slc25a-16

Overview
Nameslc25a-16 (AKN21584.1)
Smed IDSMED30019037
Length (bp)1238
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-16 (SMED30019037) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-16 (SMED30019037) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-16 (SMED30019037) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-16 (SMED30019037) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019037

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30019037SMESG000047064.1 dd_Smed_v4_12847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019037SMESG000047064.1 dd_Smed_v6_12847_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-16 vs. Ensembl Human
Match: SLC25A19 (solute carrier family 25 member 19 [Source:HGNC Symbol;Acc:HGNC:14409])

HSP 1 Score: 217.624 bits (553), Expect = 3.247e-67
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++    KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCN 308          

HSP 2 Score: 92.4337 bits (228), Expect = 2.790e-20
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. Ensembl Human
Match: SLC25A19 (solute carrier family 25 member 19 [Source:HGNC Symbol;Acc:HGNC:14409])

HSP 1 Score: 217.624 bits (553), Expect = 3.247e-67
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++    KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCN 308          

HSP 2 Score: 92.4337 bits (228), Expect = 2.790e-20
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. Ensembl Human
Match: SLC25A19 (solute carrier family 25 member 19 [Source:HGNC Symbol;Acc:HGNC:14409])

HSP 1 Score: 217.624 bits (553), Expect = 3.247e-67
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++    KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCN 308          

HSP 2 Score: 92.4337 bits (228), Expect = 2.790e-20
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. Ensembl Human
Match: SLC25A19 (solute carrier family 25 member 19 [Source:HGNC Symbol;Acc:HGNC:14409])

HSP 1 Score: 217.624 bits (553), Expect = 3.247e-67
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++    KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCN 308          

HSP 2 Score: 92.4337 bits (228), Expect = 2.790e-20
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. Ensembl Human
Match: SLC25A19 (solute carrier family 25 member 19 [Source:HGNC Symbol;Acc:HGNC:14409])

HSP 1 Score: 217.624 bits (553), Expect = 3.247e-67
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++    KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCN 308          

HSP 2 Score: 92.4337 bits (228), Expect = 2.790e-20
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. Ensembl Celegans
Match: hpo-12 (pep chromosome:WBcel235:IV:12283174:12285065:1 gene:WBGene00016588.1 transcript:C42C1.10.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-12)

HSP 1 Score: 202.601 bits (514), Expect = 6.479e-62
Identity = 122/314 (38.85%), Postives = 177/314 (56.37%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ-GEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKL-HVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            N   +  +Y+ AG + G V+R ++QPLDV+KIRFQLQ EPI+    GKYKG+ Q+I  I +EEG  AFWKGH+ +Q  + ++ LVQFS++E        +I   P+  +SV +S+  F  G+L+G  A     P DV RTR  AQ      Y    +A+  I + EG+ G FRG +PS++ +AP TG QF  YN   ++               G    G L    SG +AG++AK  +YP+D+++ R+Q+ GFE  R+ FGK  + S+G+ K I ++   E   G FKGL  S IK+  + G  F  YE  C+
Sbjct:   10 NEPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVI---PADNQSV-RSTSDFACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQFALYNCFMDLWP-----------FNGYESAGAL---FSGAMAGTVAKTVLYPLDMVRHRLQMNGFE--RAGFGKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAANSGCAFLFYEIFCD 303          
BLAST of slc25a-16 vs. Ensembl Celegans
Match: hpo-12 (pep chromosome:WBcel235:IV:12283174:12285122:1 gene:WBGene00016588.1 transcript:C42C1.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-12)

HSP 1 Score: 202.601 bits (514), Expect = 6.479e-62
Identity = 122/314 (38.85%), Postives = 177/314 (56.37%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ-GEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKL-HVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            N   +  +Y+ AG + G V+R ++QPLDV+KIRFQLQ EPI+    GKYKG+ Q+I  I +EEG  AFWKGH+ +Q  + ++ LVQFS++E        +I   P+  +SV +S+  F  G+L+G  A     P DV RTR  AQ      Y    +A+  I + EG+ G FRG +PS++ +AP TG QF  YN   ++               G    G L    SG +AG++AK  +YP+D+++ R+Q+ GFE  R+ FGK  + S+G+ K I ++   E   G FKGL  S IK+  + G  F  YE  C+
Sbjct:   10 NEPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVI---PADNQSV-RSTSDFACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQFALYNCFMDLWP-----------FNGYESAGAL---FSGAMAGTVAKTVLYPLDMVRHRLQMNGFE--RAGFGKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAANSGCAFLFYEIFCD 303          
BLAST of slc25a-16 vs. Ensembl Celegans
Match: slc-25A42 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q93717])

HSP 1 Score: 112.849 bits (281), Expect = 3.424e-28
Identity = 80/308 (25.97%), Postives = 154/308 (50.00%), Query Frame = 2
Query:  191 AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIG-GYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLR 1111
            AGA  G +++  + PLD  KI FQ     + +     ++   + IK  Y+E G  A ++G+ ++  + V ++ +QF+ +E  K     L+    +  ++ +K    ++ GSLA +TAT+ T P D  + R +   + + Y +L +  +   K  G++ L+RG+ P++L V P  G  FF Y     +   +   +G+ +N +           L G +AG + +   YP+DI+++RMQ           G++      ++ +  I+  EG+  G +KGL  + +K  I++G+ F+ YE+V   + +L+
Sbjct:   20 AGAIAGALAKTTIAPLDRTKIYFQ-----VSSTRGYSFRSAIKFIKLTYRENGFFALYRGNSATMARVVPYASMQFAAFEQYK----KLLKVDENGSRTPVKR---YITGSLAATTATMITYPLDTAKARLSVSSKLQ-YSSLKHVFVKTYKEGGIQLLYRGIYPTILGVIPYAGSSFFTY---ETLKIMYRDHRGEVENSY--------YRMLFGMLAGLIGQSSSYPLDIVRRRMQT----------GRIPSGWSPLRALIHIYHTEGLKRGLYKGLSMNWLKGPIAVGVSFTTYEKVLELVGHLK 293          
BLAST of slc25a-16 vs. Ensembl Celegans
Match: ant-1.1 (Adenine Nucleotide Translocator [Source:UniProtKB/TrEMBL;Acc:G3MU69])

HSP 1 Score: 100.138 bits (248), Expect = 1.377e-23
Identity = 80/307 (26.06%), Postives = 140/307 (45.60%), Query Frame = 2
Query:  176 IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAA---QGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            ID A +G +   VS+  V P++ VK+  Q+Q        D +YKGI   +  + KE+G+ A W+G+L++ I+      + F+  +  K  F   + +     K     +     G  AG+T+  F  P D  RTR AA   +   + +  L++ +I I+K++G  GL+RG   S+  +       F  ++ +  V    F + G++ N F    I  + +  SG        I  YP D +++RM +Q   K         + K  + C K I   EG+   FKG  ++V +      L  ++Y+++
Sbjct:   14 IDLA-SGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKDFWKFF---AGNLASGGAAGATSLCFVYPLDFARTRLAADIGKANDREFKGLADCLIKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMV----FASDGQKLNFFAAWGIAQVVTVGSG--------ILSYPWDTVRRRMMMQSGRKD-------ILYKNTLDCAKKIIQNEGMSAMFKGALSNVFRG-TGGALVLAIYDEI 296          
BLAST of slc25a-16 vs. Ensembl Celegans
Match: ant-1.1 (Adenine Nucleotide Translocator [Source:UniProtKB/TrEMBL;Acc:G3MU69])

HSP 1 Score: 100.138 bits (248), Expect = 1.377e-23
Identity = 80/307 (26.06%), Postives = 140/307 (45.60%), Query Frame = 2
Query:  176 IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAA---QGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            ID A +G +   VS+  V P++ VK+  Q+Q        D +YKGI   +  + KE+G+ A W+G+L++ I+      + F+  +  K  F   + +     K     +     G  AG+T+  F  P D  RTR AA   +   + +  L++ +I I+K++G  GL+RG   S+  +       F  ++ +  V    F + G++ N F    I  + +  SG        I  YP D +++RM +Q   K         + K  + C K I   EG+   FKG  ++V +      L  ++Y+++
Sbjct:   14 IDLA-SGGTAAAVSKTAVAPIERVKLLLQVQDASKAIAVDKRYKGIMDVLIRVPKEQGVAALWRGNLANVIRYFPTQAMNFAFKDTYKAIFLEGLDKKKDFWKFF---AGNLASGGAAGATSLCFVYPLDFARTRLAADIGKANDREFKGLADCLIKIVKSDGPIGLYRGFFVSVQGIIIYRAAYFGMFDTAKMV----FASDGQKLNFFAAWGIAQVVTVGSG--------ILSYPWDTVRRRMMMQSGRKD-------ILYKNTLDCAKKIIQNEGMSAMFKGALSNVFRG-TGGALVLAIYDEI 296          
BLAST of slc25a-16 vs. Ensembl Fly
Match: Tpc1 (gene:FBgn0037852 transcript:FBtr0082334)

HSP 1 Score: 197.978 bits (502), Expect = 1.013e-59
Identity = 117/322 (36.34%), Postives = 175/322 (54.35%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI--QTITDG------KYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQD----NLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            +S   Q+   +AG     ++R+  QPLDV+KIRFQLQVEP+      +G      KY  I QA+K IY+EEG+ AFWKGH  +Q+ ++ + + QF TYE        L+++  S        S  FL G+ AG  A I + P DV RTR  AQ   K Y N + A+  I++ EG RG++RGL  +LL + P  G  F  Y L ++    F +   +       L G+           G  +G ++K  VYP D+IKKR+Q+QGFE  R  FG+     GV  C+++    EG+ G +KG+  +++KS ++  L FS+Y+++
Sbjct:   23 HSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLS-----LMAKQTSYLADHQHLSN-FLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGL-----------GASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKL 327          
BLAST of slc25a-16 vs. Ensembl Fly
Match: Tpc1 (gene:FBgn0037852 transcript:FBtr0082333)

HSP 1 Score: 197.978 bits (502), Expect = 1.013e-59
Identity = 117/322 (36.34%), Postives = 175/322 (54.35%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI--QTITDG------KYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQD----NLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            +S   Q+   +AG     ++R+  QPLDV+KIRFQLQVEP+      +G      KY  I QA+K IY+EEG+ AFWKGH  +Q+ ++ + + QF TYE        L+++  S        S  FL G+ AG  A I + P DV RTR  AQ   K Y N + A+  I++ EG RG++RGL  +LL + P  G  F  Y L ++    F +   +       L G+           G  +G ++K  VYP D+IKKR+Q+QGFE  R  FG+     GV  C+++    EG+ G +KG+  +++KS ++  L FS+Y+++
Sbjct:   23 HSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLS-----LMAKQTSYLADHQHLSN-FLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGL-----------GASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKL 327          
BLAST of slc25a-16 vs. Ensembl Fly
Match: Tpc2 (gene:FBgn0035078 transcript:FBtr0304800)

HSP 1 Score: 176.792 bits (447), Expect = 8.669e-52
Identity = 102/297 (34.34%), Postives = 162/297 (54.55%), Query Frame = 2
Query:  215 SRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVY-----FWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEP---KTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +R + QPLDV+KIRFQ+QVEP+      KY+G+  A K +Y EEG++  ++GH S Q+ ++S++LVQF +YE  +       +W    E P            F+ G +AG    +  QPFDV RT+  A  +P   ++  N    +  + K EG  GL RGL  +L+ V P  G  F FY   N  +        +Q+    IH   +    L+G ++G +AK+ VYP D++KKR+Q+  F++ R  FG+      ++ CI   F  EGIGG++KG+  +++K+ +   + FS+Y+
Sbjct:   23 TRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYW---RERPFL--------MFFICGGIAGCLGAVAAQPFDVVRTQMVA-ADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQE----IHGAFLF---LNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300          

HSP 2 Score: 59.3066 bits (142), Expect = 1.660e-9
Identity = 53/195 (27.18%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  536 TATIFTQPFDVFRTRFAAQGEPKT------YPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGIL 1102
            T TI TQP DV + RF  Q EP T      Y  + +A   +   EG+RG+FRG     +L       QF+ Y    ++  +F   + +   +F I           GGIAG +  +   P D+++ +M        RS+   ++   G+ K  K+    EG  G  +GL  ++++ F  +G  F  Y+ +   +L
Sbjct:   23 TRTI-TQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFI----------CGGIAGCLGAVAAQPFDVVRTQMVAADPSSRRSQ---MNTFTGLRKVYKM----EGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVL 199          

HSP 3 Score: 49.2914 bits (116), Expect = 2.981e-6
Identity = 46/215 (21.40%), Postives = 81/215 (37.67%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTR---FAAQGEPKTY------PNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIH 805
            I G   G +     QP DVV+ +        +      + G+    + +YK EG     +G   + +Q        F  Y+        ++   P   +  +  +  FL G+L+G  A +   P D+ + R    A + E KT+      P +   I    + EG+ G ++G++P+LL     +   F  Y++         K   K     G H
Sbjct:  116 ICGGIAGCLGAVAAQPFDVVRTQMVAADPSSRRSQMNTFTGL----RKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNA---AVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHYIAPMKEAEKNRQKLGKH 323          
BLAST of slc25a-16 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0344281)

HSP 1 Score: 117.087 bits (292), Expect = 1.301e-29
Identity = 90/313 (28.75%), Postives = 149/313 (47.60%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVE-PIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYEQV---CNGILNLR 1111
            I+GA+ G +++ V+ PLD  KI FQ++ + P        ++   + ++  Y  EG+ A W+G+ ++  + V ++ +QF+ +E      W  I      G +     + FL GSLAG T+   T P D+ R R A       Y  L      I   EG R LFRG   ++L V P  G  FF Y             K +   + G +K   L S   G  AG+  +   YP+DI+++RMQ     +  +  G  + +  +++ +  I+  EG+  G++KGL  + IK  I++G+ FS Y+ +      + NLR
Sbjct:    2 ISGAAAGALAKTVIAPLDRTKINFQIRNDVPFS------FRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQ-----WRRILHVDKDGTNT--KGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYE----------TLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTM---RVNTAGGDRYPT--ILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLR 286          
BLAST of slc25a-16 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0089481)

HSP 1 Score: 117.087 bits (292), Expect = 1.301e-29
Identity = 90/313 (28.75%), Postives = 149/313 (47.60%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVE-PIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYEQV---CNGILNLR 1111
            I+GA+ G +++ V+ PLD  KI FQ++ + P        ++   + ++  Y  EG+ A W+G+ ++  + V ++ +QF+ +E      W  I      G +     + FL GSLAG T+   T P D+ R R A       Y  L      I   EG R LFRG   ++L V P  G  FF Y             K +   + G +K   L S   G  AG+  +   YP+DI+++RMQ     +  +  G  + +  +++ +  I+  EG+  G++KGL  + IK  I++G+ FS Y+ +      + NLR
Sbjct:    2 ISGAAAGALAKTVIAPLDRTKINFQIRNDVPFS------FRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQ-----WRRILHVDKDGTNT--KGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYE----------TLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTM---RVNTAGGDRYPT--ILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLR 286          
BLAST of slc25a-16 vs. Ensembl Zebrafish
Match: slc25a19 (solute carrier family 25 member 19 [Source:ZFIN;Acc:ZDB-GENE-050417-292])

HSP 1 Score: 245.358 bits (625), Expect = 3.554e-78
Identity = 135/314 (42.99%), Postives = 195/314 (62.10%), Query Frame = 2
Query:  179 DYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTIT-DGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDK 1117
            + A+AG++ G V+RA++ PLDVVKIRFQLQ+E +   +  GKY G+ QA +CI  EEGL AFWKGH+ +Q+ +V +  VQF+++E+       +  ++P   ++   +   F+ G LA  +AT+  QP D  RTRFAAQGEPK Y NL +AI  ++++EG    +RGL P+L+ V P  G QFFFYN+   +L +   TK K     G+H      S +SG  AG ++K   YP D+IKKR+QV GFE+AR KFG++    G V C+  I   EG  G+FKGL  S++K+ +S G  F  YE   + I+ L+ +
Sbjct:   17 EAALAGSAAGIVTRALISPLDVVKIRFQLQIEKVSWRSRQGKYWGLWQATRCILTEEGLPAFWKGHIPAQLLSVCYGAVQFASFEVLTEL---VHKKTPYNSQT---AGVHFICGGLAACSATVACQPLDTLRTRFAAQGEPKIYRNLRHAIGTMLRSEGPFTFYRGLTPTLVAVFPYAGLQFFFYNILKKLL-ELQDTKSKA----GLH------SLISGSCAGVISKTLTYPFDLIKKRLQVGGFEEARLKFGEVRTYHGFVDCVLRIGREEGPRGFFKGLSPSLLKAALSTGFTFFWYEFFISAIVTLKSR 313          
BLAST of slc25a-16 vs. Ensembl Zebrafish
Match: slc25a42 (solute carrier family 25 member 42 [Source:NCBI gene;Acc:751743])

HSP 1 Score: 119.783 bits (299), Expect = 2.816e-30
Identity = 90/315 (28.57%), Postives = 152/315 (48.25%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYK---EEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-----LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPK-TYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
             S ++  ++GA  G V++  V PLD  KI FQ        ++  ++    +A + IY+   ++G  + W+G+ ++ ++ + ++ +QF  +E     L K Y +         GK+ L      L GSLAG+TA I T P D+ R R A    PK  Y N+ +  + I + EGL+ L+RG  P++L V P  G  FF Y      L K    K  + + F   ++      + G  AG + +   YP+D++++RMQ  G           H    V+  ++ I   EGI  G +KGL  + +K  I++G+ F  ++
Sbjct:   38 RSVLNSLVSGAFAGAVAKTAVAPLDRTKIIFQ--------VSSNRFSA-KEAYRLIYRTYLKDGFFSLWRGNSATMVRVIPYAAIQFCAHEQYKGILGKYYGF--------QGKA-LPPVPRLLAGSLAGTTAAIITYPLDMVRARMAV--TPKEMYSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTY----ETLKKTHAEKTGRAHPFPYERL------VFGACAGLIGQSASYPLDVVRRRMQTAGVTG--------HTYSTVLGTMREIVAEEGIVRGLYKGLSMNWVKGPIAVGISFMTFD 314          

HSP 2 Score: 63.1586 bits (152), Expect = 1.322e-10
Identity = 52/194 (26.80%), Postives = 88/194 (45.36%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG-EPKTYPNLSNAIIMIIKTEGL-RGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKF 763
            +AG+  G  +  +  PLD+V+ R  + V P +      Y  I      I +EEGLK  ++G   + +  V ++ + F TYE  K       + +  TG++     +  + G+ AG      + P DV R R    G    TY  +   +  I+  EG+ RGL++GL  + +      G  F  ++L+  +L KF
Sbjct:  143 LAGSLAGTTAAIITYPLDMVRAR--MAVTPKEM-----YSNIMDVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETLKK------THAEKTGRAHPFPYERLVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHTYSTVLGTMREIVAEEGIVRGLYKGLSMNWVKGPIAVGISFMTFDLTQILLRKF 323          
BLAST of slc25a-16 vs. Ensembl Zebrafish
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 114.005 bits (284), Expect = 3.866e-28
Identity = 94/307 (30.62%), Postives = 148/307 (48.21%), Query Frame = 2
Query:  191 AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ--GEPKTYPNLSNAIIMIIKTEG-LRGLFRGLIPSLLLVAPQTGFQFF-FYNLSNNVLTKFFKTKGKQ--DNLFGIHKIGILQSA---LSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            AG   G  +++ + PLD VKI  Q Q  P       K+ G+   IK + K+EG    +KG+ +  I+   +  +QF  ++  K +    +  S    +         + GS+AG TA I T P DV R R A Q  G  + Y  + +A   I   EG + G +RGLIP+++ +AP  GF FF F  L    LT F +  GK   DN      + +L++    L GG+AG++A+   YP+D+ ++RMQ+        K   L       K +K ++   G+  G ++GL  + I+   S  + F+ YE
Sbjct:   31 AGGVAGCCAKSTIAPLDRVKILLQAQ-NP-----HYKHLGVFATIKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHR--------LMAGSMAGMTAVICTYPLDVIRARLAFQVTGHHR-YSGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKTLGLTHFPEQLGKPSLDNP----DVLVLKTQVNLLCGGVAGAIAQTISYPLDVARRRMQLGASLPDHDKCCSL------TKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTYE 312          

HSP 2 Score: 64.3142 bits (155), Expect = 5.051e-11
Identity = 55/200 (27.50%), Postives = 85/200 (42.50%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIY-KEEGLKAFWKGHLSSQI---QAVSFSLVQFSTYELCKVYFWPLISESPSTGKS---VLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---AAQGEPKTYPNLSNAIIMIIKTEGLR-GLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            +AG+  G  +     PLDV++ R   QV         +Y GI  A + IY KE G+  F++G + + I       FS   F T +   +  +P     PS       VLK+    L G +AG+ A   + P DV R R    A+  +     +L+  +  +    G++ GL+RGL  + +   P     F  Y     VL
Sbjct:  124 MAGSMAGMTAVICTYPLDVIRARLAFQVT-----GHHRYSGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKTLGLTHFPEQLGKPSLDNPDVLVLKTQVNLLCGGVAGAIAQTISYPLDVARRRMQLGASLPDHDKCCSLTKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTYEFMKQVL 318          

HSP 3 Score: 59.3066 bits (142), Expect = 2.260e-9
Identity = 50/182 (27.47%), Postives = 81/182 (44.51%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRM--QVQGFEKARSKFGKLHVSKGVVKCIKVIFLVE-GIGGYFKGLKTSVI 1039
            ++F  G +AG  A     P D  +    AQ     +  +   I  + K EG  GL++G    ++ + P    QF    ++ +   KF  TK       GI   G +   ++G +AG  A IC YP+D+I+ R+  QV G           H   G+    + I+  E GI G+++GL  ++I
Sbjct:   27 RSFTAGGVAGCCAKSTIAPLDRVKILLQAQNPHYKHLGVFATIKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQF----MAFDNYKKFLHTK------VGIS--GHVHRLMAGSMAGMTAVICTYPLDVIRARLAFQVTGH----------HRYSGIRHAFQTIYHKEGGISGFYRGLIPTII 186          
BLAST of slc25a-16 vs. Ensembl Zebrafish
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 112.849 bits (281), Expect = 9.343e-28
Identity = 93/307 (30.29%), Postives = 148/307 (48.21%), Query Frame = 2
Query:  191 AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ--GEPKTYPNLSNAIIMIIKTEG-LRGLFRGLIPSLLLVAPQTGFQFF-FYNLSNNVLTKFFKTKGKQ--DNLFGIHKIGILQSA---LSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            AG   G  +++ + PLD VKI  Q Q  P       K+ G+   +K + K+EG    +KG+ +  I+   +  +QF  ++  K +    +  S    +         + GS+AG TA I T P DV R R A Q  G  + Y  + +A   I   EG + G +RGLIP+++ +AP  GF FF F  L    LT F +  GK   DN      + +L++    L GG+AG++A+   YP+D+ ++RMQ+        K   L       K +K ++   G+  G ++GL  + I+   S  + F+ YE
Sbjct:   31 AGGVAGCCAKSTIAPLDRVKILLQAQ-NP-----HYKHLGVFATLKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQFMAFDNYKKFLHTKVGISGHVHR--------LMAGSMAGMTAVICTYPLDVIRARLAFQVTGHHR-YTGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKTLGLTHFPEQLGKPSLDNP----DVLVLKTQVNLLCGGVAGAIAQTISYPLDVARRRMQLGASLPDHDKCCSL------TKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTYE 312          

HSP 2 Score: 64.3142 bits (155), Expect = 5.899e-11
Identity = 55/200 (27.50%), Postives = 85/200 (42.50%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIY-KEEGLKAFWKGHLSSQI---QAVSFSLVQFSTYELCKVYFWPLISESPSTGKS---VLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---AAQGEPKTYPNLSNAIIMIIKTEGLR-GLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            +AG+  G  +     PLDV++ R   QV         +Y GI  A + IY KE G+  F++G + + I       FS   F T +   +  +P     PS       VLK+    L G +AG+ A   + P DV R R    A+  +     +L+  +  +    G++ GL+RGL  + +   P     F  Y     VL
Sbjct:  124 MAGSMAGMTAVICTYPLDVIRARLAFQVT-----GHHRYTGIRHAFQTIYHKEGGISGFYRGLIPTIIGMAPYAGFSFFTFGTLKTLGLTHFPEQLGKPSLDNPDVLVLKTQVNLLCGGVAGAIAQTISYPLDVARRRMQLGASLPDHDKCCSLTKTLKHVYSQYGVKKGLYRGLSLNYIRCVPSQAVAFTTYEFMKQVL 318          

HSP 3 Score: 58.151 bits (139), Expect = 5.690e-9
Identity = 49/182 (26.92%), Postives = 81/182 (44.51%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRM--QVQGFEKARSKFGKLHVSKGVVKCIKVIFLVE-GIGGYFKGLKTSVI 1039
            ++F  G +AG  A     P D  +    AQ     +  +   +  + K EG  GL++G    ++ + P    QF    ++ +   KF  TK       GI   G +   ++G +AG  A IC YP+D+I+ R+  QV G           H   G+    + I+  E GI G+++GL  ++I
Sbjct:   27 RSFTAGGVAGCCAKSTIAPLDRVKILLQAQNPHYKHLGVFATLKAVPKKEGFLGLYKGNGAMMIRIFPYGAIQF----MAFDNYKKFLHTK------VGIS--GHVHRLMAGSMAGMTAVICTYPLDVIRARLAFQVTGH----------HRYTGIRHAFQTIYHKEGGISGFYRGLIPTII 186          
BLAST of slc25a-16 vs. Ensembl Zebrafish
Match: slc25a32b (solute carrier family 25 member 32b [Source:ZFIN;Acc:ZDB-GENE-050306-39])

HSP 1 Score: 104.76 bits (260), Expect = 6.633e-25
Identity = 83/321 (25.86%), Postives = 145/321 (45.17%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQ----LQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTR----FAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILN 1105
            H +++  IAG SGG +S   + PLD+VKIRF     L V P       KY GI   +K I+ +EG +  ++G   +   A +   + F  Y   K Y       +  T +  L +++  L  ++AG+     T P  V +TR    ++A    K Y  + +A++ I + EG+ GL+RG +P L   +     QF  Y     +   + K + KQ +     K+  L+      ++   A    YP  +++ R+Q Q            +   G+   +   +  EG+ G++KG+  ++I+   +  + F VYE V   +L+
Sbjct:   23 HVRVENLIAGLSGGVLSTLALHPLDLVKIRFAVSDGLDVRP-------KYSGIVHCMKSIWHQEGFRGLYQGVTPNIWGAGASWGLYFFFYNAIKGY-------NKETRQIELTATEHLLSAAVAGAMTLCLTNPIWVTKTRLVLQYSADPSQKQYKGMMDALVKIYRHEGISGLYRGFVPGLFGTS-HGALQFMAY---EELKRDYNKYRKKQSDA----KLNPLEYITMAALSKIFAVATTYPYQVVRARLQDQH-----------NTYNGLTDVVWRTWRNEGLLGFYKGMVPNLIRVTPACCITFVVYENVSRVLLD 310          
BLAST of slc25a-16 vs. Ensembl Xenopus
Match: slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:NCBI gene;Acc:548707])

HSP 1 Score: 248.054 bits (632), Expect = 6.363e-79
Identity = 137/314 (43.63%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTI-TDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLT-KFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILN 1105
            S  + A+AG+  G V+RA++ PLDV+KIRFQLQ+E + +  T GKY GI QA+  I +EEGL  FWKGH+ +Q+ +VS+  VQF ++E+    F    S  P +       +  FL G LA  +AT+  QP D  RTRFAAQGEPK Y NL NAI  + +TEG    +RGL P+LL V P  G QF  YNL          K + ++D+         L++ L G  AG ++K   YP D+ KKR+QV GFE+AR+ FGK+    G+V C   I+  EG  G+FKGL  S++K+  S GL F  YE  C+ +L+
Sbjct:   19 SSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQGKYHGILQAVGLILREEGLPGFWKGHVPAQLLSVSYGAVQFVSFEMLTELFHVSTSLDPRS------PAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEPKVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRTWNLVLLKDQTQKDS---------LRNLLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYELFCSLMLS 317          

HSP 2 Score: 97.8265 bits (242), Expect = 3.159e-22
Identity = 71/213 (33.33%), Postives = 102/213 (47.89%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNL 739
            +E+F  V+ S    S   + + G      +   VQPLD ++ RF  Q EP        Y+ +  AI  +++ EG  AF++G   + +    ++ +QFS+Y L K   W L+     T K  L++    L GS AG  +   T PFD+F+ R          A  G+ +TY  L +    I K EG RG F+GL PSLL  A  TG  FF Y L
Sbjct:  109 TELFH-VSTSLDPRSPAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEP------KVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRT-WNLVLLKDQTQKDSLRN---LLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYEL 310          

HSP 3 Score: 83.1889 bits (204), Expect = 4.561e-17
Identity = 62/222 (27.93%), Postives = 100/222 (45.05%), Query Frame = 2
Query:  440 VYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF-------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQD-NLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +YF  ++   PST   +L SS+  + GSL+G        P DV + RF       ++ G    Y  +  A+ +I++ EGL G ++G +P+ LL       QF    +S  +LT+ F      D     +H        L GG+A   A + V P+D ++ R   QG  K         V + +   I  +F  EG   +++GL  +++  F   GL+FS Y 
Sbjct:    1 MYFRRMVGYDPSTDGRLLSSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQGKYHGILQAVGLILREEGLPGFWKGHVPAQLLSVSYGAVQF----VSFEMLTELFHVSTSLDPRSPAVH-------FLCGGLAACSATLAVQPLDTLRTRFAAQGEPK---------VYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYN 202          
BLAST of slc25a-16 vs. Ensembl Xenopus
Match: slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:NCBI gene;Acc:548707])

HSP 1 Score: 248.054 bits (632), Expect = 6.628e-79
Identity = 137/314 (43.63%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTI-TDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLT-KFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILN 1105
            S  + A+AG+  G V+RA++ PLDV+KIRFQLQ+E + +  T GKY GI QA+  I +EEGL  FWKGH+ +Q+ +VS+  VQF ++E+    F    S  P +       +  FL G LA  +AT+  QP D  RTRFAAQGEPK Y NL NAI  + +TEG    +RGL P+LL V P  G QF  YNL          K + ++D+         L++ L G  AG ++K   YP D+ KKR+QV GFE+AR+ FGK+    G+V C   I+  EG  G+FKGL  S++K+  S GL F  YE  C+ +L+
Sbjct:   14 SSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQGKYHGILQAVGLILREEGLPGFWKGHVPAQLLSVSYGAVQFVSFEMLTELFHVSTSLDPRS------PAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEPKVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRTWNLVLLKDQTQKDS---------LRNLLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYELFCSLMLS 312          

HSP 2 Score: 97.8265 bits (242), Expect = 3.400e-22
Identity = 71/213 (33.33%), Postives = 102/213 (47.89%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNL 739
            +E+F  V+ S    S   + + G      +   VQPLD ++ RF  Q EP        Y+ +  AI  +++ EG  AF++G   + +    ++ +QFS+Y L K   W L+     T K  L++    L GS AG  +   T PFD+F+ R          A  G+ +TY  L +    I K EG RG F+GL PSLL  A  TG  FF Y L
Sbjct:  104 TELFH-VSTSLDPRSPAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEP------KVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRT-WNLVLLKDQTQKDSLRN---LLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYEL 305          

HSP 3 Score: 79.7221 bits (195), Expect = 5.808e-16
Identity = 60/217 (27.65%), Postives = 97/217 (44.70%), Query Frame = 2
Query:  455 LISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF-------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQD-NLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            ++   PST   +L SS+  + GSL+G        P DV + RF       ++ G    Y  +  A+ +I++ EGL G ++G +P+ LL       QF    +S  +LT+ F      D     +H        L GG+A   A + V P+D ++ R   QG  K         V + +   I  +F  EG   +++GL  +++  F   GL+FS Y 
Sbjct:    1 MVGYDPSTDGRLLSSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQGKYHGILQAVGLILREEGLPGFWKGHVPAQLLSVSYGAVQF----VSFEMLTELFHVSTSLDPRSPAVH-------FLCGGLAACSATLAVQPLDTLRTRFAAQGEPK---------VYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYN 197          
BLAST of slc25a-16 vs. Ensembl Xenopus
Match: slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:NCBI gene;Acc:548707])

HSP 1 Score: 248.44 bits (633), Expect = 9.834e-79
Identity = 137/314 (43.63%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTI-TDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLT-KFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILN 1105
            S  + A+AG+  G V+RA++ PLDV+KIRFQLQ+E + +  T GKY GI QA+  I +EEGL  FWKGH+ +Q+ +VS+  VQF ++E+    F    S  P +       +  FL G LA  +AT+  QP D  RTRFAAQGEPK Y NL NAI  + +TEG    +RGL P+LL V P  G QF  YNL          K + ++D+         L++ L G  AG ++K   YP D+ KKR+QV GFE+AR+ FGK+    G+V C   I+  EG  G+FKGL  S++K+  S GL F  YE  C+ +L+
Sbjct:   43 SSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQGKYHGILQAVGLILREEGLPGFWKGHVPAQLLSVSYGAVQFVSFEMLTELFHVSTSLDPRS------PAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEPKVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRTWNLVLLKDQTQKDS---------LRNLLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYELFCSLMLS 341          

HSP 2 Score: 97.8265 bits (242), Expect = 5.563e-22
Identity = 71/213 (33.33%), Postives = 102/213 (47.89%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNL 739
            +E+F  V+ S    S   + + G      +   VQPLD ++ RF  Q EP        Y+ +  AI  +++ EG  AF++G   + +    ++ +QFS+Y L K   W L+     T K  L++    L GS AG  +   T PFD+F+ R          A  G+ +TY  L +    I K EG RG F+GL PSLL  A  TG  FF Y L
Sbjct:  133 TELFH-VSTSLDPRSPAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEP------KVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYNLLKRT-WNLVLLKDQTQKDSLRN---LLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSYEL 334          

HSP 3 Score: 83.1889 bits (204), Expect = 5.266e-17
Identity = 63/225 (28.00%), Postives = 100/225 (44.44%), Query Frame = 2
Query:  431 LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF-------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQD-NLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            L   YF  ++   PST   +L SS+  + GSL+G        P DV + RF       ++ G    Y  +  A+ +I++ EGL G ++G +P+ LL       QF    +S  +LT+ F      D     +H        L GG+A   A + V P+D ++ R   QG  K         V + +   I  +F  EG   +++GL  +++  F   GL+FS Y 
Sbjct:   22 LVARYFRRMVGYDPSTDGRLLSSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQIESLSSHGTQGKYHGILQAVGLILREEGLPGFWKGHVPAQLLSVSYGAVQF----VSFEMLTELFHVSTSLDPRSPAVH-------FLCGGLAACSATLAVQPLDTLRTRFAAQGEPK---------VYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFSSYN 226          
BLAST of slc25a-16 vs. Ensembl Xenopus
Match: cep152 (centrosomal protein 152kDa [Source:Xenbase;Acc:XB-GENE-988609])

HSP 1 Score: 120.168 bits (300), Expect = 3.708e-30
Identity = 85/312 (27.24%), Postives = 148/312 (47.44%), Query Frame = 2
Query:  161 SQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYK---EEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPK-TYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEG-IGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +  S ++  ++GA  G V++  V PLD  KI FQ        ++  ++    +A + IY+    EG  + W+G+ ++ ++ + ++ +QF  +E  K     L+        S L      L G+LAG+TATI T P D+ R R A    PK  Y N+ +  + + + EGL+ L+RG  P++L V P  G  FF Y      L K       +   +   ++      L G  AG   +   YP+D++++RMQ  G           H    ++  ++ I   EG I G +KGL  + +K  +++G+ F+ ++
Sbjct:   37 NHKSILNSLMSGALAGAVAKTAVAPLDRTKIIFQ--------VSSNRFSA-KEAYRLIYRTYLNEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYK----KLLGSYYGFQGSALTPIPRLLAGALAGTTATIITYPLDLVRARMAVT--PKEMYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTY----ETLKKLHAEHSGRTQPYPFERL------LFGACAGLFGQSASYPLDVVRRRMQTAGVTG--------HAYGSIIGTMQEIVAEEGVIRGLYKGLSMNWVKGPVAVGISFTTFD 315          

HSP 2 Score: 58.9214 bits (141), Expect = 4.281e-9
Identity = 50/200 (25.00%), Postives = 89/200 (44.50%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG-EPKTYPNLSNAIIMIIKTEG-LRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKF 763
            + I   +AGA  G  +  +  PLD+V+ R  + V P +      Y  I      + +EEGLK+ ++G   + +  + ++ + F TYE  K         +  +G++     +  L G+ AG      + P DV R R    G     Y ++   +  I+  EG +RGL++GL  + +      G  F  ++L+  +L K 
Sbjct:  138 TPIPRLLAGALAGTTATIITYPLDLVRAR--MAVTPKEM-----YSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETLKKL------HAEHSGRTQPYPFERLLFGACAGLFGQSASYPLDVVRRRMQTAGVTGHAYGSIIGTMQEIVAEEGVIRGLYKGLSMNWVKGPVAVGISFTTFDLTQILLKKL 324          

HSP 3 Score: 58.5362 bits (140), Expect = 6.088e-9
Identity = 54/215 (25.12%), Postives = 94/215 (43.72%), Query Frame = 2
Query:  452 PLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKT---EGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            P++SE     KS+L S    + G+LAG+ A     P D  RT+   Q     + +   A  +I +T   EG   L+RG   +++ V P    QF  +     +L  ++  +G    L  I ++      L+G +AG+ A I  YP+D+++ RM V   E          +   ++     +   EG+   ++G   +V+      G+ F  YE +
Sbjct:   29 PVVSEGHKNHKSILNS---LMSGALAGAVAKTAVAPLD--RTKIIFQVSSNRF-SAKEAYRLIYRTYLNEGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGSYYGFQG--SALTPIPRL------LAGALAGTTATIITYPLDLVRARMAVTPKE----------MYSNIIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGISFFTYETL 219          
BLAST of slc25a-16 vs. Ensembl Xenopus
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:100216243])

HSP 1 Score: 108.612 bits (270), Expect = 4.430e-26
Identity = 91/312 (29.17%), Postives = 148/312 (47.44%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSK---TFLLGSLAGSTATIFTQPFDVFRTRFAAQ--GEPKTYPNLSNAIIMI-IKTEGLRGLFRGLIPSLLLVAPQTGFQFF-FYNLSNNVLTKFFKTKGK--QDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGF----EKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +AG      ++  + PLD +KI  Q Q          ++ GI      + K+EG    +KG+ +  ++   +  +QF  ++  K              K  +K S+     + GS+AG TA IFT P D+ R R A Q  GE + Y  + +A   I +K  G+RG +RGL+P+++ +AP  GF FF F  L    L    +  GK   DN   +  +    S L GGIAG++A+   YP+D+ ++RMQ+       +K R+ F          + +K + +  GI  G ++GL  + I+   S  + F+ YE
Sbjct:   29 VAGGVASCCAKTTIAPLDRIKILLQAQN------VHYRHLGILATAFAVQKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDKYKKVL----------KKRFIKHSEHVPRLMAGSMAGITAVIFTYPLDMVRARLAFQVKGEHR-YNGIIHAFKTIYLKEGGIRGYYRGLVPTIVGMAPYAGFSFFTFETLKTAGLRHAPELLGKPSSDNP-DVMVLKTHASLLCGGIAGAIAQSISYPLDVTRRRMQLSAILPDSDKCRTMF----------QTLKYVCMQHGIRRGLYRGLSLNYIRCIPSQAVAFTTYE 312          

HSP 2 Score: 68.9366 bits (167), Expect = 2.215e-12
Identity = 56/212 (26.42%), Postives = 95/212 (44.81%), Query Frame = 2
Query:  152 LSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIY-KEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCK---VYFWPLISESPSTGKS---VLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---AAQGEPKTYPNLSNAIIMIIKTEGLR-GLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            + +S+H  +   +AG+  G  +     PLD+V+ R   QV+      + +Y GI  A K IY KE G++ +++G + + +    ++   F T+E  K   +   P +   PS+      VLK+  + L G +AG+ A   + P DV R R    A   +      +   +  +    G+R GL+RGL  + +   P     F  Y     VL
Sbjct:  114 IKHSEH--VPRLMAGSMAGITAVIFTYPLDMVRARLAFQVK-----GEHRYNGIIHAFKTIYLKEGGIRGYYRGLVPTIVGMAPYAGFSFFTFETLKTAGLRHAPELLGKPSSDNPDVMVLKTHASLLCGGIAGAIAQSISYPLDVTRRRMQLSAILPDSDKCRTMFQTLKYVCMQHGIRRGLYRGLSLNYIRCIPSQAVAFTTYEFMRQVL 318          

HSP 3 Score: 59.6918 bits (143), Expect = 2.686e-9
Identity = 48/198 (24.24%), Postives = 84/198 (42.42%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRM--QVQGFEKARSKFGKLHVSKGVVKCIKVIFLVE-GIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            ++F+ G +A   A     P D  +    AQ     +  +      + K EG  GL++G    ++ + P    QF  ++    VL K F    +            +   ++G +AG  A I  YP+D+++ R+  QV+G           H   G++   K I+L E GI GY++GL  +++      G  F  +E +
Sbjct:   26 RSFVAGGVASCCAKTTIAPLDRIKILLQAQNVHYRHLGILATAFAVQKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDKYKKVLKKRFIKHSEH-----------VPRLMAGSMAGITAVIFTYPLDMVRARLAFQVKG----------EHRYNGIIHAFKTIYLKEGGIRGYYRGLVPTIVGMAPYAGFSFFTFETL 202          
BLAST of slc25a-16 vs. Ensembl Mouse
Match: Slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:MGI Symbol;Acc:MGI:1914533])

HSP 1 Score: 223.016 bits (567), Expect = 1.892e-69
Identity = 125/311 (40.19%), Postives = 184/311 (59.16%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            +S+++ A+AG+  GFV+RA++ PLDV+KIRFQLQ+E +  +  + KY GI QA K I +EEG +AFWKGH+ +QI ++ +  VQF  +E L ++ +   + ++        + S  F+ G L+  TAT+   P DV RTR AAQGEPK Y NL  AI  + KTEG    ++GL P+++ + P  G QF  Y              GKQ         G L++ L G  +G ++K   YP+D+IKKR+QV GFE ARS FG++   +G++   + +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   13 NSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTH-------QFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQ--------TGNLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCN 308          

HSP 2 Score: 97.4413 bits (241), Expect = 3.036e-22
Identity = 66/218 (30.28%), Postives = 103/218 (47.25%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNV 751
            +E+    NL  +      +   G S G  +   V P+DV++ R   Q EP        Y  + +AI+ +YK EG   F+KG   + I    ++ +QFS Y  L + Y W +  +   TG     + K  L G  +G  +  FT P D+ + R          +A G+ ++Y  L +    +++ EG RG F+GL PSL+  A  TGF FF+Y L  N+
Sbjct:  104 TELLYQANLYQTHQFSAHFVCGGLSAG-TATLTVHPVDVLRTRLAAQGEP------KIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTG-----NLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCNL 309          
BLAST of slc25a-16 vs. Ensembl Mouse
Match: Slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:MGI Symbol;Acc:MGI:1914533])

HSP 1 Score: 223.016 bits (567), Expect = 1.892e-69
Identity = 125/311 (40.19%), Postives = 184/311 (59.16%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            +S+++ A+AG+  GFV+RA++ PLDV+KIRFQLQ+E +  +  + KY GI QA K I +EEG +AFWKGH+ +QI ++ +  VQF  +E L ++ +   + ++        + S  F+ G L+  TAT+   P DV RTR AAQGEPK Y NL  AI  + KTEG    ++GL P+++ + P  G QF  Y              GKQ         G L++ L G  +G ++K   YP+D+IKKR+QV GFE ARS FG++   +G++   + +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   13 NSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTH-------QFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQ--------TGNLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCN 308          

HSP 2 Score: 97.4413 bits (241), Expect = 3.036e-22
Identity = 66/218 (30.28%), Postives = 103/218 (47.25%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNV 751
            +E+    NL  +      +   G S G  +   V P+DV++ R   Q EP        Y  + +AI+ +YK EG   F+KG   + I    ++ +QFS Y  L + Y W +  +   TG     + K  L G  +G  +  FT P D+ + R          +A G+ ++Y  L +    +++ EG RG F+GL PSL+  A  TGF FF+Y L  N+
Sbjct:  104 TELLYQANLYQTHQFSAHFVCGGLSAG-TATLTVHPVDVLRTRLAAQGEP------KIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTG-----NLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCNL 309          
BLAST of slc25a-16 vs. Ensembl Mouse
Match: Slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:MGI Symbol;Acc:MGI:1914533])

HSP 1 Score: 145.206 bits (365), Expect = 1.215e-40
Identity = 80/198 (40.40%), Postives = 110/198 (55.56%), Query Frame = 2
Query:  500 SKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            S  F+ G L+  TAT+   P DV RTR AAQGEPK Y NL  AI  + KTEG    ++GL P+++ + P  G QF  Y              GKQ         G L++ L G  +G ++K   YP+D+IKKR+QV GFE ARS FG++   +G++   + +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   36 SAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQ--------TGNLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCN 225          

HSP 2 Score: 97.0561 bits (240), Expect = 8.793e-23
Identity = 66/217 (30.41%), Postives = 102/217 (47.00%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNN 748
            +E+    NL  +      +   G S G  +   V P+DV++ R   Q EP        Y  + +AI+ +YK EG   F+KG   + I    ++ +QFS Y  L + Y W +  +   TG     + K  L G  +G  +  FT P D+ + R          +A G+ ++Y  L +    +++ EG RG F+GL PSL+  A  TGF FF+Y L  N
Sbjct:   21 TELLYQANLYQTHQFSAHFVCGGLSAG-TATLTVHPVDVLRTRLAAQGEP------KIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTG-----NLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCN 225          
BLAST of slc25a-16 vs. Ensembl Mouse
Match: Slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:MGI Symbol;Acc:MGI:1914533])

HSP 1 Score: 122.479 bits (306), Expect = 4.368e-32
Identity = 68/169 (40.24%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTY-ELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGL 667
            +S+++ A+AG+  GFV+RA++ PLDV+KIRFQLQ+E +  +  + KY GI QA K I +EEG +AFWKGH+ +QI ++ +  VQF  + EL ++ +   + ++        + S  F+ G L+  TAT+   P DV RTR AAQGEPK    L    + +++    R L
Sbjct:   13 NSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQT-------HQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKG--TLKTCFVAVVRELSARPL 172          

HSP 2 Score: 52.7582 bits (125), Expect = 1.692e-7
Identity = 37/142 (26.06%), Postives = 62/142 (43.66%), Query Frame = 2
Query:  518 GSLAGSTATIFTQPFDVFRTRFAAQ------GEPKT-YPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEK 922
            GS++G        P DV + RF  Q       +P   Y  +  A   I++ EG R  ++G +P+ +L       QF  +     +L         Q NL+  H+       + GG++   A + V+PVD+++ R+  QG  K
Sbjct:   22 GSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLY--------QANLYQTHQFSA--HFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPK 153          
BLAST of slc25a-16 vs. Ensembl Mouse
Match: Slc25a32 (solute carrier family 25, member 32 [Source:MGI Symbol;Acc:MGI:1917156])

HSP 1 Score: 107.842 bits (268), Expect = 5.480e-26
Identity = 90/331 (27.19%), Postives = 151/331 (45.62%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQ----LQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSV-LKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ----GEP--KTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTK-GKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVS-KGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDK 1117
            +H + +  +AG SGG +S   + PLD+VKIRF     L+V P       KYKGI   +  I+K +GL+  ++G ++  +     S   +        +F+  I    + G++  L+  +  +  + AG+     T P  V +TR   Q      P  + Y  + +A++ I K EG+RGL++G +P L   +     QF  Y L         K K  K  N     ++   +      ++   A    YP  +++ R+Q Q            HVS  GV   I   +  EGIGG++KG+  ++I+   +  + F VYE V + + +LR+K
Sbjct:   19 RHVRYENLVAGVSGGVLSNLALHPLDLVKIRFAVSDGLEVRP-------KYKGILHCLATIWKVDGLRGLYQG-VTPNVWGAGLSWGLY-------FFFYNAIKSYKTEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYGGVASPSQRQYKGMFDALVKIYKYEGVRGLYKGFVPGLFGTS-HGALQFMAYEL--------LKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQ------------HVSYGGVTDVITKTWRKEGIGGFYKGIAPNLIRVTPACCITFVVYENVSHFLYDLREK 313          
BLAST of slc25a-16 vs. UniProt/SwissProt
Match: sp|Q29RM1|TPC_BOVIN (Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus OX=9913 GN=SLC25A19 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.127e-68
Identity = 122/319 (38.24%), Postives = 186/319 (58.31%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS 1123
            S ++ A+AG+  G V+R ++ PLDV+KIRFQLQ+E + ++  + KY GI QA + I +EEG  AFWKGH+ +Q+ ++ +  VQF ++E        L+  +  + +     S  FL G L+   AT+   P DV RTRFAAQGEP+ Y  L +A++ + +TEG    ++GL P+L+ + P  GFQF  Y+            +GK++        G  ++ L G  AG ++K   YP+D+ KKR+QV GFE+AR+ FG++   KG++ C   +   EG  G FKGL  S++K+ +S GL F  YE  CN   ++R   S
Sbjct:   14 SNVEVAVAGSVSGLVTRVLISPLDVIKIRFQLQIERLSRSDPNAKYHGILQAGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEALT----ELVHRA--SVRDARDFSVHFLCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGLNPTLIAIFPYAGFQFSIYSSLKRAYEWALPAEGKKN--------GNFKNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEQARASFGQVRSYKGLLDCAGQVLREEGAQGCFKGLSPSLLKAALSTGLVFFWYELFCNFFHHMRKADS 318          
BLAST of slc25a-16 vs. UniProt/SwissProt
Match: sp|Q9DAM5|TPC_MOUSE (Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus OX=10090 GN=Slc25a19 PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.324e-68
Identity = 125/311 (40.19%), Postives = 184/311 (59.16%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            +S+++ A+AG+  GFV+RA++ PLDV+KIRFQLQ+E +  +  + KY GI QA K I +EEG +AFWKGH+ +QI ++ +  VQF  +E L ++ +   + ++        + S  F+ G L+  TAT+   P DV RTR AAQGEPK Y NL  AI  + KTEG    ++GL P+++ + P  G QF  Y              GKQ         G L++ L G  +G ++K   YP+D+IKKR+QV GFE ARS FG++   +G++   + +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   13 NSKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTH-------QFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQ--------TGNLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCN 308          

HSP 2 Score: 97.4413 bits (241), Expect = 2.123e-21
Identity = 66/218 (30.28%), Postives = 103/218 (47.25%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNV 751
            +E+    NL  +      +   G S G  +   V P+DV++ R   Q EP        Y  + +AI+ +YK EG   F+KG   + I    ++ +QFS Y  L + Y W +  +   TG     + K  L G  +G  +  FT P D+ + R          +A G+ ++Y  L +    +++ EG RG F+GL PSL+  A  TGF FF+Y L  N+
Sbjct:  104 TELLYQANLYQTHQFSAHFVCGGLSAG-TATLTVHPVDVLRTRLAAQGEP------KIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTG-----NLKNLLCGCGSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELFCNL 309          
BLAST of slc25a-16 vs. UniProt/SwissProt
Match: sp|Q5IS35|TPC_MACFA (Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis OX=9541 GN=SLC25A19 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.498e-68
Identity = 123/313 (39.30%), Postives = 185/313 (59.11%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             ++++  A+AG+  G V+RA++ P DV+KIRFQLQ E + +   + KY GI QA + I +EEGL AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA  TAT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKLQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRRDPNAKYHGIFQASRQILQEEGLTAFWKGHIPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACTATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAMPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFWYEFFCN 308          

HSP 2 Score: 93.9745 bits (232), Expect = 4.001e-20
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGFVS---RAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG  +      V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF+Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACTATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAM----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFWYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. UniProt/SwissProt
Match: sp|Q5NVC1|TPC_PONAB (Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii OX=9601 GN=SLC25A19 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 7.521e-67
Identity = 121/313 (38.66%), Postives = 183/313 (58.47%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++  + KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPNAKYHGILQASRQILQEEGPTAFWKGHIPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLCHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFWYEFFCN 308          

HSP 2 Score: 94.3597 bits (233), Expect = 2.537e-20
Identity = 68/231 (29.44%), Postives = 109/231 (47.19%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF+Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLCHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFWYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. UniProt/SwissProt
Match: sp|Q9HC21|TPC_HUMAN (Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens OX=9606 GN=SLC25A19 PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.559e-66
Identity = 121/313 (38.66%), Postives = 182/313 (58.15%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGK--SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
             +++   A+AG+  G V+RA++ P DV+KIRFQLQ E + ++    KY GI QA + I +EEG  AFWKGH+ +QI ++ +  VQF ++E+        ++E    G      + S  F+ G LA   AT+   P DV RTRFAAQGEPK Y  L +A+  + ++EG +  ++GL P+L+ + P  G QF  Y+   ++       +GK++          LQ+ L G  AG ++K   YP+D+ KKR+QV GFE AR+ FG++   KG++ C K +   EG  G+FKGL  S++K+ +S G  F  YE  CN
Sbjct:   12 NNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEM--------LTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNE--------NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCN 308          

HSP 2 Score: 92.4337 bits (228), Expect = 1.340e-19
Identity = 68/231 (29.44%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF---------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQ 784
            EM   +    S +   ++++    GG    ++   V P+DV++ RF  Q EP        Y  +  A+  +Y+ EG + F+KG   + I    ++ +QFS Y  L  +Y W +    P+ GK   ++ +  L GS AG  +   T P D+F+ R          AA G+ + Y  L +    +++ EG  G F+GL PSLL  A  TGF FF Y    NV     +T  ++
Sbjct:  101 EMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEP------KVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAI----PAEGKKN-ENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR 320          
BLAST of slc25a-16 vs. TrEMBL
Match: A0A0H3YJC4 (Slc25a-16 OS=Schmidtea mediterranea OX=79327 GN=slc25a-16 PE=2 SV=1)

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 330/330 (100.00%), Postives = 330/330 (100.00%), Query Frame = 2
Query:  134 MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS 1123
            MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS
Sbjct:    1 MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS 330          
BLAST of slc25a-16 vs. TrEMBL
Match: A0A0H3YFE8 (Slc25a-14 OS=Schmidtea mediterranea OX=79327 GN=slc25a-14 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 5.209e-101
Identity = 165/309 (53.40%), Postives = 215/309 (69.58%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQ 1084
              ++S  + A AGA+ GFVSRA+VQPLDV+KIR QLQVEP++    GKY GI   I CIYKEEG KA WKGH+  QI A+SFS++QF TY  C +  +    +  ST    L S+  F  GSL+G  A   TQP D+ RTRF AQGEPK Y +L +A   I++ EG   L+RG IPS+LL+APQ+G QF FYN SN V+   F      +N   + KIG++QS  SGG+AG+++K+ V+P+DI+KKRMQVQGFE+AR KFGKLH S+G ++C  VI+  EG   + KGLK +++KSFIS+GL+FSVYEQ
Sbjct:    7 TQKNSARESAFAGAASGFVSRAMVQPLDVLKIRLQLQVEPLKK-KFGKYHGIFPTICCIYKEEGFKALWKGHMCGQIHAISFSMIQFYTYT-CLIEKYKFSLQRHSTFSEKLISN--FFCGSLSGILAISLTQPLDILRTRFVAQGEPKLYRSLYHAAASIVQKEGFLTLYRGSIPSILLIAPQSGLQFLFYNFSNAVIGSIFSLFRFYENKNEL-KIGVVQSIASGGMAGALSKVLVFPLDIVKKRMQVQGFEEARKKFGKLHRSQGFIRCFGVIYREEGWTAFTKGLKPTLLKSFISIGLKFSVYEQ 310          
BLAST of slc25a-16 vs. TrEMBL
Match: A0A0X3NHS2 (Mitochondrial thiamine pyrophosphate carrier OS=Schistocephalus solidus OX=70667 GN=TPC PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 3.158e-98
Identity = 156/314 (49.68%), Postives = 207/314 (65.92%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTI-TDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWP--LISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSN---NVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            S++D+  AG   GF SRA VQPLDVVK+RFQLQVEPI  + +  KY+   QAI+CI  EEG  AFWKGHLSSQ+ AVSFS  QF+ +E+   Y+W   L+  + +     L     FL GSLAG T    TQP DV +TRF AQGEP+TY NL++A++ I++ +G+ G FRGL PSLLL+APQTG QF  Y L N   ++ T   K    +     +  IG LQ+  +G IAG ++K  VYP+D+ KKR+QVQGFE+AR +FG+LH S  +  CI  +   EG    FKGL  S++K+ +S+G+RF VYE+VC+
Sbjct:   13 SKMDFLAAGCVSGFFSRACVQPLDVVKVRFQLQVEPISGLESSSKYRSCLQAIRCITAEEGFSAFWKGHLSSQLLAVSFSGTQFAAFEI-YTYWWSTLLLHNTNNQQPYPLSPLPNFLCGSLAGITGGTITQPLDVLKTRFIAQGEPRTYKNLNDAVVSIMRKDGITGFFRGLSPSLLLIAPQTGLQFSIYKLVNRLVDIFTNDAKESLDRSTPLRVKSIGALQNISAGAIAGMVSKCAVYPMDVAKKRLQVQGFEEARCRFGRLHSSSSLRDCIITMCREEGPSSLFKGLSPSLLKACVSIGVRFGVYEEVCS 325          

HSP 2 Score: 68.9366 bits (167), Expect = 4.557e-9
Identity = 59/214 (27.57%), Postives = 95/214 (44.39%), Query Frame = 2
Query:  185 AIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYF--------WPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG---------EPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTK 775
            ++AG +GG     + QPLDV+K RF  Q EP        YK +  A+  I +++G+  F++G   S +     + +QFS Y+L               L   +P   KS+  + +    G++AG  +     P DV + R   QG            +  +L + II + + EG   LF+GL PSLL      G +F  Y    ++L+   K +
Sbjct:  132 SLAGITGG----TITQPLDVLKTRFIAQGEP------RTYKNLNDAVVSIMRKDGITGFFRGLSPSLLLIAPQTGLQFSIYKLVNRLVDIFTNDAKESLDRSTPLRVKSI-GALQNISAGAIAGMVSKCAVYPMDVAKKRLQVQGFEEARCRFGRLHSSSSLRDCIITMCREEGPSSLFKGLSPSLLKACVSIGVRFGVYEEVCSLLSSHHKGR 334          
BLAST of slc25a-16 vs. TrEMBL
Match: A0A1S8X4A5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_02565 PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.107e-97
Identity = 160/329 (48.63%), Postives = 214/329 (65.05%), Query Frame = 2
Query:  179 DYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYF-WPLISESPSTGKSVLKSSK---TFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKF------FKTKGKQDN------LFGIHKIGI--LQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLR 1111
            DY IAG+  GFVSRA+VQPLDV+KIRFQLQ EPI+     KY G  QAI+CI KEEG+ AFWKGH+ +Q+QAV+F+ +QFST+E+   +F    +S S    +  L+S     TF+ GSLAGS A I TQP DV RTRF AQGEPK Y N+ +A   I   EGL G FRGL+PSLLLV PQTG QF  Y+  N ++         F+   KQ +       +G     +  +QS +SGG+AG  AK  +YP+D++KKRMQ+ GFE+AR +FG+L  +  +  C+  I+  EG  G FKGL+ +++KS +S+  RF+VYEQ C  + ++R
Sbjct:   17 DYVIAGSVSGFVSRAIVQPLDVLKIRFQLQSEPIRVSNTSKYHGFVQAIRCINKEEGVVAFWKGHIPAQLQAVTFTALQFSTFEVLVAHFGRKTVSNSTHDKRIALRSPNTIGTFICGSLAGSFAAIATQPLDVLRTRFIAQGEPKLYRNIYHAAKHIATHEGLPGYFRGLLPSLLLVTPQTGLQFAIYHACNQLVGVIRLQWLEFRDSSKQGHSTSKSQRYGADSFPVSSIQSIISGGLAGMGAKCIIYPMDMVKKRMQIHGFEEARIRFGRLPATSNIRDCLINIWTTEGASGLFKGLRPTLLKSCLSISCRFTVYEQFCRVLYHIR 345          
BLAST of slc25a-16 vs. TrEMBL
Match: A0A4S2L9W8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008750 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 2.316e-97
Identity = 159/329 (48.33%), Postives = 213/329 (64.74%), Query Frame = 2
Query:  179 DYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYF-WPLISESPSTGKSVLKSSK---TFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKF------FKTKGK------QDNLFGIHKIGI--LQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLR 1111
            DY IAG+  GFVSRA+VQPLDV+KIRFQLQ EPI+     KY G+ QAI+CI KEEG+ AFWKGH+ +Q+QAV+F+ +QFST+E+   YF    +S S    +  L+      TF+ GSLAGS A I TQP DV RTRF AQGEPK Y N+ +A   I   EGL G FRGL+PSLLLV PQTG QF  Y+  N ++         F+   K      +   +G     +  +QS +SGG+AG  AK  +YP+D++KKRMQ+ GFE+AR +FG+L  +  +  C+  I+  EG  G FKGL+ +++KS +S+  RF+VYEQ C  + ++R
Sbjct:   15 DYVIAGSVSGFVSRAIVQPLDVLKIRFQLQSEPIRVSNTSKYHGVVQAIRCINKEEGVIAFWKGHIPAQLQAVTFTALQFSTFEVLVAYFRRKTVSSSTYDKRIALRCPNTLGTFICGSLAGSFAAIATQPLDVLRTRFIAQGEPKLYRNIYHAAKHIATHEGLPGFFRGLLPSLLLVTPQTGLQFAIYHACNQLIGIIRLQWLEFRDSSKPGHSTSKSQRYGADSFPVSSIQSIISGGLAGMGAKCIIYPMDMVKKRMQIHGFEEARVRFGRLPATSNIRDCLINIWTTEGASGLFKGLRPTLLKSCLSISCRFTVYEQFCRLLYHIR 343          

HSP 2 Score: 81.6481 bits (200), Expect = 2.402e-13
Identity = 62/219 (28.31%), Postives = 98/219 (44.75%), Query Frame = 2
Query:  482 KSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLS------NAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTK----GKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNL 1108
            +S L  +   + GS++G  +    QP DV + RF  Q EP    N S       AI  I K EG+   ++G IP+ L     T  QF  +     VL  +F+ K       D    +     L + + G +AGS A I   P+D+++ R   QG  K         + + +    K I   EG+ G+F+GL  S++      GL+F++Y   CN ++ +
Sbjct:    8 RSGLARNDYVIAGSVSGFVSRAIVQPLDVLKIRFQLQSEPIRVSNTSKYHGVVQAIRCINKEEGVIAFWKGHIPAQLQAVTFTALQFSTF----EVLVAYFRRKTVSSSTYDKRIALRCPNTLGTFICGSLAGSFAAIATQPLDVLRTRFIAQGEPK---------LYRNIYHAAKHIATHEGLPGFFRGLLPSLLLVTPQTGLQFAIY-HACNQLIGI 212          
BLAST of slc25a-16 vs. Ensembl Cavefish
Match: slc25a19 (solute carrier family 25 member 19 [Source:NCBI gene;Acc:103042047])

HSP 1 Score: 167.548 bits (423), Expect = 1.256e-49
Identity = 91/202 (45.05%), Postives = 119/202 (58.91%), Query Frame = 2
Query:  509 FLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRD 1114
            FL G LA  +AT+  QP D  RTRFAAQGEPK Y  L +A++ + + EG    +RGL P+L+ V P  G QFFFYN+   +L     TK K          G LQS LSG  AG ++K   YP D+ KKR+QV GFE+AR  FG++   +G V C   I   EG+ G+FKGL  S++K+ +S GL F  YE   + I NL+ 
Sbjct:    6 FLCGGLAACSATVACQPLDTLRTRFAAQGEPKVYRTLRHAVVTMYRQEGALTFYRGLTPTLVAVFPYAGLQFFFYNIFKKLLDND-STKSK----------GGLQSLLSGSAAGVISKTLTYPFDLFKKRLQVGGFEQARMHFGQVRTYRGFVDCAMRILKEEGLRGFFKGLSPSLLKAAVSTGLTFFWYEFFTSAIANLKS 196          

HSP 2 Score: 90.5077 bits (223), Expect = 8.444e-21
Identity = 58/186 (31.18%), Postives = 89/186 (47.85%), Query Frame = 2
Query:  224 VVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ---------GEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
              QPLD ++ RF  Q EP        Y+ +  A+  +Y++EG   F++G   + +    ++ +QF  Y +    F  L+    +  K  L+S    L GS AG  +   T PFD+F+ R             G+ +TY    +  + I+K EGLRG F+GL PSLL  A  TG  FF+Y    + +
Sbjct:   19 ACQPLDTLRTRFAAQGEP------KVYRTLRHAVVTMYRQEGALTFYRGLTPTLVAVFPYAGLQFFFYNI----FKKLLDNDSTKSKGGLQS---LLSGSAAGVISKTLTYPFDLFKKRLQVGGFEQARMHFGQVRTYRGFVDCAMRILKEEGLRGFFKGLSPSLLKAAVSTGLTFFWYEFFTSAI 191          
BLAST of slc25a-16 vs. Ensembl Cavefish
Match: slc25a42 (solute carrier family 25 member 42 [Source:NCBI gene;Acc:103032404])

HSP 1 Score: 120.168 bits (300), Expect = 1.714e-30
Identity = 89/331 (26.89%), Postives = 152/331 (45.92%), Query Frame = 2
Query:  107 SRFILRKSEMFETVNLSNSQ-----HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEG-IGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            SR  L +SE+    + S S+      S ++  ++GA  G V++  V PLD  KI FQ+             K   + I   Y+++G  + W+G+ ++ ++ + ++ +QF  +E  K     L+          L      L GSLAG+TA   T P D+ R R A   + + Y N+ +  + I + EGL+ L+RG  P++L V P  G  FF Y      L K    K  +   +   ++        G  AG + +   YP+D++++RMQ  G           H    ++  ++ I   EG I G +KGL  + +K  I++G+ F  ++
Sbjct:    8 SRGPLTQSEVLPRPSSSQSEGFKQGRSVLNSLLSGALAGAVAKTAVAPLDRTKIIFQVSSNRFSA------KEAYRLIYRTYRKDGFLSLWRGNSATMVRVIPYAAIQFCAHEQYKR----LLGGYYGFQGKALPPVPRLLAGSLAGTTAASLTYPLDMVRARMAVTPK-EMYSNILHVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTY----ETLKKLHAEKTGRPQPYSFERLAF------GACAGLIGQSSSYPLDVVRRRMQTAGVTG--------HTYGTILGTMREIVAEEGVIRGLYKGLSMNWVKGPIAVGISFMTFD 309          

HSP 2 Score: 58.9214 bits (141), Expect = 3.186e-9
Identity = 52/193 (26.94%), Postives = 85/193 (44.04%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG-EPKTYPNLSNAIIMIIKTEG-LRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTK 760
            +AG+  G  + ++  PLD+V+ R  + V P +      Y  I      I +EEGLK  ++G   + +  V ++ + F TYE  K         +  TG+    S +    G+ AG      + P DV R R    G    TY  +   +  I+  EG +RGL++GL  + +      G  F  ++L+   L K
Sbjct:  138 LAGSLAGTTAASLTYPLDMVRAR--MAVTPKEM-----YSNILHVFVRISREEGLKTLYRGFTPTILGVVPYAGLSFFTYETLKKL------HAEKTGRPQPYSFERLAFGACAGLIGQSSSYPLDVVRRRMQTAGVTGHTYGTILGTMREIVAEEGVIRGLYKGLSMNWVKGPIAVGISFMTFDLTQIFLRK 317          
BLAST of slc25a-16 vs. Ensembl Cavefish
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:103033894])

HSP 1 Score: 114.775 bits (286), Expect = 1.809e-28
Identity = 93/308 (30.19%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ--GEPKTYPNLSNAIIMI-IKTEGLRGLFRGLIPSLLLVAPQTGFQFF-FYNLSNNVLTKFFKTKGKQ--DNLFGIHKIGILQSA---LSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +AG   G  ++  + PLD VKI  Q    P       K+ G+   +K + K+EG    +KG+ +  ++   +  +QF  ++  K +         ST   +       + GS+AG TA I T P DV R R A Q  GE + Y  + NA   I +K  G+ G +RGL P+++ +AP  GF FF F  L +  L  F +  GK   DN      + +L++    L GGIAG++A+   YP+D+ ++RMQ+        K   L       K +K ++   G+  G ++GL  + I+   S  + F+ YE
Sbjct:   31 VAGGVAGCCAKTTIAPLDRVKILLQAH-NP-----HYKHLGVLATLKAVPKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDNYKKFL--------STQLGISGHIHRLMAGSMAGMTAVICTYPLDVIRARLAFQVTGEHR-YTGIGNAFQTIYLKEGGISGFYRGLTPTIIGMAPYAGFSFFTFGTLKSLGLAHFPEMLGKPSLDN----PDVLVLKTHVNLLCGGIAGAIAQTISYPLDVARRRMQLGAVLPDSDKCLSL------TKTLKYVYSQYGVKNGLYRGLSLNYIRCVPSQAVAFTTYE 313          

HSP 2 Score: 60.4622 bits (145), Expect = 8.995e-10
Identity = 47/182 (25.82%), Postives = 81/182 (44.51%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLS--NAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVE-GIGGYFKGLKTSVI 1039
            ++F+ G +AG  A     P D  R +   Q     Y +L     +  + K EG  GL++G    ++ + P    QF  ++     L+      G       IH++      ++G +AG  A IC YP+D+I+ R+  Q   +        H   G+    + I+L E GI G+++GL  ++I
Sbjct:   28 RSFVAGGVAGCCAKTTIAPLD--RVKILLQAHNPHYKHLGVLATLKAVPKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDNYKKFLSTQLGISGH------IHRL------MAGSMAGMTAVICTYPLDVIRARLAFQVTGE--------HRYTGIGNAFQTIYLKEGGISGFYRGLTPTII 187          
BLAST of slc25a-16 vs. Ensembl Cavefish
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:103033894])

HSP 1 Score: 114.775 bits (286), Expect = 1.809e-28
Identity = 93/308 (30.19%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ--GEPKTYPNLSNAIIMI-IKTEGLRGLFRGLIPSLLLVAPQTGFQFF-FYNLSNNVLTKFFKTKGKQ--DNLFGIHKIGILQSA---LSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +AG   G  ++  + PLD VKI  Q    P       K+ G+   +K + K+EG    +KG+ +  ++   +  +QF  ++  K +         ST   +       + GS+AG TA I T P DV R R A Q  GE + Y  + NA   I +K  G+ G +RGL P+++ +AP  GF FF F  L +  L  F +  GK   DN      + +L++    L GGIAG++A+   YP+D+ ++RMQ+        K   L       K +K ++   G+  G ++GL  + I+   S  + F+ YE
Sbjct:   31 VAGGVAGCCAKTTIAPLDRVKILLQAH-NP-----HYKHLGVLATLKAVPKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDNYKKFL--------STQLGISGHIHRLMAGSMAGMTAVICTYPLDVIRARLAFQVTGEHR-YTGIGNAFQTIYLKEGGISGFYRGLTPTIIGMAPYAGFSFFTFGTLKSLGLAHFPEMLGKPSLDN----PDVLVLKTHVNLLCGGIAGAIAQTISYPLDVARRRMQLGAVLPDSDKCLSL------TKTLKYVYSQYGVKNGLYRGLSLNYIRCVPSQAVAFTTYE 313          

HSP 2 Score: 60.4622 bits (145), Expect = 8.995e-10
Identity = 47/182 (25.82%), Postives = 81/182 (44.51%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLS--NAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVE-GIGGYFKGLKTSVI 1039
            ++F+ G +AG  A     P D  R +   Q     Y +L     +  + K EG  GL++G    ++ + P    QF  ++     L+      G       IH++      ++G +AG  A IC YP+D+I+ R+  Q   +        H   G+    + I+L E GI G+++GL  ++I
Sbjct:   28 RSFVAGGVAGCCAKTTIAPLD--RVKILLQAHNPHYKHLGVLATLKAVPKKEGFLGLYKGNGAMMVRIFPYGAIQFMAFDNYKKFLSTQLGISGH------IHRL------MAGSMAGMTAVICTYPLDVIRARLAFQVTGE--------HRYTGIGNAFQTIYLKEGGISGFYRGLTPTII 187          
BLAST of slc25a-16 vs. Ensembl Cavefish
Match: SLC25A45 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:103042612])

HSP 1 Score: 109.383 bits (272), Expect = 8.245e-27
Identity = 89/311 (28.62%), Postives = 135/311 (43.41%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKT-----FLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKT------YPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            IAG   G V   +  P+D VK+R Q         T   YKGI   +   Y  EG   F KG     +     + V F +Y     Y       + S  K   + +K      F  G ++G    + T P D+ + R   Q E ++      Y +  + ++MI++ +G RGLFRG+    L   P  G  F  Y L+  +LT+    KGK+ + + I         ++GGIAG +   C  P+D+IK R+Q+ G            V KG + CI      EGI  +FKGL  + +++F    + F  YE +
Sbjct:    7 IAGWISGAVGLVLGHPMDTVKVRLQ---------TQSIYKGIFDCVVRTYTHEGFHGFLKGMAFPVLSVAVSNSVAFGSYSNALDYI------TQSQHKERAQGNKAPLWAVFTAGCVSGMMQVLVTSPIDLVKVRLQNQTEGRSELDRARYRSPWHCMVMIVREDGARGLFRGVTALALRDVPCFGLYFLPYELTCRMLTE----KGKEPSTYAI--------LIAGGIAGVVTWSCATPMDVIKARLQMSG--------AGGRVYKGTLHCIITSLREEGIRVFFKGLLLNSLRAFPVNAVTFLSYEML 282          
BLAST of slc25a-16 vs. Ensembl Sea Lamprey
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 104.76 bits (260), Expect = 1.682e-25
Identity = 84/308 (27.27%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ--GEPKTYPNLSNAIIMIIKTEG-LRGLFRGLIPSLLLVAPQTGFQFF-FYNLSNNVLTKFFKTKGKQ--DNLFGIHKIGILQSALS---GGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +AG   G  ++  + PLD VKI  Q    P       K+ G+   +  I ++EG    +KG+ +  ++   +  +QF+ +E  K      +  +    + +  S   +L     G TA IFT P D+ R R A Q  G+   Y  + +A  +I K EG  RG + GL+P+++ +AP  GF FF F  L +  LT+     G+   DN      + +L++ ++   GG AG++A+   YP+D+ ++RMQ+ G       FG +       + +  ++   G+  G ++GL  + ++   S  + F+ YE
Sbjct:   40 LAGGIAGCCAKTTIAPLDRVKILLQ-AYNP-----HYKHLGVFSTLVAIPRKEGFLGLYKGNGAMMVRIFPYGAIQFTAFEKYKRVLSKQMGITGHVHRLLAGSHGWYLSPCAPGITAVIFTYPLDMVRARLAYQVKGD-HGYRGILHAFSLIYKKEGGFRGFYHGLVPTIIGMAPYAGFSFFTFSTLKSVGLTRAPALLGRPSADN----PDVLVLRTPINLLFGGTAGAIAQTISYPLDVARRRMQLAGILPNSENFGSM------WQTLTNVYKQYGVRRGLYRGLSLNYVRCVPSQAVAFTTYE 330          

HSP 2 Score: 65.4698 bits (158), Expect = 4.060e-12
Identity = 60/213 (28.17%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  173 QIDYAIAGASGGFVS------RAVV--QPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEG-LKAFWKGHLSSQI---QAVSFSLVQFSTYELCKVYFWPLISESPSTGKS---VLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG---EPKTYPNLSNAIIMIIKTEGLR-GLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
             +   +AG+ G ++S       AV+   PLD+V+ R   QV+      D  Y+GI  A   IYK+EG  + F+ G + + I       FS   FST +   +   P +   PS       VL++    L G  AG+ A   + P DV R R    G     + + ++   +  + K  G+R GL+RGL  + +   P     F  Y     VL
Sbjct:  129 HVHRLLAGSHGWYLSPCAPGITAVIFTYPLDMVRARLAYQVK-----GDHGYRGILHAFSLIYKKEGGFRGFYHGLVPTIIGMAPYAGFSFFTFSTLKSVGLTRAPALLGRPSADNPDVLVLRTPINLLFGGTAGAIAQTISYPLDVARRRMQLAGILPNSENFGSMWQTLTNVYKQYGVRRGLYRGLSLNYVRCVPSQAVAFTTYEFMRQVL 336          

HSP 3 Score: 49.6766 bits (117), Expect = 6.120e-7
Identity = 50/185 (27.03%), Postives = 81/185 (43.78%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLS--NAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLF-GIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRM--QVQGFEKARSKFGKLHVSKGVVKCIKVIFLVE-GIGGYFKGLKTSVI 1039
            + FL G +AG  A     P D  R +   Q     Y +L   + ++ I + EG  GL++G    ++ + P    QF  +     VL+K     G    L  G H  G   S  + GI    A I  YP+D+++ R+  QV+G           H  +G++    +I+  E G  G++ GL  ++I
Sbjct:   37 RNFLAGGIAGCCAKTTIAPLD--RVKILLQAYNPHYKHLGVFSTLVAIPRKEGFLGLYKGNGAMMVRIFPYGAIQFTAFEKYKRVLSKQMGITGHVHRLLAGSH--GWYLSPCAPGIT---AVIFTYPLDMVRARLAYQVKGD----------HGYRGILHAFSLIYKKEGGFRGFYHGLVPTII 204          
BLAST of slc25a-16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 2.467e-24
Identity = 82/300 (27.33%), Postives = 140/300 (46.67%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            +AG   G VSR    PLD +K+  Q++     TI  G   G+A  I+    E G+++ W+G+  + I+    + ++F  YE  K     LI       +  +   +  + GSLAG+TA     P +V +TR A  G+   Y ++ +    I K EGLR  F+G +P++L + P  G     Y    N    + +  G +    GI    +L  A +    G +A    YP+ +++ RMQ      A S  G      G+V  ++ I   +G+ G ++G+  + +K   ++G+ + VYE +
Sbjct:   29 VAGGGAGVVSRTCTAPLDRLKVIMQVKASRHNTI--GVVGGLAHMIR----EGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIK----KLIGMR----QEQIGVQERLVAGSLAGATAQTVIYPMEVVKTRLAL-GKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKN---WWLQKHGAEGANPGIAV--LLCCATTSSTCGQLAS---YPLALVRTRMQA-----AASIGGPGASQPGMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENL 300          

HSP 2 Score: 62.7734 bits (151), Expect = 2.502e-11
Identity = 44/197 (22.34%), Postives = 86/197 (43.65%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            +  + G  AG  +   T P D  +     +        +   +  +I+  G+R L+RG   +++ +AP+T  +F  Y      + K    + +Q        IG+ +  ++G +AG+ A+  +YP++++K R+            GK      +V C + I   EG+  +FKG   +V+      G+  + YE + N
Sbjct:   26 RQLVAGGGAGVVSRTCTAPLDRLKVIMQVKASRHNTIGVVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQ----IKKLIGMRQEQ--------IGVQERLVAGSLAGATAQTVIYPMEVVKTRL----------ALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKN 200          
BLAST of slc25a-16 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 95.5153 bits (236), Expect = 1.647e-22
Identity = 80/290 (27.59%), Postives = 132/290 (45.52%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAA-----QGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIK 1042
            +AG     +S+  V P++ VK+  Q+Q    Q   D +YKGI   +  I +E+G  +FW+G+L++ I+      + F+  +  K  F   + +     +     +     G  AG+T+  F  P D  RTR AA     Q E + +  L++ I  I K++GLRGL++G   S+  +       F  Y+ +  +L        K   L     I    +A+SG        I  YP D +++RM +Q   K     G   + +G + C K I   EG   +FKG  ++VI+
Sbjct:   15 MAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYF---AGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGQAE-REFKGLADCISKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGML-----PNPKSTPLVVSWMIAQSVTAVSG--------IVSYPFDTVRRRMMMQSGRK-----GADIMYRGTIDCWKKILQQEGGKAFFKGAWSNVIR 282          

HSP 2 Score: 51.6026 bits (122), Expect = 1.306e-7
Identity = 49/205 (23.90%), Postives = 82/205 (40.00%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKT------YPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIG-----ILQSALSGGIAGSMAKICVYPVDIIKKRMQVQ-GFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            K F+ G +A + +     P +  +     Q   K       Y  + + ++ I + +G    +RG + +++   P     F F            K K KQ  L G+ K          +  SGG AG+ +   VYP+D  + R+    G  +A  +F      KG+  CI  IF  +G+ G ++G   SV    I     F +Y+
Sbjct:   12 KDFMAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAF------------KDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGQAEREF------KGLADCISKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGIYD 198          
BLAST of slc25a-16 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 96.6709 bits (239), Expect = 5.203e-22
Identity = 73/301 (24.25%), Postives = 133/301 (44.19%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYN-LSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            +AG + G VSR    PLD +K+  Q+       I+      I    K + KE G+ + W+G+  + I+    + ++F  YE  K +          +    L   + F+ GSLAG+TA     P +V +TR   + +   Y  + +    I   EG+   ++G +P+++ + P  G     Y  L N  LTK+ K              GIL     G ++ S  ++  YP+ +I+ RMQ Q   +   +   + + + +VK        +G  G ++G+  + +K   ++ + + VYE +
Sbjct:  215 MAGGAAGAVSRTGTAPLDRMKVFMQVHGSKSNNIS------ILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKFI--------GSNNVSLGIHERFMAGSLAGATAQTIIYPMEVMKTRLTLR-KTGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADP---------GILVLLACGTVSSSCGQVASYPLALIRTRMQAQASMEGGPQLSMVGLFRNIVKN-------DGPLGLYRGIAPNFMKVIPAVSISYVVYENL 484          

HSP 2 Score: 76.6406 bits (187), Expect = 1.680e-15
Identity = 50/192 (26.04%), Postives = 92/192 (47.92%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCK-VYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIM--IIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            +AG+  G  ++ ++ P++V+K R  L+         G+Y G+    K I+ +EG+ AF+KG++ + I  + ++ +  + YE  K  +      ++   G  VL        G+++ S   + + P  + RTR  AQ   +  P LS   +   I+K +G  GL+RG+ P+ + V P     +  Y     VL
Sbjct:  309 MAGSLAGATAQTIIYPMEVMKTRLTLR-------KTGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADPGILVL-----LACGTVSSSCGQVASYPLALIRTRMQAQASMEGGPQLSMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRVL 488          

HSP 3 Score: 70.8626 bits (172), Expect = 1.314e-13
Identity = 49/200 (24.50%), Postives = 94/200 (47.00%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGIL 1102
            +  + G  AG+ +   T P D  +      G      ++      +IK  G+  L+RG   +++ +AP+T  +F  Y      + KF    G  +   GIH     +  ++G +AG+ A+  +YP++++K R+ ++       K G+     G++ C K IF+ EG+  ++KG   ++I      G+  ++YE + N  L
Sbjct:  212 RQLMAGGAAGAVSRTGTAPLDRMKVFMQVHGSKSNNISILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQ----IKKFI---GSNNVSLGIH-----ERFMAGSLAGATAQTIIYPMEVMKTRLTLR-------KTGQY---SGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWL 389          
BLAST of slc25a-16 vs. Ensembl Sea Lamprey
Match: SLC25A40 (solute carrier family 25 member 40 [Source:HGNC Symbol;Acc:HGNC:29680])

HSP 1 Score: 90.8929 bits (224), Expect = 8.676e-21
Identity = 81/318 (25.47%), Postives = 129/318 (40.57%), Query Frame = 2
Query:  227 VQPLDVVKIRFQLQVEP---------IQTITD------------------GKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCI------KVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            V PLDVVKIR Q Q  P            + D                  G   G   A   I + EG+ + W G   + + AV  +++ F++Y+L +        +S +   +    S  F+ G++A   A     P ++ RT+   Q    TY  LS  +   +  +G R L+RG  P++    P +G  +  Y L  + L     + G     F IH         SG ++G+ A I   P D++K R Q++         G++ ++KG  + I      K I+   G+ G F G    VIK   +  +  S YE
Sbjct:    1 VTPLDVVKIRLQAQQTPFYKGKCFVYCNGLMDHLCVCMNGNSKAWYKPAPGYVNGTLDAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLR--------DSLARHFNSQHPSIPFVAGAVARLGAVTVISPLELIRTKM--QSRQLTYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGL---MGSAGVNQATFLIHFT-------SGAVSGTFAGIATLPFDVVKTRRQIE--------LGEMEITKGAFRDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYE 290          

HSP 2 Score: 67.781 bits (164), Expect = 5.943e-13
Identity = 60/223 (26.91%), Postives = 102/223 (45.74%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLL----GSLAGSTATIFTQPFDVFRTRFAAQ-GEPK----TYPNLSNAIIM--IIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNL 793
            NSQH  I + +AGA     +  V+ PL++++ + Q +           YK +++ ++    ++G ++ W+G   +  + V FS + +  YEL K               S   +  TFL+    G+++G+ A I T PFDV +TR   + GE +     + ++S    M  I    GLRGLF G +P ++ VAP        Y    +    FF+   +Q  L
Sbjct:  106 NSQHPSIPF-VAGAVARLGAVTVISPLELIRTKMQSR--------QLTYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIK----------HGLMGSAGVNQATFLIHFTSGAVSGTFAGIATLPFDVVKTRRQIELGEMEITKGAFRDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYEFGKS----FFRKLNQQREL 305          

HSP 3 Score: 48.521 bits (114), Expect = 1.241e-6
Identity = 33/160 (20.62%), Postives = 71/160 (44.38%), Query Frame = 2
Query:  623 NAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGIL 1102
            +A + I++ EG+  L+ GL P+L++  P T   F  Y+L  + L + F ++                  ++G +A   A   + P+++I+ +MQ +               K + +C++     +G    ++G   +V +     GL +  YE + +G++
Sbjct:   58 DAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSLARHFNSQHPSIPF------------VAGAVARLGAVTVISPLELIRTKMQSRQL-----------TYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGLM 194          
BLAST of slc25a-16 vs. Ensembl Yeast
Match: YPR011C_mRNA (Mitochondrial transporter; major substrates are adenosine 5'-phosphosulfate (APS) and 3'-phospho-adenosine 5'-phosphosulfate (PAPS); member of the mitochondrial carrier family; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000006215])

HSP 1 Score: 125.176 bits (313), Expect = 3.752e-33
Identity = 100/334 (29.94%), Postives = 155/334 (46.41%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAI-------IMIIKTE------GLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALS-------GGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILN 1105
            Q S I + +AG   G VSR VV P + VKI  Q     +Q+ T    +GI  +I+ +Y EEG K  ++G+  + I+   +S VQF  YE CK     L   + + G+  L +++    G+L G  + + T P D+ +TR + Q    +  N S A        I  + +E      GLRGL+RG+ P+ L V P     F  Y               +Q   FG++      S  S       G I+G +A+   YP D++++R QV       ++ G  + S  V   +  I   EG+ GY+KGL  ++ K   S  + + VYE VC+ + N
Sbjct:   20 QDSNIAF-LAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK---KLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVY---------------EQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQV--LAMGGNELGFRYTS--VWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCDSVRN 325          
BLAST of slc25a-16 vs. Ensembl Yeast
Match: AAC3 (Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Aac1p; has roles in maintenance of viability and in respiration; AAC3 has a paralog, PET9, that arose from the whole genome duplication [Source:SGD;Acc:S000000289])

HSP 1 Score: 110.923 bits (276), Expect = 4.022e-28
Identity = 90/322 (27.95%), Postives = 151/322 (46.89%), Query Frame = 2
Query:  155 SNSQHSQIDYAIAGASGGF---VSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAA------QGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQF-FFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            S+++  + ++AI    GG    +++    P++ VKI  Q Q E I Q   D KY GI    K   K+EGL +FW+G+ ++ I+      + F+  +  K+ F     +    GK     +     G  AG+ + +F    D  RTR AA      +G  + +  L++     +K++G+ GL+RG +PS++ +    G  F  F +L   VLT      G  D  F       L S L G +  + A  C YP+D +++RM +          G+     G + C+K I   EG+G  FKG   ++++S    G+  S+Y+Q+
Sbjct:    3 SDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG--FKKEEGYGKWF---AGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLT------GSLDGSF-------LASFLLGWVVTTGASTCSYPLDTVRRRMMMTS--------GQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV-ISMYDQL 297          

HSP 2 Score: 47.7506 bits (112), Expect = 1.332e-6
Identity = 45/194 (23.20%), Postives = 80/194 (41.24%), Query Frame = 2
Query:  191 AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFA-AQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFK 769
            +G + G +S   V  LD  + R     +  +     ++ G+    K   K +G+   ++G + S +  V +  + F  ++  K    PL+      G S L S   FLLG +  + A+  + P D  R R     G+   Y    + +  I+ +EG+  LF+G   ++L      G    +  L   +  K FK
Sbjct:  122 SGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLK----PLVLTGSLDG-SFLAS---FLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMILFGKKFK 307          
BLAST of slc25a-16 vs. Ensembl Yeast
Match: TPC1 (Mitochondrial membrane transporter; mediates uptake of the essential cofactor thiamine pyrophosphate (ThPP) into mitochondria; expression appears to be regulated by carbon source; member of the mitochondrial carrier family [Source:SGD;Acc:S000003328])

HSP 1 Score: 109.768 bits (273), Expect = 1.103e-27
Identity = 80/312 (25.64%), Postives = 147/312 (47.12%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQ----VEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQ------VQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            +AGA  G ++R++  P+D +KIR QL     ++P  +        + +  + + K EG+++FWKG++   +  V++   QFS+Y L   Y  P   E+            + ++G+ AG T++I + PFDV RTR  A  +  +  +++  +  I K EGL G F+G I S+  +       F  Y        +  KT           ++  L  + +G I G +AKI  +P++ I++RMQ      ++ F +  S +G  +   G  +    I   EG+   ++G+  ++ K+  +  + F  YE   +
Sbjct:   21 LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGS-------QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEA---------RLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSM-SITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKW----ELATLNHS-AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGS-YKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIH 309          

HSP 2 Score: 67.3958 bits (163), Expect = 5.285e-13
Identity = 54/198 (27.27%), Postives = 86/198 (43.43%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRF---AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            KT L G+++G  A   T P D  + R     A G       +      +IK EG+R  ++G IP  LL       QF  Y+L N  LT F           G+     L S + G  AG  + I  YP D+++ R+             ++H S  + + ++ I+ +EG+ G+FKG   S+    ++  + F  YE +
Sbjct:   18 KTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-----------GLE--ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANN---------QMH-SMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192          

HSP 3 Score: 55.4546 bits (132), Expect = 4.473e-9
Identity = 52/217 (23.96%), Postives = 92/217 (42.40%), Query Frame = 2
Query:  167 HSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFL---LGSLAGSTATIFTQPFDVFRTRF---------------AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKF 763
             +++   + GA  G  S  V  P DV++ R  +    + +++      I + ++ I+K EGL  F+KG ++S       + + F TYE  ++Y      E+  T  +  K     L    G++ G  A I T P +  R R                +  G  K Y   +   + I+K EG+  L+RG++ +L    P T   F+ Y  + + L  +
Sbjct:  110 EARLHSLVVGAFAGITSSIVSYPFDVLRTRL-VANNQMHSMS------ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIY----CDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGY-GFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIHYLRMY 314          
BLAST of slc25a-16 vs. Ensembl Yeast
Match: LEU5 (Mitochondrial carrier protein; involved in the accumulation of CoA in the mitochondrial matrix; homolog of human Graves disease protein SLC25A16, which complements yeast null mutant; does not encode an isozyme of Leu4p, as first hypothesized [Source:SGD;Acc:S000001044])

HSP 1 Score: 110.538 bits (275), Expect = 1.214e-27
Identity = 91/357 (25.49%), Postives = 160/357 (44.82%), Query Frame = 2
Query:  128 SEMFETVNLSNSQHSQIDY---------AIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGE----------PKTYPNLSNAIIMIIKTEGLRGLF-------RGLIPSLLLVAPQTGFQFFFYNLSNNVL-TKFFKTK-----GKQDNLFGIHK-----IGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            ++ ++ +N + +Q +  D           +AG   G  ++ ++ PLD +KI FQ    P  T   G   G+ +A K I+  +G++ F++GH ++ ++   ++ V+F  YE  +    P         K      +  + GSLAG  +   T P D+ R R A + E           K Y   ++A   +IK + +   F       RG +P++L + P  G  FF ++L ++VL + FF         + D L  + K     +      +SGG+AG  ++   YP +II++R+QV        K    H  + + +   +IF   G+ G+F GL    IK    +   F VYE++
Sbjct:    9 NDSYKHINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTS-NPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIP--------SKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASA--TLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALS---PKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERM 351          

HSP 2 Score: 53.1434 bits (126), Expect = 2.903e-8
Identity = 31/96 (32.29%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  815 ILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGIL 1102
            I++S L+GGI+GS AK  + P+D IK   Q       +   G L    G+V+  K I++ +G+ G+F+G   ++++ F    ++F  YEQ+ N ++
Sbjct:   33 IVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYT-GSL---IGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLI 124          
BLAST of slc25a-16 vs. Ensembl Yeast
Match: PET9 (Major ADP/ATP carrier of the mitochondrial inner membrane; exchanges cytosolic ADP for mitochondrially synthesized ATP; also imports heme and ATP; required for viability in many lab strains that carry a sal1 mutation; PET9 has a paralog, AAC3, that arose from the whole genome duplication; human homolog SLC25A4 implicated in progressive external ophthalmoplegia can complement yeast null mutant [Source:SGD;Acc:S000000126])

HSP 1 Score: 97.0561 bits (240), Expect = 3.941e-23
Identity = 80/311 (25.72%), Postives = 140/311 (45.02%), Query Frame = 2
Query:  176 IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPI-QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAA------QGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            ID+ + G S   V++    P++ VK+  Q Q E + Q   D KY GI    K    +EG+ +FW+G+ ++ I+      + F+  +  K  F     E  +   +   +S     G  AG+ + +F    D  RTR AA      +G  + +  L +     +K++G+ GL+RG +PS++ +    G  F  Y+    +L            L G  +   L S L G +  + A  C YP+D +++RM +          G+     G   C++ I   EG+G  FKG   ++++     G+  S+Y+Q+
Sbjct:   25 IDFLMGGVSAA-VAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLAS-----GGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLL------------LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTS--------GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV-ISMYDQL 308          
BLAST of slc25a-16 vs. Ensembl Nematostella
Match: EDO29391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3S4])

HSP 1 Score: 225.713 bits (574), Expect = 9.389e-71
Identity = 124/309 (40.13%), Postives = 174/309 (56.31%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPI--------QTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELC--KVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQ 1084
            I G+  G  +R + QPLDV+KIRFQLQVEP           +T GKY G+ QA K +++EEG  A WKGH+ +Q  +V +   QF+ +E      YF      SP T +   K +  F+ G+ +G  A +  QP DV RTR  AQGEPK Y +L  A  ++ K EG    F+GL PSLL + P +G QF  Y+L   +           D++F I    +++S   G ++G ++K  + P DIIKKR+QVQGFE+AR  FG++    GV  C + I   EG  G FKGL  S +K+ +++G+ F  YEQ
Sbjct:   20 ICGSVAGAFTRLIAQPLDVLKIRFQLQVEPTFQPTFQITTKVTTGKYTGVWQAGKLVFEEEGFAALWKGHVPAQALSVVYGYFQFTCFEAFTKAAYFI-----SPRTMEKKYKPATHFMCGAFSGCAAAVMAQPLDVIRTRLVAQGEPKIYNSLLQAARVMYKGEGPTVFFKGLTPSLLQIFPYSGLQFGSYSLLKTIW----------DHVFDIKVTDVIESLTCGALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCFRTILKEEGAMGLFKGLAPSTLKAAVTVGIMFCTYEQ 313          

HSP 2 Score: 82.4185 bits (202), Expect = 1.725e-17
Identity = 63/222 (28.38%), Postives = 97/222 (43.69%), Query Frame = 2
Query:  125 KSEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ---------GEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKF 763
            K+  F +      ++    + + GA  G  +  + QPLDV++ R   Q EP        Y  + QA + +YK EG   F+KG   S +Q   +S +QF +Y L K   W  + +   T   V++S      G+L+G  +     PFD+ + R   Q         G  + Y  + +    I+K EG  GLF+GL PS L  A   G  F  Y    ++  K 
Sbjct:  112 KAAYFISPRTMEKKYKPATHFMCGAFSGCAAAVMAQPLDVIRTRLVAQGEP------KIYNSLLQAARVMYKGEGPTVFFKGLTPSLLQIFPYSGLQFGSYSLLKT-IWDHVFDIKVT--DVIES---LTCGALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCFRTILKEEGAMGLFKGLAPSTLKAAVTVGIMFCTYEQCLHLFRKL 321          

HSP 3 Score: 53.1434 bits (126), Expect = 8.570e-8
Identity = 35/104 (33.65%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  176 IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQ--VEPIQTITD-GKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPST 478
            I+    GA  G +S+AV+ P D++K R Q+Q   E  Q+     +Y G+    + I KEEG    +KG   S ++A     + F TYE C   F  LI +   T
Sbjct:  225 IESLTCGALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCFRTILKEEGAMGLFKGLAPSTLKAAVTVGIMFCTYEQCLHLFRKLIHKGDRT 328          
BLAST of slc25a-16 vs. Ensembl Nematostella
Match: EDO34426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF1])

HSP 1 Score: 145.976 bits (367), Expect = 2.778e-40
Identity = 98/325 (30.15%), Postives = 163/325 (50.15%), Query Frame = 2
Query:  125 KSEMFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEG--LRG-LFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQ---SALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYE 1081
            K   F  V +  + +    + +AG   G VSR  V PL+ VKI  Q+QV+      + K+KG+   +  I KEEG+  ++KG+ ++ I+   +S VQF+ YE  K      I + P     +    K  + G++AG T+   T P D+ RTR +AQG  + Y  + +A   I+  EG    G L+RGL+P+ + +AP  G  F  Y      L        +  +L  I K   L      + G +AG++++   YP+D++++RMQ++G     +    LH    +VK       +EG  G +KG+  +++K   S+G++F+ YE
Sbjct:   18 KQPEFSDVRIPKTSYKPFKHLLAGGIAGAVSRTSVSPLERVKILLQIQVK------NPKFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKKLLN--IPDDPEHQTPI----KRLVAGAMAGVTSITATYPLDLIRTRLSAQGADRKYRGIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETLKGFLFSTVMASSQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKGIRADFAYKSTLHAFSSIVK-------LEGFRGLYKGMWPNILKVAPSVGIQFAAYE 323          

HSP 2 Score: 93.5893 bits (231), Expect = 2.869e-21
Identity = 68/223 (30.49%), Postives = 103/223 (46.19%), Query Frame = 2
Query:  131 EMFETVNLSNSQHSQ--IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEG---LKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKT--------FLLGSLAGSTATIFTQPFDVFRTRFAAQG--EPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            E  + +N+ +    Q  I   +AGA  G  S     PLD+++ R   Q        D KY+GI  A + I  EEG       ++G + + +    +  + F+ YE  K + +  +  S S G S+    K          + GSLAG+ +   T P DV R R   +G      Y +  +A   I+K EG RGL++G+ P++L VAP  G QF  Y LS + L
Sbjct:  114 EYKKLLNIPDDPEHQTPIKRLVAGAMAGVTSITATYPLDLIRTRLSAQG------ADRKYRGIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETLKGFLFSTVMAS-SQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKGIRADFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILKVAPSVGIQFAAYELSKSFL 329          

HSP 3 Score: 50.8322 bits (120), Expect = 5.138e-7
Identity = 35/95 (36.84%), Postives = 55/95 (57.89%), Query Frame = 2
Query:  830 LSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRD 1114
            L+GGIAG++++  V P++ +K  +Q+Q       KF      KGV+  +  I   EGI GYFKG  T+VI+ F    ++F+ YE+    +LN+ D
Sbjct:   39 LAGGIAGAVSRTSVSPLERVKILLQIQ---VKNPKF------KGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEY-KKLLNIPD 123          

HSP 4 Score: 48.1358 bits (113), Expect = 3.653e-6
Identity = 29/113 (25.66%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  116 ILRKSEMFETVNLSNSQHSQIDYAI-AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFW 451
            ++  S+     N+   +   +++ +  G+  G VS+    PLDVV+ R Q++        D  YK    A   I K EG +  +KG   + ++      +QF+ YEL K + +
Sbjct:  222 VMASSQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMK----GIRADFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILKVAPSVGIQFAAYELSKSFLY 330          
BLAST of slc25a-16 vs. Ensembl Nematostella
Match: EDO38453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCS6])

HSP 1 Score: 131.339 bits (329), Expect = 2.985e-35
Identity = 86/299 (28.76%), Postives = 147/299 (49.16%), Query Frame = 2
Query:  191 AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQG-FEKARSKFGKLHVSKGVVKCIKVIFLVEGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +GA  G V++  + PLD  KI FQ       + T    +G+   +   Y   G    ++G+ ++ ++ V ++ +QF+++E  K      I E    GK  L   + F+ GSLAG TA + T P D+ R R A   + K Y  L NA   I + EG+R  +RG +P+L+ + P  G  FF Y        +F+   GK+   F  H++        G  AG   +   YP++I+++RMQ  G +   R ++  +  +       K ++  EG+  G +KGL  + +K  +++G+ F+VY+
Sbjct:    9 SGAIAGAVAKTAIAPLDRTKIIFQ------TSNTRFSVQGVVHVLTQTYTTNGFTGLFRGNSATMMRVVPYASIQFTSHEQYKKLL--RIDE----GKGALPPVRRFVAGSLAGMTAALLTYPLDMVRARLAIT-QKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCKKAFGEFY--DGKKPTPF--HRLAF------GACAGLFGQSATYPIEIVRRRMQADGIYGPRRPEYAHMWSTA------KYVYKTEGLRTGLYKGLSLNWVKGPVAVGISFTVYD 278          

HSP 2 Score: 71.2478 bits (173), Expect = 6.359e-14
Identity = 54/197 (27.41%), Postives = 90/197 (45.69%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG-----EPKTYPNLSNAIIMIIKTEGLR-GLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTK 760
            +AG+  G  +  +  PLD+V+ R  +  +        KY G+  A   IY++EG++ F++G++ + I  + ++ + F TYE CK  F         T    L        G+ AG      T P ++ R R  A G      P+ Y ++ +    + KTEGLR GL++GL  + +      G  F  Y+L    + K
Sbjct:  104 VAGSLAGMTAALLTYPLDMVRARLAITQKK-------KYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCKKAFGEFYDGKKPTPFHRLA------FGACAGLFGQSATYPIEIVRRRMQADGIYGPRRPE-YAHMWSTAKYVYKTEGLRTGLYKGLSLNWVKGPVAVGISFTVYDLMQAFIGK 286          
BLAST of slc25a-16 vs. Ensembl Nematostella
Match: EDO43942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC5])

HSP 1 Score: 112.849 bits (281), Expect = 2.812e-28
Identity = 90/324 (27.78%), Postives = 145/324 (44.75%), Query Frame = 2
Query:  164 QHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGK-----YKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ-----GEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKI----CVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            +H + ++ +AG SGG  +  V+ PLD+VKIR Q        + DG      YKG+  A + I + +G K  ++G   +     +   + F  Y + K       S+ P      L + K  L G +AG      T P  V +TR   Q     G+ KTY  + +A I I + EGLRGL++G  P L+ V+     QF  Y       + +F    KQ            Q++L   +  S++KI      YP  +++ R+Q             L   KG +  I+ ++  EGI G++KG+  SV++   +  + F VYE + +
Sbjct:   21 RHVRYEHLVAGVSGGVSATMVLHPLDLVKIRLQ--------VNDGSGRGPAYKGLIDATRSIIRTDGFKGLYQGATPNIAGNGTAWGLYFFGYNILKAVMQDG-SDEP------LGAEKHLLAGVIAGWGTLTVTNPIWVVKTRMCLQYGDGAGQTKTYTGMMDAFIKIWRQEGLRGLYKGYAPGLIGVS-HGALQFMAYEELKKANSVYFNRPIKQK-----------QTSLEYLVMASLSKIFAASATYPYQVVRSRLQ---------NHNTLGQYKGAIDIIQKVWRFEGIRGFYKGMVPSVLRVTPACAITFLVYENIAH 308          

HSP 2 Score: 73.9442 bits (180), Expect = 9.748e-15
Identity = 58/196 (29.59%), Postives = 92/196 (46.94%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCK----VYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFY-NLSNNVLTK 760
            +AG   G+ +  V  P+ VVK R  LQ       T   Y G+  A   I+++EGL+  +KG+    I  VS   +QF  YE  K    VYF   I +  +       S +  ++ SL+   A   T P+ V R+R         Y    + I  + + EG+RG ++G++PS+L V P     F  Y N+++ ++ K
Sbjct:  127 LAGVIAGWGTLTVTNPIWVVKTRMCLQYGDGAGQTK-TYTGMMDAFIKIWRQEGLRGLYKGYAPGLI-GVSHGALQFMAYEELKKANSVYFNRPIKQKQT-------SLEYLVMASLSKIFAASATYPYQVVRSRLQNHNTLGQYKGAIDIIQKVWRFEGIRGFYKGMVPSVLRVTPACAITFLVYENIAHFLMPK 313          
BLAST of slc25a-16 vs. Ensembl Nematostella
Match: EDO31058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ11])

HSP 1 Score: 111.694 bits (278), Expect = 3.961e-28
Identity = 85/299 (28.43%), Postives = 144/299 (48.16%), Query Frame = 2
Query:  215 SRAVVQPLDVVKIRFQLQVEPIQTITDGKYKG--IAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ-GEPKTYPNLSNAIIMI-IKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL--TKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLV---EGI-GGYFKGLKTSVIKSFISLGLRFSVYE 1081
            +R  + PL+ +KI  Q          +  YKG  +  A + IY+ EGL A++KG+ +  ++   +  VQF +YE    Y   L + SP+  K V         GSLAG TA   T P D+ R+R A Q  + + Y  ++  I  I +K  G + L++G +P+LL + P  G  F+ +         T+   T    D L    ++ I+   + GG+AG++++   YP+D++++RMQ+ G      K+           CI  +  V   +GI  G ++GL  + ++    + + F VYE
Sbjct:   13 ARTTMAPLERLKILLQAN--------NRHYKGMKVLTAFRAIYRNEGLLAYFKGNGAMMLRTFPYGAVQFLSYEH---YSKVLQTSSPAINKLVA--------GSLAGMTACACTYPLDMVRSRLAFQVAQDQGYTTITQTIRCISVKEGGPKALYKGFVPTLLTIVPAMGIGFYMFETMKAYFLETRIAFTNTNPDTL--CPELSIIGGFVCGGVAGAVSQTIAYPLDVVRRRMQLAGAVPDGHKYN---------TCINTLVNVYKDDGIRRGLYRGLSINYLRVCPQVAIMFGVYE 281          

HSP 2 Score: 86.6557 bits (213), Expect = 3.818e-19
Identity = 62/204 (30.39%), Postives = 92/204 (45.10%), Query Frame = 2
Query:  176 IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCI-YKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFW----PLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG---EPKTYPNLSNAIIMIIKTEGLR-GLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTK 760
            I+  +AG+  G  + A   PLD+V+ R   QV       D  Y  I Q I+CI  KE G KA +KG + + +  V    + F  +E  K YF        + +P T    L     F+ G +AG+ +     P DV R R    G   +   Y    N ++ + K +G+R GL+RGL  + L V PQ    F  Y ++   L +
Sbjct:   91 INKLVAGSLAGMTACACTYPLDMVRSRLAFQVA-----QDQGYTTITQTIRCISVKEGGPKALYKGFVPTLLTIVPAMGIGFYMFETMKAYFLETRIAFTNTNPDTLCPELSIIGGFVCGGVAGAVSQTIAYPLDVVRRRMQLAGAVPDGHKYNTCINTLVNVYKDDGIRRGLYRGLSINYLRVCPQVAIMFGVYEVTKQFLNR 289          
BLAST of slc25a-16 vs. Ensembl Medaka
Match: slc25a19 (solute carrier family 25 member 19 [Source:NCBI gene;Acc:101168214])

HSP 1 Score: 245.743 bits (626), Expect = 2.787e-78
Identity = 135/318 (42.45%), Postives = 191/318 (60.06%), Query Frame = 2
Query:  170 SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTI-TDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYE-LCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDK 1117
            S  +  +AG++ G V+RA++ P DVVKIRFQLQ+E +  +  +GKY G+ QA +CIY EEGL AFWKGH+ +Q+ ++ +  VQF+++E L K+ +     +S S G         F  G LA  +AT+  QP D  RTRFA+QGEPK Y NL +A+  + +TEG    FRGL P+L+ V P  G QFFFYN+S   L     +KG           G L+S + G  AG ++K   YP D+ KKR+QV GFE AR++FG++    G++ C+  I   EG  G+FKGL  S++K+ +S G  F  YE   N I N+  +
Sbjct:   14 SPKEAVLAGSAAGMVTRALISPFDVVKIRFQLQIERVSALRPEGKYAGLFQAFRCIYSEEGLSAFWKGHVPAQLLSICYGAVQFTSFEVLTKMVYKLTPYDSQSAGVH-------FFCGGLAACSATVVCQPLDTLRTRFASQGEPKVYRNLRHAVSTMWRTEGPLTFFRGLSPTLVAVYPYAGLQFFFYNVSKKWLGP--PSKGGDSG-------GSLKSLVCGSGAGVISKTITYPFDLFKKRLQVGGFEAARARFGQVRRYSGLMDCMFQIAKEEGFRGFFKGLSPSLVKAALSTGFTFFWYEFFINLIHNVERR 315          
BLAST of slc25a-16 vs. Ensembl Medaka
Match: ENSORLT00000000947.2 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 130.954 bits (328), Expect = 2.059e-34
Identity = 95/350 (27.14%), Postives = 164/350 (46.86%), Query Frame = 2
Query:  101 HCSRFILRKSEMFETVNLSNSQH-----SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIA--------QAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEG-IGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNL 1108
            H SR  + ++ +      S +Q      S +D  + GA  G V++ V+ PLD  KI FQ           GK  GI         + I C Y ++GL + W+G+ ++ ++ + ++ +QF ++E  K     L+     + +  L      L GSLAG+TA   T P DV R R A   + + Y N+ +  + I + EG+R L+RG  P++L V P  G  FF Y      L K    + K+   +   ++      + G  AG + +   YP+D++++RMQ  G   +            +V  I+ I   EG + G +KGL  + +K  +++G+ F+ ++   + +L L
Sbjct:    8 HQSRLPVAQAAVLALPASSQTQDLRPRLSAVDSLLCGAFAGAVAKTVIAPLDRTKIIFQ-----------GKISGIGPFSVQEAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYK----KLLGGDYGSQERALPPFPRLLAGSLAGTTAATLTYPLDVVRARMAVTAK-EMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTY----ETLKKLHAERTKRCQPYPHERL------VFGACAGLIGQSASYPLDVVRRRMQTAGVTGSS--------YSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLLLKL 323          
BLAST of slc25a-16 vs. Ensembl Medaka
Match: ENSORLT00000031788.1 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 129.798 bits (325), Expect = 6.342e-34
Identity = 91/342 (26.61%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  101 HCSRFILRKSEMFETVNLSNSQH-----SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEG-IGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNL 1108
            H SR  + ++ +      S +Q      S +D  + GA  G V++ V+ PLD  KI FQ+  +          +   + I C Y ++GL + W+G+ ++ ++ + ++ +QF ++E  K     L+     + +  L      L GSLAG+TA   T P DV R R A   + + Y N+ +  + I + EG+R L+RG  P++L V P  G  FF Y      L K    + K+   +   ++      + G  AG + +   YP+D++++RMQ  G   +            +V  I+ I   EG + G +KGL  + +K  +++G+ F+ ++   + +L L
Sbjct:    8 HQSRLPVAQAAVLALPASSQTQDLRPRLSAVDSLLCGAFAGAVAKTVIAPLDRTKIIFQVSSKRFSA------REAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYK----KLLGGDYGSQERALPPFPRLLAGSLAGTTAATLTYPLDVVRARMAVTAK-EMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTY----ETLKKLHAERTKRCQPYPHERL------VFGACAGLIGQSASYPLDVVRRRMQTAGVTGSS--------YSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLLLKL 320          
BLAST of slc25a-16 vs. Ensembl Medaka
Match: ENSORLT00000000948.2 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 129.798 bits (325), Expect = 6.342e-34
Identity = 91/342 (26.61%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  101 HCSRFILRKSEMFETVNLSNSQH-----SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEG-IGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNL 1108
            H SR  + ++ +      S +Q      S +D  + GA  G V++ V+ PLD  KI FQ+  +          +   + I C Y ++GL + W+G+ ++ ++ + ++ +QF ++E  K     L+     + +  L      L GSLAG+TA   T P DV R R A   + + Y N+ +  + I + EG+R L+RG  P++L V P  G  FF Y      L K    + K+   +   ++      + G  AG + +   YP+D++++RMQ  G   +            +V  I+ I   EG + G +KGL  + +K  +++G+ F+ ++   + +L L
Sbjct:    8 HQSRLPVAQAAVLALPASSQTQDLRPRLSAVDSLLCGAFAGAVAKTVIAPLDRTKIIFQVSSKRFSA------REAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYK----KLLGGDYGSQERALPPFPRLLAGSLAGTTAATLTYPLDVVRARMAVTAK-EMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTY----ETLKKLHAERTKRCQPYPHERL------VFGACAGLIGQSASYPLDVVRRRMQTAGVTGSS--------YSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLLLKL 320          
BLAST of slc25a-16 vs. Ensembl Medaka
Match: ENSORLT00000035929.1 (mitochondrial coenzyme A transporter SLC25A42-like [Source:NCBI gene;Acc:101167609])

HSP 1 Score: 129.798 bits (325), Expect = 6.342e-34
Identity = 91/342 (26.61%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  101 HCSRFILRKSEMFETVNLSNSQH-----SQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEG-IGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNL 1108
            H SR  + ++ +      S +Q      S +D  + GA  G V++ V+ PLD  KI FQ+  +          +   + I C Y ++GL + W+G+ ++ ++ + ++ +QF ++E  K     L+     + +  L      L GSLAG+TA   T P DV R R A   + + Y N+ +  + I + EG+R L+RG  P++L V P  G  FF Y      L K    + K+   +   ++      + G  AG + +   YP+D++++RMQ  G   +            +V  I+ I   EG + G +KGL  + +K  +++G+ F+ ++   + +L L
Sbjct:    8 HQSRLPVAQAAVLALPASSQTQDLRPRLSAVDSLLCGAFAGAVAKTVIAPLDRTKIIFQVSSKRFSA------REAFRLIYCTYLKDGLLSLWRGNSATMVRVMPYAAIQFCSHEQYK----KLLGGDYGSQERALPPFPRLLAGSLAGTTAATLTYPLDVVRARMAVTAK-EMYSNIMHVFVRISQEEGVRTLYRGFTPTILGVIPYAGITFFTY----ETLKKLHAERTKRCQPYPHERL------VFGACAGLIGQSASYPLDVVRRRMQTAGVTGSS--------YSTIVGTIREIVTKEGVVRGLYKGLSMNWLKGPVAVGISFTAFDITHDLLLKL 320          
BLAST of slc25a-16 vs. Planmine SMEST
Match: SMESG000047064.1 (SMESG000047064.1)

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 329/330 (99.70%), Postives = 329/330 (99.70%), Query Frame = 2
Query:  134 MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS 1123
            MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLF IHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS
Sbjct:    1 MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFEIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS 330          
BLAST of slc25a-16 vs. Planmine SMEST
Match: SMESG000015827.1 (SMESG000015827.1)

HSP 1 Score: 312.768 bits (800), Expect = 1.448e-104
Identity = 165/309 (53.40%), Postives = 215/309 (69.58%), Query Frame = 2
Query:  158 NSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQ 1084
              ++S  + A AGA+ GFVSRA+VQPLDV+KIR QLQVEP++    GKY GI   I CIYKEEG KA WKGH+  QI A+SFS++QF TY  C +  +    +  ST    L S+  F  GSL+G  A   TQP D+ RTRF AQGEPK Y +L +A   I++ EG   L+RG IPS+LL+APQ+G QF FYN SN V+   F      +N   + KIG++QS  SGG+AG+++K+ V+P+DI+KKRMQVQGFE+AR KFGKLH S+G ++C  VI+  EG   + KGLK +++KSFIS+GL+FSVYEQ
Sbjct:    7 TQKNSARESAFAGAASGFVSRAMVQPLDVLKIRLQLQVEPLKK-KFGKYHGIFPTICCIYKEEGFKALWKGHMCGQIHAISFSMIQFYTYT-CLIEKYKFSLQRHSTFSEKLISN--FFCGSLSGILAISLTQPLDILRTRFVAQGEPKLYRSLYHAAASIVQKEGFLTLYRGSIPSILLIAPQSGLQFLFYNFSNAVIGSIFSLFRFYENKNEL-KIGVVQSIASGGMAGALSKVLVFPLDIVKKRMQVQGFEEARKKFGKLHRSQGFIRCFGVIYREEGWTAFTKGLKPTLLKSFISIGLKFSVYEQ 310          

HSP 2 Score: 51.9878 bits (123), Expect = 3.963e-7
Identity = 57/228 (25.00%), Postives = 96/228 (42.11%), Query Frame = 2
Query:  134 MFETVNLSNSQHSQ-----IDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLIS-----ESPSTGK-SVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQG---EPKTYPNL--SNAII----MIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLT 757
            + E    S  +HS      I     G+  G ++ ++ QPLD+++ RF  Q EP        Y+ +  A   I ++EG    ++G + S +     S +QF  Y         + S     E+ +  K  V++S  +   G +AG+ + +   P D+ + R   QG     K +  L  S   I    +I + EG     +GL P+LL      G +F  Y  +  +LT
Sbjct:   98 LIEKYKFSLQRHSTFSEKLISNFFCGSLSGILAISLTQPLDILRTRFVAQGEP------KLYRSLYHAAASIVQKEGFLTLYRGSIPSILLIAPQSGLQFLFYNFSNAVIGSIFSLFRFYENKNELKIGVVQSIAS---GGMAGALSKVLVFPLDIVKKRMQVQGFEEARKKFGKLHRSQGFIRCFGVIYREEGWTAFTKGLKPTLLKSFISIGLKFSVYEQAYQLLT 316          
BLAST of slc25a-16 vs. Planmine SMEST
Match: SMESG000054493.1 (SMESG000054493.1)

HSP 1 Score: 109.768 bits (273), Expect = 6.336e-27
Identity = 90/332 (27.11%), Postives = 147/332 (44.28%), Query Frame = 2
Query:  143 TVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQ----------GEPKT--YPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGIL 1102
            + N+SN +  Q ++ ++G S G +S  V+ PLD++KIRFQ+  E        KY G+  A + I K  G    ++G + + + +       F  Y   K Y      +     K  L   +   + +L+G+    FT P  V +TR   Q            PKT  Y  + N    I KTEG+RGL++G IP L   +     QF  Y    N  ++++  K          K+   +  L G ++  +A    YP  +++ R+Q Q             V  G++  I  ++  EGI G++KGL  S+I+   + G+ F VYE +   +L
Sbjct:    2 SANISN-RTVQWEHLVSGMSAGIISTLVLHPLDLIKIRFQVN-EGTGVAIRPKYYGMVDACRRIVKVNGFSGLYQGVMPNTVGSGCAWGFYFIIYNSMKEY------QQKGNLKQELSKLEYMTMAALSGALTLAFTNPIWVVKTRLCLQYDKELFNTSKNNPKTVHYSGMINCFNQIYKTEGMRGLYKGFIPGLFGTS-HGAVQFVTYESMKNFYSQWYYRKDINT------KLNTWEYLLLGCVSKLVAASTTYPYQVVRSRLQDQH-----------RVYGGIIDVIFQLWKYEGIYGFYKGLLPSLIRVTPASGIVFVVYETMSTYLL 307          
BLAST of slc25a-16 vs. Planmine SMEST
Match: SMESG000074820.1 (SMESG000074820.1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.760e-22
Identity = 74/300 (24.67%), Postives = 134/300 (44.67%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            +AG   G VSR    PLD +K+  Q               GI  AIK +  E G+ + W+G+  + I+    S ++F  YE  K            TG   L   + F+ G++AG+TA     P +V +TR   + +   Y ++ +    +   EG++  FRG +P++L + P  G     Y    N+  K         N        I  S  SG ++    ++  YP+ ++  R ++Q   K+  K    +VS+ ++K        EG+ G+++G+  +++K   ++ + ++V+EQ 
Sbjct:  189 VAGGIAGCVSRTATAPLDRLKVTMQAHGAKAAN------HGIINAIKYMVNEGGVSSLWRGNGVNCIKIAPESAIKFLAYESYKKLIVNFTQNE--TGNVTL--GEKFVAGAMAGATAQTLIYPMEVLKTRMCLR-KSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSI-------NHDKSASTPIYVSLCSGAVSSVCGQVATYPLALV--RTKLQAMSKSDGKISMKNVSRDIIKN-------EGVLGFYRGIGPNMLKVIPAVSISYAVFEQT 461          

HSP 2 Score: 72.7886 bits (177), Expect = 1.189e-13
Identity = 46/189 (24.34%), Postives = 90/189 (47.62%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            +AGA  G  ++ ++ P++V+K R  L+         G+Y  I    K +Y  EG++ F++G++ + +  + ++ +  + YE  K  +   I+   S    +  S  +  + S+ G  AT    P  + RT+  A  +     ++ N    IIK EG+ G +RG+ P++L V P     +  +  + + L
Sbjct:  287 VAGAMAGATAQTLIYPMEVLKTRMCLR-------KSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSINHDKSASTPIYVSLCSGAVSSVCGQVATY---PLALVRTKLQAMSKSDGKISMKNVSRDIIKNEGVLGFYRGIGPNMLKVIPAVSISYAVFEQTRHFL 465          

HSP 3 Score: 69.3218 bits (168), Expect = 1.336e-12
Identity = 46/197 (23.35%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCN 1093
            KT + G +AG  +   T P D  +    A G       + NAI  ++   G+  L+RG   + + +AP++  +F  Y     ++  F  T+ +  N      + + +  ++G +AG+ A+  +YP++++K RM ++   +  S F           C K +++ EGI  +F+G   +++      G+  ++YE   N
Sbjct:  186 KTLVAGGIAGCVSRTATAPLDRLKVTMQAHGAKAANHGIINAIKYMVNEGGVSSLWRGNGVNCIKIAPESAIKFLAYESYKKLIVNF--TQNETGN------VTLGEKFVAGAMAGATAQTLIYPMEVLKTRMCLRKSGQYSSIF----------DCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKN 364          
BLAST of slc25a-16 vs. Planmine SMEST
Match: SMESG000074801.1 (SMESG000074801.1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.932e-21
Identity = 71/300 (23.67%), Postives = 140/300 (46.67%), Query Frame = 2
Query:  188 IAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQV 1087
            +AG   G VSR    PLD +K+  Q     +  +      GI   IK +  E G+ + W+G+  S  +    S ++F +YE+ K +   + +   +TG   L   + F  G+LAG+T+     P +V +TR   +   + Y ++ +    + +TEG +  FRG +P+LL + P  G     +    N+   + K+  +   L    +I +  S LSG  +    +   YP+ +++ ++Q      ++ K   + V + + K        EG  G+++G+  + +K   ++ + ++V++Q 
Sbjct:  186 VAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANL------GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNN--TTGDVTLM--ERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQ-YSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNI---YLKSNNETSQL----QIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMSDSQ-KITMVSVFRSIKK-------QEGFFGFYRGIGPNTLKVIPAVSISYAVFDQT 459          

HSP 2 Score: 56.9954 bits (136), Expect = 1.479e-8
Identity = 43/207 (20.77%), Postives = 91/207 (43.96%), Query Frame = 2
Query:  503 KTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTSVIKSFISLGLRFSVYEQVCNGILNLRDKIS 1123
            KT + G +AG  +   T P D  +    A G       + N I  +I   G+  L+RG   S   + P++  +F  Y +    + +        +N  G   + +++   +G +AG+ ++  ++P++++K RM ++       K G+      +  C K ++  EG   +F+G   +++      G+  +++E   N  L   ++ S
Sbjct:  183 KTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRI------TNNTTG--DVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLR-------KSGQYS---SIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETS 371          

HSP 3 Score: 54.6842 bits (130), Expect = 6.632e-8
Identity = 47/194 (24.23%), Postives = 87/194 (44.85%), Query Frame = 2
Query:  191 AGASGGFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIM------IIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVL 754
            AGA  G  S+ ++ P++V+K R  L+         G+Y  I    K +Y+ EG + F++G++ + +  + ++ +  + +E  K  +    +E+      V  S    L G+ +       T P  + RT+   Q  P +    S  I M      I K EG  G +RG+ P+ L V P     +  ++ + ++L
Sbjct:  285 AGALAGATSQNLIFPMEVLKTRMTLR-------KSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVS---LLSGATSSVCGQFATYPLALVRTKL--QAIPMSD---SQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 463          
The following BLAST results are available for this feature:
BLAST of slc25a-16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A193.247e-6738.66solute carrier family 25 member 19 [Source:HGNC Sy... [more]
SLC25A193.247e-6738.66solute carrier family 25 member 19 [Source:HGNC Sy... [more]
SLC25A193.247e-6738.66solute carrier family 25 member 19 [Source:HGNC Sy... [more]
SLC25A193.247e-6738.66solute carrier family 25 member 19 [Source:HGNC Sy... [more]
SLC25A193.247e-6738.66solute carrier family 25 member 19 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpo-126.479e-6238.85pep chromosome:WBcel235:IV:12283174:12285065:1 gen... [more]
hpo-126.479e-6238.85pep chromosome:WBcel235:IV:12283174:12285122:1 gen... [more]
slc-25A423.424e-2825.97SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
ant-1.11.377e-2326.06Adenine Nucleotide Translocator [Source:UniProtKB... [more]
ant-1.11.377e-2326.06Adenine Nucleotide Translocator [Source:UniProtKB... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpc11.013e-5936.34gene:FBgn0037852 transcript:FBtr0082334[more]
Tpc11.013e-5936.34gene:FBgn0037852 transcript:FBtr0082333[more]
Tpc28.669e-5234.34gene:FBgn0035078 transcript:FBtr0304800[more]
DPCoAC1.301e-2928.75gene:FBgn0067783 transcript:FBtr0344281[more]
DPCoAC1.301e-2928.75gene:FBgn0067783 transcript:FBtr0089481[more]
back to top
BLAST of slc25a-16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a193.554e-7842.99solute carrier family 25 member 19 [Source:ZFIN;Ac... [more]
slc25a422.816e-3028.57solute carrier family 25 member 42 [Source:NCBI ge... [more]
slc25a163.866e-2830.62solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
slc25a169.343e-2830.29solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
slc25a32b6.633e-2525.86solute carrier family 25 member 32b [Source:ZFIN;A... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a196.363e-7943.63solute carrier family 25 (mitochondrial thiamine p... [more]
slc25a196.628e-7943.63solute carrier family 25 (mitochondrial thiamine p... [more]
slc25a199.834e-7943.63solute carrier family 25 (mitochondrial thiamine p... [more]
cep1523.708e-3027.24centrosomal protein 152kDa [Source:Xenbase;Acc:XB-... [more]
slc25a164.430e-2629.17solute carrier family 25 member 16 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a191.892e-6940.19solute carrier family 25 (mitochondrial thiamine p... [more]
Slc25a191.892e-6940.19solute carrier family 25 (mitochondrial thiamine p... [more]
Slc25a191.215e-4040.40solute carrier family 25 (mitochondrial thiamine p... [more]
Slc25a194.368e-3240.24solute carrier family 25 (mitochondrial thiamine p... [more]
Slc25a325.480e-2627.19solute carrier family 25, member 32 [Source:MGI Sy... [more]
back to top
BLAST of slc25a-16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29RM1|TPC_BOVIN1.127e-6838.24Mitochondrial thiamine pyrophosphate carrier OS=Bo... [more]
sp|Q9DAM5|TPC_MOUSE1.324e-6840.19Mitochondrial thiamine pyrophosphate carrier OS=Mu... [more]
sp|Q5IS35|TPC_MACFA1.498e-6839.30Mitochondrial thiamine pyrophosphate carrier OS=Ma... [more]
sp|Q5NVC1|TPC_PONAB7.521e-6738.66Mitochondrial thiamine pyrophosphate carrier OS=Po... [more]
sp|Q9HC21|TPC_HUMAN1.559e-6638.66Mitochondrial thiamine pyrophosphate carrier OS=Ho... [more]
back to top
BLAST of slc25a-16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJC40.000e+0100.00Slc25a-16 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YFE85.209e-10153.40Slc25a-14 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0X3NHS23.158e-9849.68Mitochondrial thiamine pyrophosphate carrier OS=Sc... [more]
A0A1S8X4A51.107e-9748.63Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2L9W82.316e-9748.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a191.256e-4945.05solute carrier family 25 member 19 [Source:NCBI ge... [more]
slc25a421.714e-3026.89solute carrier family 25 member 42 [Source:NCBI ge... [more]
slc25a161.809e-2830.19solute carrier family 25 member 16 [Source:NCBI ge... [more]
slc25a161.809e-2830.19solute carrier family 25 member 16 [Source:NCBI ge... [more]
SLC25A458.245e-2728.62solute carrier family 25 member 45 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a161.682e-2527.27solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
ENSPMAT00000004577.12.467e-2427.33pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
slc25a41.647e-2227.59solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
slc25a23a5.203e-2224.25solute carrier family 25 member 23a [Source:ZFIN;A... [more]
SLC25A408.676e-2125.47solute carrier family 25 member 40 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPR011C_mRNA3.752e-3329.94Mitochondrial transporter; major substrates are ad... [more]
AAC34.022e-2827.95Mitochondrial inner membrane ADP/ATP translocator;... [more]
TPC11.103e-2725.64Mitochondrial membrane transporter; mediates uptak... [more]
LEU51.214e-2725.49Mitochondrial carrier protein; involved in the acc... [more]
PET93.941e-2325.72Major ADP/ATP carrier of the mitochondrial inner m... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO293919.389e-7140.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344262.778e-4030.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384532.985e-3528.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439422.812e-2827.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310583.961e-2828.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a192.787e-7842.45solute carrier family 25 member 19 [Source:NCBI ge... [more]
ENSORLT00000000947.22.059e-3427.14mitochondrial coenzyme A transporter SLC25A42-like... [more]
ENSORLT00000031788.16.342e-3426.61mitochondrial coenzyme A transporter SLC25A42-like... [more]
ENSORLT00000000948.26.342e-3426.61mitochondrial coenzyme A transporter SLC25A42-like... [more]
ENSORLT00000035929.16.342e-3426.61mitochondrial coenzyme A transporter SLC25A42-like... [more]
back to top
BLAST of slc25a-16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047064.10.000e+099.70SMESG000047064.1[more]
SMESG000015827.11.448e-10453.40SMESG000015827.1[more]
SMESG000054493.16.336e-2727.11SMESG000054493.1[more]
SMESG000074820.13.760e-2224.67SMESG000074820.1[more]
SMESG000074801.14.932e-2123.67SMESG000074801.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019037
GenBankAKN21584.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019037 ID=SMED30019037|Name=slc25a-16|organism=Schmidtea mediterranea sexual|type=transcript|length=1238bp
GAATTCTAGTATATGACATGATATATTATTACAAATGCATATTTTATTAT
CCTAAATTAGAATTTCTAGTATTAGCCTATATATTTAAATAGCGAATTTT
CATTGTTCTAGATTTATATTACGTAAATCCGAAATGTTTGAAACAGTAAA
TTTATCAAATTCACAACATAGTCAAATAGATTATGCTATAGCTGGTGCTT
CTGGTGGATTTGTGAGCAGAGCAGTTGTTCAGCCTTTAGACGTCGTAAAA
ATCAGATTTCAGTTACAAGTTGAACCAATACAAACTATCACAGACGGAAA
ATACAAGGGAATTGCACAAGCAATTAAATGCATTTATAAAGAAGAAGGTC
TCAAAGCTTTTTGGAAAGGTCATTTGTCATCACAAATACAAGCTGTCTCA
TTTAGTTTGGTTCAATTTTCTACATATGAATTATGTAAAGTTTACTTTTG
GCCATTAATTTCCGAAAGTCCATCAACTGGGAAATCGGTTTTGAAATCCA
GTAAAACATTTCTTCTTGGTAGTTTAGCTGGTTCAACCGCAACTATTTTT
ACCCAACCGTTTGATGTATTTAGAACTCGTTTTGCTGCCCAAGGAGAGCC
AAAAACCTATCCGAACCTCTCAAATGCAATAATAATGATAATAAAAACGG
AAGGGCTTAGAGGACTATTTCGAGGACTTATACCTAGTTTACTTTTAGTG
GCCCCTCAAACTGGATTTCAATTTTTCTTTTATAATTTGTCGAACAATGT
TTTGACAAAGTTTTTCAAAACAAAAGGAAAACAGGACAATCTATTCGGAA
TACATAAAATAGGTATATTACAAAGTGCACTTTCTGGTGGTATTGCGGGT
TCAATGGCGAAGATTTGTGTTTATCCTGTAGATATAATTAAAAAGCGTAT
GCAAGTCCAAGGTTTCGAAAAAGCTAGATCTAAATTTGGAAAGCTGCACG
TCTCAAAAGGAGTTGTTAAATGTATTAAAGTTATATTTTTAGTTGAAGGA
ATTGGAGGATATTTTAAAGGCCTAAAAACTTCAGTTATTAAATCTTTTAT
ATCATTAGGCTTAAGATTTTCAGTTTATGAACAAGTTTGTAATGGCATTC
TCAATCTTCGGGATAAAATAAGTTAATAACTGTATACGGTTTTATTTCGA
TTCTGAGTTCCAACGATATTTTAATTCAACTTGATTTTTTAGATTATTTA
TTTTTCGCAATTGTTTTAATAATACAGTTTAATTTTGT
back to top

protein sequence of SMED30019037-orf-1

>SMED30019037-orf-1 ID=SMED30019037-orf-1|Name=SMED30019037-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MFETVNLSNSQHSQIDYAIAGASGGFVSRAVVQPLDVVKIRFQLQVEPIQ
TITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYEL
CKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGSTATIFTQPFDVFRTRF
AAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFY
NLSNNVLTKFFKTKGKQDNLFGIHKIGILQSALSGGIAGSMAKICVYPVD
IIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIFLVEGIGGYFKGLKTS
VIKSFISLGLRFSVYEQVCNGILNLRDKIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 79..99
score: 18.35
coord: 30..44
score: 32.9
coord: 235..257
score: 29.86
coord: 179..197
score: 26.75
coord: 135..153
score: 38.57
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 8..325
e-value: 4.3E-76
score: 257.4
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 12..318
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 15..105
e-value: 3.2E-20
score: 71.9
coord: 122..209
e-value: 4.9E-21
score: 74.4
coord: 225..320
e-value: 2.3E-19
score: 69.1
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 226..321
score: 21.119
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 12..104
score: 24.937
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 120..206
score: 23.736
NoneNo IPR availablePANTHERPTHR24089:SF59MITOCHONDRIAL THIAMINE PYROPHOSPHATE CARRIERcoord: 10..322
NoneNo IPR availablePANTHERPTHR24089FAMILY NOT NAMEDcoord: 10..322