNRLHMTPHFI------ECKWHFTSPPGTRMQIDFEDLVI--SRIICNESFLAFFDGSTTFTQKIGGQNFCTKT--NSIFTIGNVLTILFKNMDDFSYFRLKV-----------KIGSC-----------------GGLLHRRQ------------------GYIASPNYPLNYPPISSCIWQISGFSYSNIRLTFMDRDLD--ENCSKSNLTVIPLKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEY---SDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKL 2571          

HSP 17 Score: 56.225 bits (134), Expect = 1.896e-7
Identity = 69/275 (25.09%), Postives = 111/275 (40.36%), Query Frame = 3
Query: 2712 PGYQLHGKKNCKE--KTVDGCTYEI--TDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIESHQECTYDQLIV-YDGAS---------IKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGSVQRRGFKITFNSIC--------DGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETINQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQ-YCGTSMP----TLITSQSG---NLLIHFVSDDTVSAKGFKAEY 3446
            PG+ +       E  K +  C Y I  T+    + SPNYP    ++  C W I+T     + +   +F++ES  EC Y+   V + G+          +   + G    S+  V      NSI IT+ +D      GFK+++   C        +G L   E P  IF           N+NC ++L +      + L  L        +C    +KI      +A  I +  CG+++P     +IT+ S    NL  +F S+   S  GF+  Y
Sbjct: 2034 PGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLNFDLESSYECKYENFTVEFTGSKNPIFSFSEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDHFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFE----------NKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKI------LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYS--GFQIMY 2290          

HSP 18 Score: 55.8398 bits (133), Expect = 2.770e-7
Identity = 39/171 (22.81%), Postives = 71/171 (41.52%), Query Frame = 3
Query: 1479 CGKTLLEYSDNFSSPERENEWTFSGALDCQWRISVTEGERVSLNISEFHIPESLDCTI-NYLEIRDGVYENSDLIGRYCARAAISPIISK---GSRIWIRYKNQAP--SRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEK 1973
            CG         F+SP   N       LDC + I  + G  + L+I EF    ++   + ++++IR+G  E S L+GR+   + I            +WIR ++Q    + +  F+A Y      E  +  G + SP +   Y  + +  W +       +   F+ F + +
Sbjct: 1815 CGGDFYLDDGLFTSPFYPNSVNMD--LDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR 1983          

HSP 19 Score: 54.299 bits (129), Expect = 7.417e-7
Identity = 34/123 (27.64%), Postives = 58/123 (47.15%), Query Frame = 3
Query: 1557 LDCQWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIG--RYCARAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIISPNYPEFYKPNKQCIWKIT 1919
            ++C+W  +   G R+ ++  +  I   + C  ++L   DG    +  IG   +C +   + I + G+ + I +KN              + CGG +H  +G I SPNYP  Y P   CIW+I+
Sbjct: 2326 IECKWHFTSPPGTRMQIDFEDLVISRII-CNESFLAFFDGSTTFTQKIGGQNFCTKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKIGS-CGGLLHRRQGYIASPNYPLNYPPISSCIWQIS 2444          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000013804.1 (SMESG000013804.1)

HSP 1 Score: 109.768 bits (273), Expect = 5.482e-24
Identity = 70/207 (33.82%), Postives = 107/207 (51.69%), Query Frame = 3
Query:  864 RYRRAATSFKFRTWTHGIIPYYIQANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIG--QRIMLSPGDIRQTNKLYNCPK 1478
            R +RA  ++  + WT  IIPY    +FS   K  + KA+  ++  TCL F+  + +  +  +  EK   C S +G ++  E Q +++ K C + G+V+HELGH IG  HE  RPDR+ H+  + EN+       F ++ES+     N  +D+QSIM Y+   FSK      ++  A   R PI       LS  D++  N LY C K
Sbjct:   24 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGE-QLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENIQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNA-SDRTPIFDISEKDLSFWDVKAINDLYQCGK 227          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000073667.1 (SMESG000073667.1)

HSP 1 Score: 103.99 bits (258), Expect = 1.100e-23
Identity = 60/200 (30.00%), Postives = 94/200 (47.00%), Query Frame = 3
Query:  897 RTWTHGIIPYYI-QANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIGQRIM-------LSPGDIRQTNKLYNC 1472
            + W +  I Y I   +F  +    ++ AM  ++  TCL F P + SD+  +I    + GC + +G+  +   Q +++G  C   G+ +HELGH IG  HEH  PDRD  V +  +NV       F  +   +V      YD QS+MHY +  F+K +             P   QR +       LS GD+++ N +Y C
Sbjct:   47 KRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEF-QRYLYYVWMKDLSFGDVKRINLMYKC 245          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074510.1 (SMESG000074510.1)

HSP 1 Score: 103.99 bits (258), Expect = 1.501e-22
Identity = 62/177 (35.03%), Postives = 97/177 (54.80%), Query Frame = 3
Query:  864 RYRRAATSFKFRTWTHGIIPYYI-QANFSSETKATIMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQAISIGK-NCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFNFKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPK 1388
            R +RA  S +   WT+  IPYYI ++ F+ E    +  A+  W   TC+ F  K + D +++  T  T  C S+VG   E E Q++S+   +C   G  +HELGHV+G  HEHTRP R+  + +  + +  G +  + + +  E++S N  YD QS+MHY   +FS  + + TI  K
Sbjct:   27 RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNDDINWVKITGGT-QCHSFVGMNEEGE-QSLSLASPDCRFYGTYLHELGHVLGLLHEHTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVK 201          
The following BLAST results are available for this feature:
BLAST of Metalloendopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLL10.000e+045.29tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL20.000e+044.06tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844][more]
TLL10.000e+044.27tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
BMP10.000e+047.28bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
BMP11.601e-7149.41bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nas-390.000e+042.56Zinc metalloproteinase nas-39 [Source:UniProtKB/S... [more]
nas-43.476e-3735.32Zinc metalloproteinase nas-4 [Source:UniProtKB/Sw... [more]
ZC116.34.265e-3722.25Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc... [more]
nas-141.665e-3639.70Zinc metalloproteinase nas-14 [Source:UniProtKB/S... [more]
nas-41.966e-3635.32Zinc metalloproteinase nas-4 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tok8.643e-3448.08gene:FBgn0004885 transcript:FBtr0084690[more]
tok8.643e-3448.08gene:FBgn0004885 transcript:FBtr0339252[more]
tok8.643e-3448.08gene:FBgn0004885 transcript:FBtr0084689[more]
tld0.000e+044.52gene:FBgn0003719 transcript:FBtr0084691[more]
Cubn1.260e-4022.82gene:FBgn0052702 transcript:FBtr0273437[more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll10.000e+045.19tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll10.000e+045.19tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll10.000e+045.19tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
bmp1a0.000e+048.90bone morphogenetic protein 1a [Source:ZFIN;Acc:ZDB... [more]
bmp1b0.000e+045.47bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000007933.10.000e+044.80tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000008231.10.000e+044.88tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007882.10.000e+047.99tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007804.10.000e+047.99tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007792.10.000e+047.99tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tll20.000e+044.00tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll10.000e+044.99tolloid-like [Source:MGI Symbol;Acc:MGI:106923][more]
Bmp10.000e+044.06bone morphogenetic protein 1 [Source:MGI Symbol;Ac... [more]
Tll20.000e+042.47tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Cubn1.860e-7628.08cubilin (intrinsic factor-cobalamin receptor) [Sou... [more]
back to top
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JI28|TLL1_XENLA0.000e+046.54Tolloid-like protein 1 OS=Xenopus laevis OX=8355 G... [more]
sp|Q9DER7|TLL1_CHICK0.000e+045.83Tolloid-like protein 1 OS=Gallus gallus OX=9031 GN... [more]
sp|O57382|TLL2_XENLA0.000e+045.25Tolloid-like protein 2 OS=Xenopus laevis OX=8355 G... [more]
sp|O43897|TLL1_HUMAN0.000e+045.29Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|O57460|TLL1_DANRE0.000e+045.19Dorsal-ventral patterning tolloid-like protein 1 O... [more]
back to top
BLAST of Metalloendopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VQ020.000e+055.79Metalloendopeptidase OS=Schistosoma mansoni OX=618... [more]
A0A1S3HHT94.983e-7847.79Metalloendopeptidase OS=Lingula unguis OX=7574 GN=... [more]
A0A2T7PWN13.416e-6850.92Metalloendopeptidase OS=Pomacea canaliculata OX=40... [more]
R7U2Q90.000e+052.32Metalloendopeptidase OS=Capitella teleta OX=283909... [more]
A0A147BQI36.105e-7051.33Metalloendopeptidase (Fragment) OS=Ixodes ricinus ... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp1b0.000e+045.80bone morphogenetic protein 1-like [Source:NCBI gen... [more]
bmp1a0.000e+049.18bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
tll10.000e+044.72tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll10.000e+047.61tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll10.000e+047.14tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007253.11.225e-848.68pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1... [more]
ENSPMAT00000010323.16.325e-4529.35pep scaffold:Pmarinus_7.0:GL476365:125003:472029:-... [more]
ENSPMAT00000001629.12.900e-4429.92pep scaffold:Pmarinus_7.0:GL476369:34656:293612:-1... [more]
ENSPMAT00000006495.11.338e-3730.72pep scaffold:Pmarinus_7.0:GL479301:959:30909:1 gen... [more]
ENSPMAT00000008884.12.547e-3627.39pep scaffold:Pmarinus_7.0:GL477160:356:88814:-1 ge... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417830.000e+044.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434718.230e-9835.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424212.159e-4343.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301945.718e-4345.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444721.322e-4234.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll10.000e+044.77tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
bmp1a0.000e+048.97bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
tll10.000e+047.42tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
bmp1b0.000e+043.80bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
cubn2.556e-8829.79cubilin [Source:NCBI gene;Acc:105353827][more]
back to top
BLAST of Metalloendopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005882.10.000e+099.72SMESG000005882.1[more]
SMESG000068883.14.657e-2522.78SMESG000068883.1[more]
SMESG000013804.15.482e-2433.82SMESG000013804.1[more]
SMESG000073667.11.100e-2330.00SMESG000073667.1[more]
SMESG000074510.11.501e-2235.03SMESG000074510.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019039 ID=SMED30019039|Name=Metalloendopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=3655bp
CTTCCGATCTCTTCAATGTGAATTTCTTTTGATTTGTACGAATAACCGCG
AATTCACTGTTTTAATTCGATAATTCGATAATTTAATTTCACAATTTACG
CACACGACGGTTTGCATTGTTAAAAATTTAACGAAAAAAAAATATTAGTT
TTCAAACCGAAAGAAAAAATCGGTGGCAATCAAAACAAAACCACAATCCG
GATCGAAAACCACCACAACAACAAACAAAAAGCAAAACCGAAGAGTGGAA
TTTCTGGCATCATAATTGTTTATGGTTGGCTGGTGAAACTCGTGAATTTG
ATTCGTCACAATTGTTGAATATTGGATTTACACGGACTTGGAAACATTGA
TTTGTGTTGATTTTAATGGAATTAATGTTACGTAAATTTTTAACCAGTTT
TGGATATCTCCTAAAAATATTCCTAGTTTTATTACTTATTAGTTTATCAT
CGACTTCTCATTTTCCAAATCATAATAATAATAATAATATTGATGAGTTG
GAACTTAAAGAAAATTTTCGATTTTTAGATCCATGTAAAGCAAATGCATT
TATGGGTGATATAGCCCTCACTGATGACGAAAAAATGAGAATGCTTGAAA
GAGACATCCTCTTATCAAGAGAATCTATTCAATCATGGCAACCGGAGAGT
AACAATAGCTCAAATCATTATTCTCACAAAATTCGCCGGAAAAACGACAC
AATACTTCCAGAAAGTTTGTTTAAAGAACCTGAATTTGTCCAAACGAAAG
AATGGTGGAATTCATATTATAAGACTCTGAAGCTAAAACCAAGTCAAATA
AGAAAGTTGACAGAAATGCGATTTTCCCCAATTCAGCGGTTAAAGAGACA
TACGAATAGAAAAAGATATCGTAGAGCTGCTACCTCATTCAAATTTCGAA
CATGGACACATGGGATTATTCCTTATTATATTCAAGCTAATTTCTCCAGT
GAAACAAAGGCTACCATAATGAAAGCCATGCGGCATTGGGAAAATTATAC
GTGCCTTAGCTTTATTCCTAAACGAAGCTCTGATAAATCCTACATAATTT
TTACAGAAAAAACATGCGGATGTTGTTCATACGTCGGCAGGAGAAGTGAA
GATGAGCCTCAAGCAATATCAATTGGTAAGAACTGTGATAAAAAGGGCAT
TGTTATTCATGAGCTTGGACATGTTATTGGCTTTTGGCATGAACATACAA
GACCGGATAGAGATGATCATGTTGATATTCTACTGGAGAACGTTGTTGTC
GGTCAGGATTTTAATTTCAAAAAGATGGAATCTCACGAAGTTGATTCCTT
AAATGAAGCATATGATTATCAGTCTATCATGCATTATGCAAAAGGAACGT
TTTCTAAGGCGAATAAAGAGTGGACGATACGACCCAAAGCATGTTGCCCT
AGACCACCTATTGGTCAAAGAATAATGTTGAGCCCTGGAGATATTCGGCA
GACAAATAAGTTATATAATTGTCCAAAATGCGGAAAGACACTTTTAGAAT
ATTCGGATAATTTCTCATCCCCAGAAAGAGAAAACGAGTGGACATTTTCT
GGTGCATTAGATTGTCAATGGAGAATATCGGTTACAGAAGGTGAAAGAGT
TTCCTTAAACATATCGGAATTCCATATTCCAGAAAGCCTTGACTGTACGA
TAAATTATCTTGAAATAAGGGACGGAGTTTATGAAAATTCAGATTTAATA
GGAAGATATTGTGCGAGAGCGGCAATTTCACCAATAATCAGCAAAGGATC
TCGCATATGGATCAGATACAAAAATCAGGCCCCTAGCAGAAATACTGGTT
TTGTGGCATCCTATCAAGCGGTTTGCGGAGGGGAAATCCACGCATCAGAG
GGTCGCATAATCAGTCCAAATTATCCAGAATTCTACAAACCAAACAAACA
GTGCATCTGGAAAATCACAGTTCCAATCGGATATTCAATCGCATTGAAAT
TTGAATCGTTCAAGATTGAAAAGCACGATACATGCGTTTATGATTTCTTA
GAAATAAGAGATGGACACGACGAACAGAAGAGATTATTGTCAAAAATTTG
TGGATACCAAATACCTGGGCCAATTAAAACTACAAACAATCAAATGTATA
TTAAATTTATGTCCGATAGCTCTGTAGAAAAACAAGGATTCACAGCTTAT
TTTCAACAAGAGCATGATGAATGTAAAAATATGAAGCACGGATGTTCTCA
TGTTTGTGTAAATACACTTGGAGCTTATATGTGCGCTTGCGATATCGGAT
ATGAGCTACAAGCGGATGGTAAGACATGTGAAAATGCGTGTGGGGGTCTA
ATAAAGGAGTCAAACGGAAGCCTTCATAGTCCAAATTATCCATCAAATTA
TCCGCCGAATAAGAAGTGCATATGGAGAATCATAGCATCAAAGAAAGCTA
AAATATTTTTCAACTTTACTGAATTCGACGTCGAAGGAAAAGAAAAAGAT
TGCCAATATGATTACATAAATGTTTATGATGGACCAGAAAACAATCAGAA
AAAACTGGGAAAGTATTGTGGTAAAAAGCCACCTCAACCTATTACATCAA
CAACTAATGAGTTGACAATTGCCTTCTATTCGGATAGCACAGTGCAAAAG
AAAGGATTCAAAATCAATTTTTATACCGATCGAAATGAGTGTGAAGACAA
AAACGGAGAATGTGAACATTTTTGTGTGAATACCATCGGTTCTTATTATT
GCCATTGTCGGCCTGGATATCAGCTTCATGGAAAGAAAAATTGTAAAGAA
AAAACAGTGGATGGGTGTACCTATGAAATAACGGATGCTCATGGTGAAAT
CAAAAGTCCGAATTATCCCGTAACATATCCATCTAAAAGCAACTGTGAAT
GGAAAATCATCACAACTCCTGGTCACATAATTCAATTAACTTTCTCTGAC
TTTGAAATAGAGTCTCATCAAGAATGCACTTATGATCAATTAATTGTCTA
CGACGGGGCATCAATTAAAAATAAACAGTTGGGCAGATTCTGTGGTAGCA
AAACTCCAGTTCCGATGAAGTCTCAACATAACTCAATATTAATAACATTC
ACTTCCGACGGATCAGTTCAAAGGCGTGGATTTAAAATAACTTTCAATTC
TATTTGCGATGGGAAATTAATTGCCACAGAAGAGCCTCAATTTATTTTCT
CCCATGCTGCCTATGGTACGCCTTACAACATTAATCAGAATTGTCTGTGG
CTGTTGGAAACAATTAACCAACAATTAACAGTGCAATTAAAATTTTTGCA
TTTTGAAGTAGAGCCAGAAAATCAGTGCACATATGACAGTGTAAAAATAT
ACGATGGATCAAGTGTGATGGCGCCAATGATTGGCCAGTATTGCGGAACT
TCGATGCCAACTCTCATCACGTCTCAAAGTGGAAATTTGTTAATACATTT
TGTATCAGACGACACTGTTAGTGCAAAAGGCTTTAAGGCTGAGTACCTAG
CAGTTCCGAAACCCCATAAGAATGCAAAAGATTCTCAAACGTACAGATTT
CAGTATCAAGTTCAACGGTCTGTTAATTCAGTCAACAGTAAAAGAAATAA
TGAATTCATCGAACATGCTTGAGAATTTTGGTCATTTCAAGTGTTTGTTT
TCTCTGTAGATTAACTGTAGAATTCATATTGTTTGTAACTTTCCATAGAC
ACAAA
back to top

protein sequence of SMED30019039-orf-1

>SMED30019039-orf-1 ID=SMED30019039-orf-1|Name=SMED30019039-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1069bp
MELMLRKFLTSFGYLLKIFLVLLLISLSSTSHFPNHNNNNNIDELELKEN
FRFLDPCKANAFMGDIALTDDEKMRMLERDILLSRESIQSWQPESNNSSN
HYSHKIRRKNDTILPESLFKEPEFVQTKEWWNSYYKTLKLKPSQIRKLTE
MRFSPIQRLKRHTNRKRYRRAATSFKFRTWTHGIIPYYIQANFSSETKAT
IMKAMRHWENYTCLSFIPKRSSDKSYIIFTEKTCGCCSYVGRRSEDEPQA
ISIGKNCDKKGIVIHELGHVIGFWHEHTRPDRDDHVDILLENVVVGQDFN
FKKMESHEVDSLNEAYDYQSIMHYAKGTFSKANKEWTIRPKACCPRPPIG
QRIMLSPGDIRQTNKLYNCPKCGKTLLEYSDNFSSPERENEWTFSGALDC
QWRISVTEGERVSLNISEFHIPESLDCTINYLEIRDGVYENSDLIGRYCA
RAAISPIISKGSRIWIRYKNQAPSRNTGFVASYQAVCGGEIHASEGRIIS
PNYPEFYKPNKQCIWKITVPIGYSIALKFESFKIEKHDTCVYDFLEIRDG
HDEQKRLLSKICGYQIPGPIKTTNNQMYIKFMSDSSVEKQGFTAYFQQEH
DECKNMKHGCSHVCVNTLGAYMCACDIGYELQADGKTCENACGGLIKESN
GSLHSPNYPSNYPPNKKCIWRIIASKKAKIFFNFTEFDVEGKEKDCQYDY
INVYDGPENNQKKLGKYCGKKPPQPITSTTNELTIAFYSDSTVQKKGFKI
NFYTDRNECEDKNGECEHFCVNTIGSYYCHCRPGYQLHGKKNCKEKTVDG
CTYEITDAHGEIKSPNYPVTYPSKSNCEWKIITTPGHIIQLTFSDFEIES
HQECTYDQLIVYDGASIKNKQLGRFCGSKTPVPMKSQHNSILITFTSDGS
VQRRGFKITFNSICDGKLIATEEPQFIFSHAAYGTPYNINQNCLWLLETI
NQQLTVQLKFLHFEVEPENQCTYDSVKIYDGSSVMAPMIGQYCGTSMPTL
ITSQSGNLLIHFVSDDTVSAKGFKAEYLAVPKPHKNAKDSQTYRFQYQVQ
RSVNSVNSKRNNEFIEHA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000141dorsal region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR035914Sperma_CUB_dom_sf
IPR029837BMP-1
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR001506Peptidase_M12A
IPR000859CUB_dom
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR006026Peptidase_Metallo
IPR024079MetalloPept_cat_dom_sf
IPR015446BMP_1/tolloid-like
IPR013032EGF-like_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR018097EGF_Ca-bd_CS
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0004222metalloendopeptidase activity
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0003677DNA binding
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0055114oxidation-reduction process
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001506Peptidase M12APRINTSPR00480ASTACINcoord: 315..330
score: 56.77
coord: 201..219
score: 38.42
coord: 257..275
score: 59.04
coord: 355..368
score: 47.38
coord: 276..293
score: 52.5
IPR001506Peptidase M12APFAMPF01400Astacincoord: 179..370
e-value: 9.4E-67
score: 224.3
IPR000859CUB domainSMARTSM00042CUB_2coord: 914..1030
e-value: 2.2E-32
score: 123.6
coord: 642..755
e-value: 6.3E-45
score: 165.2
coord: 801..913
e-value: 9.1E-46
score: 168.0
coord: 372..486
e-value: 3.5E-21
score: 86.4
coord: 487..599
e-value: 8.1E-47
score: 171.5
IPR000859CUB domainPFAMPF00431CUBcoord: 801..910
e-value: 4.1E-36
score: 123.7
coord: 642..752
e-value: 3.1E-38
score: 130.5
coord: 487..596
e-value: 5.2E-36
score: 123.3
coord: 372..483
e-value: 1.5E-20
score: 73.5
coord: 914..1027
e-value: 8.5E-27
score: 93.7
IPR000859CUB domainPROSITEPS01180CUBcoord: 914..1030
score: 23.704
IPR000859CUB domainPROSITEPS01180CUBcoord: 487..599
score: 31.657
IPR000859CUB domainPROSITEPS01180CUBcoord: 801..913
score: 29.411
IPR000859CUB domainPROSITEPS01180CUBcoord: 372..486
score: 21.74
IPR000859CUB domainPROSITEPS01180CUBcoord: 642..755
score: 30.852
IPR000859CUB domainCDDcd00041CUBcoord: 487..597
e-value: 1.99718E-41
score: 145.633
IPR000859CUB domainCDDcd00041CUBcoord: 914..1027
e-value: 7.60333E-30
score: 112.506
IPR000859CUB domainCDDcd00041CUBcoord: 801..912
e-value: 5.40612E-40
score: 141.396
IPR000859CUB domainCDDcd00041CUBcoord: 372..485
e-value: 1.93403E-24
score: 97.0978
IPR000859CUB domainCDDcd00041CUBcoord: 642..754
e-value: 6.54194E-39
score: 138.314
IPR000742EGF-like domainSMARTSM00181egf_5coord: 758..794
e-value: 6.5E-5
score: 32.3
coord: 602..639
e-value: 1.1E-4
score: 31.6
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 599..639
score: 8.29
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 755..794
score: 10.757
IPR006026Peptidase, metallopeptidaseSMARTSM00235col_5coord: 176..320
e-value: 2.3E-47
score: 173.4
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 755..794
e-value: 1.6E-9
score: 47.7
coord: 599..639
e-value: 5.3E-8
score: 42.6
IPR015446Bone morphogenetic protein 1/tolloid-like proteinPIRSFPIRSF001199BMP1coord: 4..1058
e-value: 0.0
score: 1276.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 599..638
e-value: 1.0E-12
score: 50.1
NoneNo IPR availablePFAMPF14670FXa_inhibitioncoord: 603..638
e-value: 3.7E-9
score: 36.7
coord: 759..789
e-value: 1.7E-8
score: 34.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 754..793
e-value: 5.3E-13
score: 50.7
NoneNo IPR availablePANTHERPTHR45645FAMILY NOT NAMEDcoord: 156..1028
NoneNo IPR availablePROSITEPS51864ASTACINcoord: 170..370
score: 82.049
NoneNo IPR availableCDDcd00054EGF_CAcoord: 755..794
e-value: 1.721E-7
score: 46.4758
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 173..369
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 753..801
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 595..640
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 913..1031
e-value: 9.8E-28
score: 98.7
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 372..485
e-value: 7.8E-24
score: 86.4
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 639..753
e-value: 8.1E-41
score: 141.1
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 486..598
e-value: 1.2E-38
score: 134.2
coord: 794..912
e-value: 3.8E-38
score: 132.6
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 367..489
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 492..597
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 647..753
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 928..1030
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 800..913
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 132..371
e-value: 5.2E-71
score: 240.8
IPR029837Bone morphogenetic protein 1PANTHERPTHR45645:SF24BONE MORPHOGENETIC PROTEIN 1coord: 156..1028
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 623..638
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 779..793
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 770..781
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 614..625
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 755..779
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 599..623