CLIP-associating protein 1

Overview
NameCLIP-associating protein 1
Smed IDSMED30019032
Length (bp)3634
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CLIP-associating protein 1 (SMED30019032) t-SNE clustered cells

Violin plots show distribution of expression levels for CLIP-associating protein 1 (SMED30019032) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CLIP-associating protein 1 (SMED30019032) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CLIP-associating protein 1 (SMED30019032) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 270.781 bits (691), Expect = 1.434e-73
Identity = 201/682 (29.47%), Postives = 341/682 (50.00%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSV--KPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK+F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP           KT  DG         +K+L +   H KN+ N         G   +++   P    ++R      PT+ S   ++   +D     +TE+L +  +       T+    +S    + SQ    L++P   DG    + +++   + S A+    R  S +       + + N + +L                N+     +P   A  YN YP +DA +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  831 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP-----------KTFQDG--------ATKLLHN---HLKNSSNTS------VGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPSMLDY----DTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKECDIVSRDGGAASPATE--GRGGSEVEGGR---TALDNKTSLL----------------NTQPPRAFPGPRARDYNPYPYSDAINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1439          

HSP 2 Score: 162.54 bits (410), Expect = 1.303e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 266.929 bits (681), Expect = 2.947e-72
Identity = 201/683 (29.43%), Postives = 341/683 (49.93%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSV--KPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP           KT  DG         +K+L +   H KN+ N         G   +++   P    ++R      PT+ S   ++   +D     +TE+L +  +       T+    +S    + SQ    L++P   DG    + +++   + S A+    R  S +       + + N + +L                N+     +P   A  YN YP +DA +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  823 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP-----------KTFQDG--------ATKLLHN---HLKNSSNTS------VGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPSMLDY----DTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKECDIVSRDGGAASPATE--GRGGSEVEGGR---TALDNKTSLL----------------NTQPPRAFPGPRARDYNPYPYSDAINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1432          

HSP 2 Score: 162.925 bits (411), Expect = 1.132e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 266.159 bits (679), Expect = 4.820e-72
Identity = 201/683 (29.43%), Postives = 341/683 (49.93%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSV--KPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP           KT  DG         +K+L +   H KN+ N         G   +++   P    ++R      PT+ S   ++   +D     +TE+L +  +       T+    +S    + SQ    L++P   DG    + +++   + S A+    R  S +       + + N + +L                N+     +P   A  YN YP +DA +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  829 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP-----------KTFQDG--------ATKLLHN---HLKNSSNTS------VGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPSMLDY----DTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKECDIVSRDGGAASPATE--GRGGSEVEGGR---TALDNKTSLL----------------NTQPPRAFPGPRARDYNPYPYSDAINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1438          

HSP 2 Score: 162.54 bits (410), Expect = 1.227e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 266.159 bits (679), Expect = 4.970e-72
Identity = 201/683 (29.43%), Postives = 341/683 (49.93%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSV--KPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP           KT  DG         +K+L +   H KN+ N         G   +++   P    ++R      PT+ S   ++   +D     +TE+L +  +       T+    +S    + SQ    L++P   DG    + +++   + S A+    R  S +       + + N + +L                N+     +P   A  YN YP +DA +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  831 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP-----------KTFQDG--------ATKLLHN---HLKNSSNTS------VGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPSMLDY----DTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKECDIVSRDGGAASPATE--GRGGSEVEGGR---TALDNKTSLL----------------NTQPPRAFPGPRARDYNPYPYSDAINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1440          

HSP 2 Score: 162.54 bits (410), Expect = 1.327e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP2 (cytoplasmic linker associated protein 2 [Source:HGNC Symbol;Acc:HGNC:17078])

HSP 1 Score: 264.618 bits (675), Expect = 8.704e-72
Identity = 206/712 (28.93%), Postives = 342/712 (48.03%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK----IMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANS--MTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHIN--QGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            ++ +E+  E+L + +S +WSE+K+GL+  QNLL++ R L+ ++LK+  E+   +F D   K+F +FL  +   I+ HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+   + P   +  S   L   V+ ++ W  E K  ++RK + ++L+ L  L+      +   LP   +      + N  + + +G  +S   M S + R       N  +P +                   TN +++ L P++   ++  M  EDI + +R  TE +Q  +   +     D N    R    +    +    P   D  A G+  +  Q  + N A+        SS R+ +Y P   S       DS SP N+                                S L + M            S              L  +D++  +L EL   N+R E+RK  L +LM L +E +   W+E FKTIL+ LL+T+ D +P IR L+L+VL+E+ +  P RF ++  LTV+K L +HKD  K VVR+AEE + V+A  +S   C+KVL  ++   D  +NL A+KM  +V++ V +  L   L  ++PGLI+  ++ ES +RKA +FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  649 MRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLA--VSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSS---MGSPLTRPTPRSPANWSSPLTSP-----------------TNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQE----DMNEPLKRDSKKDDG-DSMCGGPGMSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYNPYNYS-------DSISPFNK--------------------------------SALKEAMFDDDADQFPDDLS--------------LDHSDLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS 1280          

HSP 2 Score: 157.147 bits (396), Expect = 5.129e-38
Identity = 83/236 (35.17%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            + +  AGAVDED F   F+ +   ++ +SREL+E + +I   L  +  DW++R  ALK ++S+  +  +  + F  +LR L   L+    DLRSQVVREAC+ VA+L+ +L  + +   +A +P+L +L+PNSA++MATSG   +  I+ + H  +++  ++S   SKS   RR + + L+ +   W    LE+    L   ++KG+ DAD EAR  +R  ++G   +FP EA  +
Sbjct:   57 SKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETL 292          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058843:1 gene:WBGene00000549.1 transcript:R107.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 105.531 bits (262), Expect = 1.221e-22
Identity = 65/242 (26.86%), Postives = 113/242 (46.69%), Query Frame = 1
Query:   97 VDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNM---EEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            V +D F   F  +   E+ +  + +E + + I  L    EDW KR+  LK ++S+     ++   E+ +S L +L   L   + DLRSQ++REA +   +L          + +  +PS  + +  S ++MAT G      IV  I + ++   ++S   SK  + RR    LLE +   W+  +    LP +   ++  + DAD E R   R AF         EA+K+   +DS ++ +L
Sbjct:   16 VSKDDFLKSFEEVPKMEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHGEDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCALLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKML 257          

HSP 2 Score: 59.6918 bits (143), Expect = 1.235e-8
Identity = 37/143 (25.87%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1486 QEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFF 1914
            +E++R  SS   +EK++G+     ++    L+  ++K    VLN L  ++ ++I    L  I   ++ H   L DWL   L  L +K+ AE   + +K I  T++ I S F   +Q++  C +V D       K ++ ++ + 
Sbjct:  465 EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQI---VLESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYL 604          

HSP 3 Score: 57.3806 bits (137), Expect = 6.965e-8
Identity = 38/176 (21.59%), Postives = 90/176 (51.14%), Query Frame = 1
Query: 2968 LMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEI-RTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDS-DKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGAL--KMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIG 3483
            L+ +  ++ E +   W + F  +L+ + D +  ++ +  + ++LRVL ++  +   R  D T + + K+L +  +S D T+   A++C + +A  L     + +   +LN+   +    +L  KM+  + + +    L   ++ + P +I++ +   S +RK +++CLV +  K+G
Sbjct:  810 LLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVALRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEEKAQEPKASLVLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLG 985          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058882:1 gene:WBGene00000549.1 transcript:R107.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 105.531 bits (262), Expect = 1.221e-22
Identity = 65/242 (26.86%), Postives = 113/242 (46.69%), Query Frame = 1
Query:   97 VDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNM---EEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            V +D F   F  +   E+ +  + +E + + I  L    EDW KR+  LK ++S+     ++   E+ +S L +L   L   + DLRSQ++REA +   +L          + +  +PS  + +  S ++MAT G      IV  I + ++   ++S   SK  + RR    LLE +   W+  +    LP +   ++  + DAD E R   R AF         EA+K+   +DS ++ +L
Sbjct:   16 VSKDDFLKSFEEVPKMEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHGEDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCALLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKML 257          

HSP 2 Score: 59.6918 bits (143), Expect = 1.235e-8
Identity = 37/143 (25.87%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1486 QEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFF 1914
            +E++R  SS   +EK++G+     ++    L+  ++K    VLN L  ++ ++I    L  I   ++ H   L DWL   L  L +K+ AE   + +K I  T++ I S F   +Q++  C +V D       K ++ ++ + 
Sbjct:  465 EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQI---VLESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYL 604          

HSP 3 Score: 57.3806 bits (137), Expect = 6.965e-8
Identity = 38/176 (21.59%), Postives = 90/176 (51.14%), Query Frame = 1
Query: 2968 LMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEI-RTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDS-DKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGAL--KMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIG 3483
            L+ +  ++ E +   W + F  +L+ + D +  ++ +  + ++LRVL ++  +   R  D T + + K+L +  +S D T+   A++C + +A  L     + +   +LN+   +    +L  KM+  + + +    L   ++ + P +I++ +   S +RK +++CLV +  K+G
Sbjct:  810 LLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVALRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEEKAQEPKASLVLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLG 985          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058849:1 gene:WBGene00000549.1 transcript:R107.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 105.531 bits (262), Expect = 1.235e-22
Identity = 65/242 (26.86%), Postives = 113/242 (46.69%), Query Frame = 1
Query:   97 VDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNM---EEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            V +D F   F  +   E+ +  + +E + + I  L    EDW KR+  LK ++S+     ++   E+ +S L +L   L   + DLRSQ++REA +   +L          + +  +PS  + +  S ++MAT G      IV  I + ++   ++S   SK  + RR    LLE +   W+  +    LP +   ++  + DAD E R   R AF         EA+K+   +DS ++ +L
Sbjct:   16 VSKDDFLKSFEEVPKMEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHGEDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCALLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKML 257          

HSP 2 Score: 59.6918 bits (143), Expect = 1.334e-8
Identity = 37/143 (25.87%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1486 QEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFF 1914
            +E++R  SS   +EK++G+     ++    L+  ++K    VLN L  ++ ++I    L  I   ++ H   L DWL   L  L +K+ AE   + +K I  T++ I S F   +Q++  C +V D       K ++ ++ + 
Sbjct:  465 EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQI---VLESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYL 604          

HSP 3 Score: 56.6102 bits (135), Expect = 1.111e-7
Identity = 41/180 (22.78%), Postives = 94/180 (52.22%), Query Frame = 1
Query: 2968 LMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEI-RTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDS-DKTVVRAAEECSQVMARCLS----QNLCMKVLSEVLNDN--DCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIG 3483
            L+ +  ++ E +   W + F  +L+ + D +  ++ +  + ++LRVL ++  +   R  D T + + K+L +  +S D T+   A++C + +A  L      N+   +L+E L +   + + +L  LKM+  + + +    L   ++ + P +I++ +   S +RK +++CLV +  K+G
Sbjct:  810 LLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVALRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEYLQEKAQEPKASL-VLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLG 988          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058882:1 gene:WBGene00000549.1 transcript:R107.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 105.531 bits (262), Expect = 1.235e-22
Identity = 65/242 (26.86%), Postives = 113/242 (46.69%), Query Frame = 1
Query:   97 VDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNM---EEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            V +D F   F  +   E+ +  + +E + + I  L    EDW KR+  LK ++S+     ++   E+ +S L +L   L   + DLRSQ++REA +   +L          + +  +PS  + +  S ++MAT G      IV  I + ++   ++S   SK  + RR    LLE +   W+  +    LP +   ++  + DAD E R   R AF         EA+K+   +DS ++ +L
Sbjct:   16 VSKDDFLKSFEEVPKMEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHGEDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCALLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKML 257          

HSP 2 Score: 59.6918 bits (143), Expect = 1.334e-8
Identity = 37/143 (25.87%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1486 QEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFF 1914
            +E++R  SS   +EK++G+     ++    L+  ++K    VLN L  ++ ++I    L  I   ++ H   L DWL   L  L +K+ AE   + +K I  T++ I S F   +Q++  C +V D       K ++ ++ + 
Sbjct:  465 EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQI---VLESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYL 604          

HSP 3 Score: 56.6102 bits (135), Expect = 1.111e-7
Identity = 41/180 (22.78%), Postives = 94/180 (52.22%), Query Frame = 1
Query: 2968 LMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEI-RTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDS-DKTVVRAAEECSQVMARCLS----QNLCMKVLSEVLNDN--DCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIG 3483
            L+ +  ++ E +   W + F  +L+ + D +  ++ +  + ++LRVL ++  +   R  D T + + K+L +  +S D T+   A++C + +A  L      N+   +L+E L +   + + +L  LKM+  + + +    L   ++ + P +I++ +   S +RK +++CLV +  K+G
Sbjct:  810 LLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVALRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEYLQEKAQEPKASL-VLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLG 988          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-3 (pep chromosome:WBcel235:III:9186556:9191127:-1 gene:WBGene00013847.1 transcript:ZC84.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-3)

HSP 1 Score: 93.2041 bits (230), Expect = 6.653e-19
Identity = 64/237 (27.00%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  112 FYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV---SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            F   F  +    + ++ +L+     +   L  +SEDW KR   LKT++S+        +    I++L QL    +  + DLRSQV+REA +  +++     I    + +  +   +S +  S +IMATS  T    IV  + + +V   +SS   SK  S RR  + LLE + S W   + ++ +  +   ++  + DAD E RA  R AF        +EA+ + + +D  ++ +L
Sbjct:   19 FTKIFEDVPKVPITSAVDLRNKFDAVRIILSNSSEDWNKRQTQLKTVRSLVIHGEKVVDRPTMIAHLVQLLGCFELAVKDLRSQVLREAAITCSFIVSKYGIETHSIGEDILVPAMSQVAVSTKIMATSASTLTEFIVEYVQTRQVFTILSSFSTSKDKSQRRQLAALLEIVISKWSDRIKKQIMRQICELIKSAINDADSETRAAGRRAFAKLDEMHSEEADALYLELDHSKQKML 255          

HSP 2 Score: 59.6918 bits (143), Expect = 1.352e-8
Identity = 45/210 (21.43%), Postives = 104/210 (49.52%), Query Frame = 1
Query: 2884 TLPPNDMI----VTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEI-RTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDS-DKTVVRAAEECSQVMARCLSQNLCMKVLSEVLND---NDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGE 3486
            TLPP+ +     V  L +    ++  +++++ +  +  ++ +     W + +  +L+ L + +  +  E  + + LR+L ++      +  D T + V K+L +  ++ D T   A E+C + +A  L  +  + +   +LN    +D R +L  LKM+  + + +P   L + ++ + P +I+  +   S +RK  ++CLV +  ++GE
Sbjct:  742 TLPPDTLEKIQNVQDLLQKMRSSENADEQESAISSIYMMICDGGFGVWEQCYAKLLLNLFEILSKSRSENNKKMCLRILGKMCTAQAAKLFDSTEMAVCKVLDAAVNTNDATTALAVEDCLRTLATHLPLSNIINIAKVILNQEPIDDERASL-VLKMVTRLFEELPAEELNNIVDDITPTIIKAYQSTSSTVRKTVVYCLVAMVNRVGE 950          

HSP 3 Score: 58.5362 bits (140), Expect = 3.585e-8
Identity = 39/158 (24.68%), Postives = 75/158 (47.47%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKS----KIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV 1926
            I+  +   ++L++  S   SEKK+G+     ++    LN +++K     LN L +D  +    +I+ +F       +  H   L +WL   L  L +++AAETL + +K I  TLN I   F    Q+   C ++ D       K ++ ++ +  +++
Sbjct:  432 IEAHDKVSQVLKECCSSSVSEKKEGIKKLLPIVADTSLNPIEIKNIGNCLNRLLSDASNTMVLEIYSIF-------VRTHSSRLSEWLRLALAKLFARKAAETLPNTKKQIGHTLNVILECFNAHHQLVTVCELMCDPIHLMVPKARVVLLEYLTSLL 582          
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Match: chb (gene:FBgn0021760 transcript:FBtr0089460)

HSP 1 Score: 125.561 bits (314), Expect = 1.446e-28
Identity = 73/249 (29.32%), Postives = 140/249 (56.22%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSS-SFSNMEEFISY-LRQLQVPLQSCL-SDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKE 822
            AGAV  + F + F  +    + +++++ ++  +++  +   + DWEKRV ALK ++++   S+    +F++  L++L +     L  +LRSQV+REAC+ +AY++  L+ + +    + +  LI+LI NSA+++A++    L  I+   H+ K+L I+  +   SKS   R    +L+  +   W    LE+    L++ L+K + DAD +AR  SR A+  F  +FP+ A+++   +D   +  LE+E
Sbjct:  290 AGAVTMESFESSFEVVPQLNIFHAKDMDDIYKQVLVIISDKNADWEKRVDALKKIRALLILSYHTQPQFVAVQLKELSLSFVDILKEELRSQVIREACITIAYMSKTLRNKLDAFCWSILEHLINLIQNSAKVIASASTIALKYIIKYTHAPKLLKIYTDTLNQSKSKDIRSTLCELMVLLFEEWQTKALERNATVLRDTLKKSIGDADCDARRHSRYAYWAFRRHFPELADQIYGTLDIAAQRALERE 538          

HSP 2 Score: 103.219 bits (256), Expect = 1.117e-21
Identity = 67/244 (27.46%), Postives = 123/244 (50.41%), Query Frame = 1
Query: 1471 PSENTQEILRQLSSVHWSEKKDGLINF-QNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV--IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSK 2193
            P ++ + I++  +S HWSE+KDGLI+  Q L   ++L    LK  +++   +F DT +K++ LFL  + +LI  H   L +WL+ LL  L +K   + L S    I +TL  +   FP ++Q+++  R++ DS Q    K +++I+ F   +       S        +   TV  + +   + K  E+R  + + L+ L+NL+   M  +   LP V        ++ SA   ++S ++ +S+
Sbjct:  836 PFDDIETIIQFCASTHWSERKDGLISLTQYLADGKELTQQQLKCVLDMFRKMFMDTHTKVYSLFLDTVTELILVHANELHEWLFILLTRLFNKLGTDLLNSMHSKIWKTLQVVHEYFPTQLQLKELFRIISDSTQTPTTKTRIAILRFLTDLANTYCKSSDFPSDQSQACERTVLKLAQLAADQKSMELRSQARSCLVALYNLNTPQMTLLLADLPKV--------YQDSARSCIHSHMRRQSQ 1071          

HSP 3 Score: 63.5438 bits (153), Expect = 1.363e-9
Identity = 47/185 (25.41%), Postives = 98/185 (52.97%), Query Frame = 1
Query: 2938 NQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKT--MPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGE 3486
            +Q  E  +  L  L   ++    E  N+ F++I+  LL+ ++    ++    L VL ++ ++  M   +  F  L +LKI+  ++ S K  +R  +     +A  L  +L + +++ V+   +   NL A+K+LLEV ++    +  + L+ + P L R+++  +S +RKA++FC+V++   +GE
Sbjct: 1263 DQPVELLQTSLTNLGICIKGGNCELPNKHFRSIMRMLLNILEAEHTDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQCYQHS-KEALRDIDSMIPRIAPSLPLDLSINIVNPVIATGEFPTNLCAIKILLEVTEHHGSEITDAHLDIVFPNLARSADDTQSMVRKAAVFCIVKLYFVLGE 1446          
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Match: chb (gene:FBgn0021760 transcript:FBtr0089461)

HSP 1 Score: 125.561 bits (314), Expect = 1.446e-28
Identity = 73/249 (29.32%), Postives = 140/249 (56.22%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSS-SFSNMEEFISY-LRQLQVPLQSCL-SDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKE 822
            AGAV  + F + F  +    + +++++ ++  +++  +   + DWEKRV ALK ++++   S+    +F++  L++L +     L  +LRSQV+REAC+ +AY++  L+ + +    + +  LI+LI NSA+++A++    L  I+   H+ K+L I+  +   SKS   R    +L+  +   W    LE+    L++ L+K + DAD +AR  SR A+  F  +FP+ A+++   +D   +  LE+E
Sbjct:  290 AGAVTMESFESSFEVVPQLNIFHAKDMDDIYKQVLVIISDKNADWEKRVDALKKIRALLILSYHTQPQFVAVQLKELSLSFVDILKEELRSQVIREACITIAYMSKTLRNKLDAFCWSILEHLINLIQNSAKVIASASTIALKYIIKYTHAPKLLKIYTDTLNQSKSKDIRSTLCELMVLLFEEWQTKALERNATVLRDTLKKSIGDADCDARRHSRYAYWAFRRHFPELADQIYGTLDIAAQRALERE 538          

HSP 2 Score: 103.219 bits (256), Expect = 1.117e-21
Identity = 67/244 (27.46%), Postives = 123/244 (50.41%), Query Frame = 1
Query: 1471 PSENTQEILRQLSSVHWSEKKDGLINF-QNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV--IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSK 2193
            P ++ + I++  +S HWSE+KDGLI+  Q L   ++L    LK  +++   +F DT +K++ LFL  + +LI  H   L +WL+ LL  L +K   + L S    I +TL  +   FP ++Q+++  R++ DS Q    K +++I+ F   +       S        +   TV  + +   + K  E+R  + + L+ L+NL+   M  +   LP V        ++ SA   ++S ++ +S+
Sbjct:  836 PFDDIETIIQFCASTHWSERKDGLISLTQYLADGKELTQQQLKCVLDMFRKMFMDTHTKVYSLFLDTVTELILVHANELHEWLFILLTRLFNKLGTDLLNSMHSKIWKTLQVVHEYFPTQLQLKELFRIISDSTQTPTTKTRIAILRFLTDLANTYCKSSDFPSDQSQACERTVLKLAQLAADQKSMELRSQARSCLVALYNLNTPQMTLLLADLPKV--------YQDSARSCIHSHMRRQSQ 1071          

HSP 3 Score: 63.5438 bits (153), Expect = 1.363e-9
Identity = 47/185 (25.41%), Postives = 98/185 (52.97%), Query Frame = 1
Query: 2938 NQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKT--MPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGE 3486
            +Q  E  +  L  L   ++    E  N+ F++I+  LL+ ++    ++    L VL ++ ++  M   +  F  L +LKI+  ++ S K  +R  +     +A  L  +L + +++ V+   +   NL A+K+LLEV ++    +  + L+ + P L R+++  +S +RKA++FC+V++   +GE
Sbjct: 1263 DQPVELLQTSLTNLGICIKGGNCELPNKHFRSIMRMLLNILEAEHTDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQCYQHS-KEALRDIDSMIPRIAPSLPLDLSINIVNPVIATGEFPTNLCAIKILLEVTEHHGSEITDAHLDIVFPNLARSADDTQSMVRKAAVFCIVKLYFVLGE 1446          
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Match: chb (gene:FBgn0021760 transcript:FBtr0089462)

HSP 1 Score: 125.561 bits (314), Expect = 1.446e-28
Identity = 73/249 (29.32%), Postives = 140/249 (56.22%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSS-SFSNMEEFISY-LRQLQVPLQSCL-SDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKE 822
            AGAV  + F + F  +    + +++++ ++  +++  +   + DWEKRV ALK ++++   S+    +F++  L++L +     L  +LRSQV+REAC+ +AY++  L+ + +    + +  LI+LI NSA+++A++    L  I+   H+ K+L I+  +   SKS   R    +L+  +   W    LE+    L++ L+K + DAD +AR  SR A+  F  +FP+ A+++   +D   +  LE+E
Sbjct:  290 AGAVTMESFESSFEVVPQLNIFHAKDMDDIYKQVLVIISDKNADWEKRVDALKKIRALLILSYHTQPQFVAVQLKELSLSFVDILKEELRSQVIREACITIAYMSKTLRNKLDAFCWSILEHLINLIQNSAKVIASASTIALKYIIKYTHAPKLLKIYTDTLNQSKSKDIRSTLCELMVLLFEEWQTKALERNATVLRDTLKKSIGDADCDARRHSRYAYWAFRRHFPELADQIYGTLDIAAQRALERE 538          

HSP 2 Score: 103.219 bits (256), Expect = 1.117e-21
Identity = 67/244 (27.46%), Postives = 123/244 (50.41%), Query Frame = 1
Query: 1471 PSENTQEILRQLSSVHWSEKKDGLINF-QNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV--IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSK 2193
            P ++ + I++  +S HWSE+KDGLI+  Q L   ++L    LK  +++   +F DT +K++ LFL  + +LI  H   L +WL+ LL  L +K   + L S    I +TL  +   FP ++Q+++  R++ DS Q    K +++I+ F   +       S        +   TV  + +   + K  E+R  + + L+ L+NL+   M  +   LP V        ++ SA   ++S ++ +S+
Sbjct:  836 PFDDIETIIQFCASTHWSERKDGLISLTQYLADGKELTQQQLKCVLDMFRKMFMDTHTKVYSLFLDTVTELILVHANELHEWLFILLTRLFNKLGTDLLNSMHSKIWKTLQVVHEYFPTQLQLKELFRIISDSTQTPTTKTRIAILRFLTDLANTYCKSSDFPSDQSQACERTVLKLAQLAADQKSMELRSQARSCLVALYNLNTPQMTLLLADLPKV--------YQDSARSCIHSHMRRQSQ 1071          

HSP 3 Score: 63.5438 bits (153), Expect = 1.363e-9
Identity = 47/185 (25.41%), Postives = 98/185 (52.97%), Query Frame = 1
Query: 2938 NQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKT--MPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGE 3486
            +Q  E  +  L  L   ++    E  N+ F++I+  LL+ ++    ++    L VL ++ ++  M   +  F  L +LKI+  ++ S K  +R  +     +A  L  +L + +++ V+   +   NL A+K+LLEV ++    +  + L+ + P L R+++  +S +RKA++FC+V++   +GE
Sbjct: 1263 DQPVELLQTSLTNLGICIKGGNCELPNKHFRSIMRMLLNILEAEHTDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQCYQHS-KEALRDIDSMIPRIAPSLPLDLSINIVNPVIATGEFPTNLCAIKILLEVTEHHGSEITDAHLDIVFPNLARSADDTQSMVRKAAVFCIVKLYFVLGE 1446          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp1a (cytoplasmic linker associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-081104-520])

HSP 1 Score: 261.536 bits (667), Expect = 8.860e-71
Identity = 200/707 (28.29%), Postives = 343/707 (48.51%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPN----YDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSS 3567
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S++ L+ ++LK+  E+   +F D  SK+F +FL  +   +  H++ L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P   +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP          F+  A   L++ LK  S     +S  +     P                     T+R      PT+ S   ++     + +  +TE++ +  +       T+  +S+S    Y SQ    L++P   DG  +     +     S A   ++  +          + + N + +L    +P  R+         A   Y +    YD S       +D      D        + + L    P GF            D++  +L EL   N+R E+RK  L++L+ + RE+++  W+E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +  +L  L+ SK +LL LYI++  ++
Sbjct:  833 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVTVHREDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPGDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQVVLISLFELNTPEFTMLLGALP--------KTFQDGATKLLHNHLKNSSNTSNVSSPSNTMGRTPARHP-----------------TSRTSPLTSPTNCSHGGLSP----SMLEYDTENMNSDEIFSSLRGVTEAIQSFS----YRSQ--EDLNEPIRRDGKKDDATGKEAASPGSDARLGLDVVEGGR-------TALDNKTSLLN---TPSPRSFAGPRSREFAPYGYGDTITAYDKSALKEAVFDDDVEQFRDCRRQDCGENKMVL----PKGFS----------PDLVADLLKELSNHNERVEERKGALIELLKITREDSLAVWDEHFKTILLLLLETLGDKDHTIRALALRVLKEILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTADYPINLAAIKMQTKVVERITKESLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPHLAQLTGSKMKLLNLYIKRAQTT 1478          

HSP 2 Score: 162.54 bits (410), Expect = 7.614e-40
Identity = 84/251 (33.47%), Postives = 150/251 (59.76%), Query Frame = 1
Query:   76 NQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            + A AGA+DE+ F   F  +   ++ +S+EL++ + +I   L  + +DWE RV ALK ++S+  +  +  E FI  LR L+   +    DLRSQVVREAC+ + +L+ +L  + +   ++ MP+L++L+PNSA++MATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  287 DGASAGALDEEDFIKAFEDVPAVQIYSSKELEDSLNKIREILSDDKQDWEHRVTALKKMRSLLMAGATEHEGFIQQLRLLEGAFKMSAKDLRSQVVREACITLGHLSSLLGNKFDHGAESIMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIPIITSNCTSKSVAVRRRCYEFLDLLLQEWQTHTLERHVAVLTETIKKGIHDADSEARSVARKCYWGFHGHFSREAEHLFQALESTYQKALQSHL 537          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:404604])

HSP 1 Score: 166.392 bits (420), Expect = 4.058e-41
Identity = 86/199 (43.22%), Postives = 132/199 (66.33%), Query Frame = 1
Query: 2896 NDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++++  +L EL   ++R E+RKA L +LM L+RE  +  W+E FKTIL+ LL+T+ D +  IR L+LRVL+E+    P RF ++  LT++K L +HKD  K VVRAAEE + ++A  +S + C+KVL  ++   D  +NL A+KML +V+  +P+  L+  L  +VPGLI+  ++ ES +RKA +FCLV I   IGE +
Sbjct: 1012 SEVVAELLKELSNHSERVEERKAALCELMRLIRETQLHVWDEHFKTILLLLLETLGDGEHVIRALALRVLKEILNRQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEEAASMLATSISPDQCIKVLCPIIQSADYPINLAAIKMLTKVIDRLPKEGLIQMLPEIVPGLIQGYDNSESSVRKACVFCLVAIYAVIGEDL 1210          

HSP 2 Score: 150.984 bits (380), Expect = 2.377e-36
Identity = 80/231 (34.63%), Postives = 134/231 (58.01%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            AGAVDE+ F   F+ +   ++ ++R+L++ + +I   L  +  DW+ R  ALK ++S+  +  ++ + F  +LR L    +    DLRSQVVREAC+ VAYL+ +L  + +   +  +P L +LIPN A++MATSG   + II+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+    L  +++KG+ DAD EAR  +R A+ G   +FP EA  +
Sbjct:   56 AGAVDEEDFIKAFTDVPTVQIYSTRDLEDNLNKIREVLSDDKHDWDHRANALKKIRSLLVAGATDYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAYLSTLLGNKFDHGAEGIVPVLFNLIPNCAKVMATSGTAAIRIIIRHTHVPRLIPLIASNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHAAVLVESIKKGIRDADAEARVEARKAYWGLRAHFPGEAESL 286          

HSP 3 Score: 127.487 bits (319), Expect = 4.830e-29
Identity = 67/217 (30.88%), Postives = 119/217 (54.84%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L + +S +WSE+K+GL+  Q LL++ R L+ ++LK+  E+   +F D  SK+F +FL  +   I  HK+ L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+ + + P   +      L   V+ I+ W  E K  ++RK + ++L+ L  L+      +   LP
Sbjct:  620 MRQTEDVAEVLNRCASANWSERKEGLMGLQALLKNHRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIAVHKEDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEPQDFVNTGETRL--AVSRIITWTTEPKSSDVRKAAQSVLISLFQLNTPEFTMLLGALP 834          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:404604])

HSP 1 Score: 166.392 bits (420), Expect = 4.120e-41
Identity = 86/199 (43.22%), Postives = 132/199 (66.33%), Query Frame = 1
Query: 2896 NDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++++  +L EL   ++R E+RKA L +LM L+RE  +  W+E FKTIL+ LL+T+ D +  IR L+LRVL+E+    P RF ++  LT++K L +HKD  K VVRAAEE + ++A  +S + C+KVL  ++   D  +NL A+KML +V+  +P+  L+  L  +VPGLI+  ++ ES +RKA +FCLV I   IGE +
Sbjct: 1050 SEVVAELLKELSNHSERVEERKAALCELMRLIRETQLHVWDEHFKTILLLLLETLGDGEHVIRALALRVLKEILNRQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEEAASMLATSISPDQCIKVLCPIIQSADYPINLAAIKMLTKVIDRLPKEGLIQMLPEIVPGLIQGYDNSESSVRKACVFCLVAIYAVIGEDL 1248          

HSP 2 Score: 150.984 bits (380), Expect = 2.564e-36
Identity = 80/231 (34.63%), Postives = 134/231 (58.01%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            AGAVDE+ F   F+ +   ++ ++R+L++ + +I   L  +  DW+ R  ALK ++S+  +  ++ + F  +LR L    +    DLRSQVVREAC+ VAYL+ +L  + +   +  +P L +LIPN A++MATSG   + II+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+    L  +++KG+ DAD EAR  +R A+ G   +FP EA  +
Sbjct:   63 AGAVDEEDFIKAFTDVPTVQIYSTRDLEDNLNKIREVLSDDKHDWDHRANALKKIRSLLVAGATDYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAYLSTLLGNKFDHGAEGIVPVLFNLIPNCAKVMATSGTAAIRIIIRHTHVPRLIPLIASNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHAAVLVESIKKGIRDADAEARVEARKAYWGLRAHFPGEAESL 293          

HSP 3 Score: 115.931 bits (289), Expect = 1.787e-25
Identity = 67/237 (28.27%), Postives = 119/237 (50.21%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK--------------------IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L + +S +WSE+K+GL+  Q LL++ R L+ ++LK+  E+   +F D  SK                    +F +FL  +   I  HK+ L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+ + + P   +      L   V+ I+ W  E K  ++RK + ++L+ L  L+      +   LP
Sbjct:  638 MRQTEDVAEVLNRCASANWSERKEGLMGLQALLKNHRTLSRVELKRLCEIFTRMFADPHSKRDPRGFGTVESGISSASFKRVFSMFLETLVDFIAVHKEDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEPQDFVNTGETRL--AVSRIITWTTEPKSSDVRKAAQSVLISLFQLNTPEFTMLLGALP 872          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:404604])

HSP 1 Score: 165.622 bits (418), Expect = 8.316e-41
Identity = 86/199 (43.22%), Postives = 132/199 (66.33%), Query Frame = 1
Query: 2896 NDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++++  +L EL   ++R E+RKA L +LM L+RE  +  W+E FKTIL+ LL+T+ D +  IR L+LRVL+E+    P RF ++  LT++K L +HKD  K VVRAAEE + ++A  +S + C+KVL  ++   D  +NL A+KML +V+  +P+  L+  L  +VPGLI+  ++ ES +RKA +FCLV I   IGE +
Sbjct: 1238 SEVVAELLKELSNHSERVEERKAALCELMRLIRETQLHVWDEHFKTILLLLLETLGDGEHVIRALALRVLKEILNRQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEEAASMLATSISPDQCIKVLCPIIQSADYPINLAAIKMLTKVIDRLPKEGLIQMLPEIVPGLIQGYDNSESSVRKACVFCLVAIYAVIGEDL 1436          

HSP 2 Score: 151.754 bits (382), Expect = 1.985e-36
Identity = 80/231 (34.63%), Postives = 134/231 (58.01%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            AGAVDE+ F   F+ +   ++ ++R+L++ + +I   L  +  DW+ R  ALK ++S+  +  ++ + F  +LR L    +    DLRSQVVREAC+ VAYL+ +L  + +   +  +P L +LIPN A++MATSG   + II+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+    L  +++KG+ DAD EAR  +R A+ G   +FP EA  +
Sbjct:  295 AGAVDEEDFIKAFTDVPTVQIYSTRDLEDNLNKIREVLSDDKHDWDHRANALKKIRSLLVAGATDYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAYLSTLLGNKFDHGAEGIVPVLFNLIPNCAKVMATSGTAAIRIIIRHTHVPRLIPLIASNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHAAVLVESIKKGIRDADAEARVEARKAYWGLRAHFPGEAESL 525          

HSP 3 Score: 127.102 bits (318), Expect = 6.769e-29
Identity = 67/217 (30.88%), Postives = 119/217 (54.84%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L + +S +WSE+K+GL+  Q LL++ R L+ ++LK+  E+   +F D  SK+F +FL  +   I  HK+ L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+ + + P   +      L   V+ I+ W  E K  ++RK + ++L+ L  L+      +   LP
Sbjct:  846 MRQTEDVAEVLNRCASANWSERKEGLMGLQALLKNHRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIAVHKEDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEPQDFVNTGETRL--AVSRIITWTTEPKSSDVRKAAQSVLISLFQLNTPEFTMLLGALP 1060          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp1a (cytoplasmic linker associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-081104-520])

HSP 1 Score: 163.696 bits (413), Expect = 4.153e-40
Identity = 83/198 (41.92%), Postives = 130/198 (65.66%), Query Frame = 1
Query: 2899 DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            D++  +L EL   N+R E+RK  L++L+ + RE+++  W+E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct: 1299 DLVADLLKELSNHNERVEERKGALIELLKITREDSLAVWDEHFKTILLLLLETLGDKDHTIRALALRVLKEILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTADYPINLAAIKMQTKVVERITKESLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEEL 1496          

HSP 2 Score: 162.925 bits (411), Expect = 7.421e-40
Identity = 84/251 (33.47%), Postives = 150/251 (59.76%), Query Frame = 1
Query:   76 NQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            + A AGA+DE+ F   F  +   ++ +S+EL++ + +I   L  + +DWE RV ALK ++S+  +  +  E FI  LR L+   +    DLRSQVVREAC+ + +L+ +L  + +   ++ MP+L++L+PNSA++MATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  289 DGASAGALDEEDFIKAFEDVPAVQIYSSKELEDSLNKIREILSDDKQDWEHRVTALKKMRSLLMAGATEHEGFIQQLRLLEGAFKMSAKDLRSQVVREACITLGHLSSLLGNKFDHGAESIMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIPIITSNCTSKSVAVRRRCYEFLDLLLQEWQTHTLERHVAVLTETIKKGIHDADSEARSVARKCYWGFHGHFSREAEHLFQALESTYQKALQSHL 539          

HSP 3 Score: 122.094 bits (305), Expect = 2.214e-27
Identity = 66/218 (30.28%), Postives = 119/218 (54.59%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S++ L+ ++LK+  E+   +F D  SK +F +FL  +   +  H++ L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P   +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  841 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFVTVHREDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPGDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQVVLISLFELNTPEFTMLLGALP 1056          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp1 (CLIP associating protein 1 [Source:MGI Symbol;Acc:MGI:1923957])

HSP 1 Score: 270.781 bits (691), Expect = 1.023e-73
Identity = 201/680 (29.56%), Postives = 340/680 (50.00%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK+F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP           KT  DG         +K+L +   H KN+ N G  +  +      S  P    ++R      PT+ S   ++   +D     +TE+L +  +       T+    +S    + SQ    L++P   DG  + + +++   + S A+    R  S +         + N + +L                N+     +P   A  YN YP +D  +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  812 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP-----------KTFQDG--------ATKLLHN---HLKNSSNTGVGSPSNTIGRTPSRHP----SSRTSPLTSPTNCSHGGLSPSMLDY----DTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKDCDIVSRDGGAASPATE--GRGGSEIEGGRM---ALDNKTSLL----------------NTQPPRAFPGPRAREYNPYPYSDTINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1420          

HSP 2 Score: 162.155 bits (409), Expect = 1.067e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp1 (CLIP associating protein 1 [Source:MGI Symbol;Acc:MGI:1923957])

HSP 1 Score: 267.314 bits (682), Expect = 6.072e-73
Identity = 201/681 (29.52%), Postives = 340/681 (49.93%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP           KT  DG         +K+L +   H KN+ N G  +  +      S  P    ++R      PT+ S   ++   +D     +TE+L +  +       T+    +S    + SQ    L++P   DG  + + +++   + S A+    R  S +         + N + +L                N+     +P   A  YN YP +D  +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  596 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP-----------KTFQDG--------ATKLLHN---HLKNSSNTGVGSPSNTIGRTPSRHP----SSRTSPLTSPTNCSHGGLSPSMLDY----DTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKDCDIVSRDGGAASPATE--GRGGSEIEGGRM---ALDNKTSLL----------------NTQPPRAFPGPRAREYNPYPYSDTINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1205          

HSP 2 Score: 162.54 bits (410), Expect = 7.625e-40
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:   62 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 308          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp2 (CLIP associating protein 2 [Source:MGI Symbol;Acc:MGI:1923749])

HSP 1 Score: 267.314 bits (682), Expect = 7.507e-73
Identity = 207/712 (29.07%), Postives = 341/712 (47.89%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK----IMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANS--MTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHIN--QGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            ++ +E+  E+L + +S +WSE+K+GL+  QNLL++ R L+ ++LK+  E+   +F D   K+F +FL  +   I+ HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+   + P      S   L   V+ ++ W  E K  ++RK + ++L+ L  L+      +   LP   +      + N  + + +G  +S   M S + R       N  +P +                   TN +++ L P++   ++  M  EDI + +R  TE +Q  +     +   +      R  P      T  S P   D  A G+  +  Q  + N A+        SS R+ +Y P   S       DS SP N+                                S L + M            S              L  +D++  +L EL   N+R E+RK  L +LM L +E +   W+E FKTIL+ LL+T+ D +P IR L+L+VL+E+ +  P RF ++  LTV+K L +HKD  K VVR+AEE + V+A  +S   C+KVL  ++   D  +NL A+KM  +V++ V +  L   L  ++PGLI+  ++ ES +RKA +FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  663 MRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDFTNSSETRLA--VSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSS---MGSPLTRPTPRSPANWSSPLTSP-----------------TNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFS-----FRSQEDMSEPVRRDPKKEDGDTICSGPGMSDPRAGGDAADGSQPALDNKASLLHSMPLHSSPRSRDYNPYNYS-------DSISPFNK--------------------------------SALKEAMFDDDADQFPDDLS--------------LDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNMLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS 1294          

HSP 2 Score: 157.918 bits (398), Expect = 2.190e-38
Identity = 83/236 (35.17%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            + +  AGAVDED F   F+ +   ++ +SREL+E + +I   L  +  DW++R  ALK ++S+  +  +  + F  +LR L   L+    DLRSQVVREAC+ VA+L+ +L  + +   +A +P+L +L+PNSA++MATSG   +  I+ + H  +++  ++S   SKS   RR + + L+ +   W    LE+    L   ++KG+ DAD EAR  +R  ++G   +FP EA  +
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSVQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETL 298          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp2 (CLIP associating protein 2 [Source:MGI Symbol;Acc:MGI:1923749])

HSP 1 Score: 266.929 bits (681), Expect = 1.239e-72
Identity = 207/712 (29.07%), Postives = 341/712 (47.89%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK----IMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANS--MTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHIN--QGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            ++ +E+  E+L + +S +WSE+K+GL+  QNLL++ R L+ ++LK+  E+   +F D   K+F +FL  +   I+ HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+   + P      S   L   V+ ++ W  E K  ++RK + ++L+ L  L+      +   LP   +      + N  + + +G  +S   M S + R       N  +P +                   TN +++ L P++   ++  M  EDI + +R  TE +Q  +     +   +      R  P      T  S P   D  A G+  +  Q  + N A+        SS R+ +Y P   S       DS SP N+                                S L + M            S              L  +D++  +L EL   N+R E+RK  L +LM L +E +   W+E FKTIL+ LL+T+ D +P IR L+L+VL+E+ +  P RF ++  LTV+K L +HKD  K VVR+AEE + V+A  +S   C+KVL  ++   D  +NL A+KM  +V++ V +  L   L  ++PGLI+  ++ ES +RKA +FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  660 MRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDFTNSSETRLA--VSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSS---MGSPLTRPTPRSPANWSSPLTSP-----------------TNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFS-----FRSQEDMSEPVRRDPKKEDGDTICSGPGMSDPRAGGDAADGSQPALDNKASLLHSMPLHSSPRSRDYNPYNYS-------DSISPFNK--------------------------------SALKEAMFDDDADQFPDDLS--------------LDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNMLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS 1291          

HSP 2 Score: 157.532 bits (397), Expect = 2.775e-38
Identity = 83/236 (35.17%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            + +  AGAVDED F   F+ +   ++ +SREL+E + +I   L  +  DW++R  ALK ++S+  +  +  + F  +LR L   L+    DLRSQVVREAC+ VA+L+ +L  + +   +A +P+L +L+PNSA++MATSG   +  I+ + H  +++  ++S   SKS   RR + + L+ +   W    LE+    L   ++KG+ DAD EAR  +R  ++G   +FP EA  +
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSVQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETL 298          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp1 (CLIP associating protein 1 [Source:MGI Symbol;Acc:MGI:1923957])

HSP 1 Score: 267.314 bits (682), Expect = 1.400e-72
Identity = 201/693 (29.00%), Postives = 345/693 (49.78%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSK-ILRSNSFHDKNTENPGSKALD--HYG-----YYGHSV----KPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP   +     L         N+ +   S  I R+ S H  +  +P +   +  H G      +G S     KP   ++  N     PT+ S  ++ +    + +  +TE+L +  +       T+    +S    + SQ    L++P   DG  + + +++   + S A+    R  S +         + N + +L                N+     +P   A  YN YP +D  +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  865 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLKNSSNTGVGSPSNTIGRTPSRHPSSRTSPLTSPTNCSHGGLSPSRLWGWSADGLSKPPPPFSQPNSI---PTAPSHKTLRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKDCDIVSRDGGAASPATE--GRGGSEIEGGRM---ALDNKTSLL----------------NTQPPRAFPGPRAREYNPYPYSDTINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1513          

HSP 2 Score: 162.54 bits (410), Expect = 8.805e-40
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|Q99JD4|CLAP2_RAT (CLIP-associating protein 2 OS=Rattus norvegicus OX=10116 GN=Clasp2 PE=1 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 7.517e-72
Identity = 208/712 (29.21%), Postives = 343/712 (48.17%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK----IMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANS--MTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHIN--QGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            ++ +E+  E+L + +S +WSE+K+GL+  QNLL++ R L+ ++LK+  E+   +F D   K+F +FL  +   I+ HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+   + P   +  S   L   V+ ++ W  E K  ++RK + ++L+ L  L+      +   LP   +      + N  + + +G  +S   M S + R       N  +P +                   TN +++ L P++   ++  M  EDI + +R  TE +Q  +   +     D +    R  P      T  S P   D  A G+  +  Q  + N A+        SS R+ +Y P   S       DS SP N+                                S L + M            S              L  +D++  +L EL   N+R E+RK  L +LM L +E +   W+E FKTIL+ LL+T+ D +P IR L+L+VL+E+ +  P RF ++  LTV+K L +HKD  K VVR+AEE + V+A  +S   C+KVL  ++   D  +NL A+KM  +V++ V +  L   L  ++PGLI+  ++ ES +RKA +FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  642 MRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLA--VSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSS---MGSPLTRPTPRSPANWSSPLTSP-----------------TNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQE----DMSEPLKRD-PKKEDGDTVCSGPGMSDPRAGGDAPDSSQPALDNKASLLHSVPLHSSPRSRDYNPYNYS-------DSISPFNK--------------------------------SALKEAMFDDDADQFPDDLS--------------LDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS 1273          

HSP 2 Score: 157.532 bits (397), Expect = 2.063e-37
Identity = 83/236 (35.17%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            + +  AGAVDED F   F+ +   ++ +SREL+E + +I   L  +  DW++R  ALK ++S+  +  +  + F  +LR L   L+    DLRSQVVREAC+ VA+L+ +L  + +   +A +P+L +L+PNSA++MATSG   +  I+ + H  +++  ++S   SKS   RR + + L+ +   W    LE+    L   ++KG+ DAD EAR  +R  ++G   +FP EA  +
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETL 298          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|Q8BRT1|CLAP2_MOUSE (CLIP-associating protein 2 OS=Mus musculus OX=10090 GN=Clasp2 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 8.452e-72
Identity = 207/712 (29.07%), Postives = 341/712 (47.89%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK----IMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANS--MTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHIN--QGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            ++ +E+  E+L + +S +WSE+K+GL+  QNLL++ R L+ ++LK+  E+   +F D   K+F +FL  +   I+ HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+   + P      S   L   V+ ++ W  E K  ++RK + ++L+ L  L+      +   LP   +      + N  + + +G  +S   M S + R       N  +P +                   TN +++ L P++   ++  M  EDI + +R  TE +Q  +     +   +      R  P      T  S P   D  A G+  +  Q  + N A+        SS R+ +Y P   S       DS SP N+                                S L + M            S              L  +D++  +L EL   N+R E+RK  L +LM L +E +   W+E FKTIL+ LL+T+ D +P IR L+L+VL+E+ +  P RF ++  LTV+K L +HKD  K VVR+AEE + V+A  +S   C+KVL  ++   D  +NL A+KM  +V++ V +  L   L  ++PGLI+  ++ ES +RKA +FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  642 MRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRIELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDFTNSSETRLA--VSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSS---MGSPLTRPTPRSPANWSSPLTSP-----------------TNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFS-----FRSQEDMSEPVRRDPKKEDGDTICSGPGMSDPRAGGDAADGSQPALDNKASLLHSMPLHSSPRSRDYNPYNYS-------DSISPFNK--------------------------------SALKEAMFDDDADQFPDDLS--------------LDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNMLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS 1273          

HSP 2 Score: 157.532 bits (397), Expect = 1.724e-37
Identity = 83/236 (35.17%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            + +  AGAVDED F   F+ +   ++ +SREL+E + +I   L  +  DW++R  ALK ++S+  +  +  + F  +LR L   L+    DLRSQVVREAC+ VA+L+ +L  + +   +A +P+L +L+PNSA++MATSG   +  I+ + H  +++  ++S   SKS   RR + + L+ +   W    LE+    L   ++KG+ DAD EAR  +R  ++G   +FP EA  +
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSVQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETL 298          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|Q80TV8|CLAP1_MOUSE (CLIP-associating protein 1 OS=Mus musculus OX=10090 GN=Clasp1 PE=1 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 1.235e-71
Identity = 201/693 (29.00%), Postives = 345/693 (49.78%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSK-ILRSNSFHDKNTENPGSKALD--HYG-----YYGHSV----KPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP   +     L         N+ +   S  I R+ S H  +  +P +   +  H G      +G S     KP   ++  N     PT+ S  ++ +    + +  +TE+L +  +       T+    +S    + SQ    L++P   DG  + + +++   + S A+    R  S +         + N + +L                N+     +P   A  YN YP +D  +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct:  848 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLKNSSNTGVGSPSNTIGRTPSRHPSSRTSPLTSPTNCSHGGLSPSRLWGWSADGLSKPPPPFSQPNSI---PTAPSHKTLRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFS----FRSQ--EDLNEPIKRDGKKDCDIVSRDGGAASPATE--GRGGSEIEGGRM---ALDNKTSLL----------------NTQPPRAFPGPRAREYNPYPYSDTINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1496          

HSP 2 Score: 162.54 bits (410), Expect = 5.698e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|O75122|CLAP2_HUMAN (CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3)

HSP 1 Score: 259.996 bits (663), Expect = 1.185e-69
Identity = 206/713 (28.89%), Postives = 342/713 (47.97%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK----IMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANS--MTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHIN--QGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            ++ +E+  E+L + +S +WSE+K+GL+  QNLL++ R L+ ++LK+  E+   +F D   K +F +FL  +   I+ HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+   + P   +  S   L   V+ ++ W  E K  ++RK + ++L+ L  L+      +   LP   +      + N  + + +G  +S   M S + R       N  +P +                   TN +++ L P++   ++  M  EDI + +R  TE +Q  +   +     D N    R    +    +    P   D  A G+  +  Q  + N A+        SS R+ +Y P   S       DS SP N+                                S L + M            S              L  +D++  +L EL   N+R E+RK  L +LM L +E +   W+E FKTIL+ LL+T+ D +P IR L+L+VL+E+ +  P RF ++  LTV+K L +HKD  K VVR+AEE + V+A  +S   C+KVL  ++   D  +NL A+KM  +V++ V +  L   L  ++PGLI+  ++ ES +RKA +FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  649 MRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLA--VSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSS---MGSPLTRPTPRSPANWSSPLTSP-----------------TNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQE----DMNEPLKRDSKKDDG-DSMCGGPGMSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYNPYNYS-------DSISPFNK--------------------------------SALKEAMFDDDADQFPDDLS--------------LDHSDLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKVLREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRAQTGS 1281          

HSP 2 Score: 157.147 bits (396), Expect = 2.263e-37
Identity = 83/236 (35.17%), Postives = 138/236 (58.47%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            + +  AGAVDED F   F+ +   ++ +SREL+E + +I   L  +  DW++R  ALK ++S+  +  +  + F  +LR L   L+    DLRSQVVREAC+ VA+L+ +L  + +   +A +P+L +L+PNSA++MATSG   +  I+ + H  +++  ++S   SKS   RR + + L+ +   W    LE+    L   ++KG+ DAD EAR  +R  ++G   +FP EA  +
Sbjct:   57 SKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETL 292          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|Q7Z460|CLAP1_HUMAN (CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.668e-42
Identity = 97/257 (37.74%), Postives = 154/257 (59.92%), Query Frame = 1
Query: 2728 CYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPN--DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
             +P   A  YN YP +DA +T  D+  +K    D             ++++  +P +  D++  +L EL   N+R E+RK  L++L+ + RE+++  W E FKTIL+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  LL  L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct: 1255 AFPGPRARDYNPYPYSDAINTY-DKTALKEAVFD-----------DDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1499          

HSP 2 Score: 162.54 bits (410), Expect = 5.708e-39
Identity = 87/247 (35.22%), Postives = 145/247 (58.70%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            AGAVDE+ F   F  + V ++ +SR+L+E I +I   L  +  DWE+RV ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ + +L+ +L  + +   +A MP++ +LIPNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR  +R  + GF  +F +EA  +   ++S  +  L+  L
Sbjct:  294 AGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL 540          

HSP 3 Score: 122.479 bits (306), Expect = 1.191e-26
Identity = 69/218 (31.65%), Postives = 118/218 (54.13%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  851 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP 1066          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A4E0RUN0 (CLIP-associating protein 1 OS=Fasciola hepatica OX=6192 GN=D915_003599 PE=4 SV=1)

HSP 1 Score: 544.273 bits (1401), Expect = 6.571e-169
Identity = 410/1261 (32.51%), Postives = 658/1261 (52.18%), Query Frame = 1
Query:   28 SASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL-SFHPAGQVLAQFSNAKQRA--------------TNP----PTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSSL-----TRSKIKTQSDRGQNIMTS-SVSRAAESSNIRGSNSSLTGYTYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTG---KGLYSGFENG----------------VDPPNSGLLSRRRMD-------------------SSDDNGXXXXXXXXXXXXXXXL-----RAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNI----IVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFK-----TSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDS-FSPHNRNLLAGVDNSLAYSCYP-NYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSS 3567
            SAS   ++ RK     NQ V GAVDED F+  F         +S+EL E++G +   L GN E+WEKRV ALKTL+++ ++  +  EEF   L+ L+VP+ +CL DLRS VVREAC+ VAY +  LK R +   +A + +LI L+ NSA+IMA+S    +  I+ N HS ++   +  +++SKS+ TR+   + LE I   W   VLEK +  LQ++L+KG+ DADQEAR  +R AF  F   FP +AN +L  +D+ +R L+EK+L S   +G +++  +    R+              TNP    PT   LGT +      +      + +E  T    T + S+     TRS++ T+    Q+  TS  VS +  +    G ++   G +Y +S   +       ++G A  I    G ++      S+YR      VS+ +PR +  +  G   + + SG+                   +   NS   +R+R                      SDDN SETSS  S   SRS+      ++++ + N +EI+  LS   WS++KDGL+N QN ++S   L+  D+K+  +  N +F D++SK+  LF+  +Q  I+ +   L DWLY LL+ L+ +Q+ E L S QK IQETL  +RS FPL +Q   CC  V+D+ Q    K K+ ++ + K ++++    +   ++A+ TP +N+    I+ W  E K  ++R++++ +++KL++L+     AI   LP  ++++   + K     T+  G ++S L   S   R+ S    +                H + P D+     +S   P  G  N M+ E +++ IR+ +E +Q+L         + G  +  R       +R+ +   P  D     + ++Q        + ++   Q         PS I +S   +Q +   P      A V NS A    P + D S Y     N A  T S+++       D     +  +G+Q L+KI  +PP D++  IL EL   N+R EQRK C++KL+ L+R+  +++W+E FK  L+ LL+T+ D   E R L+L+VLQEL +T P  F +F  L V+K+L + +D +KTV RAAEECS+V+A+CL  +LC+ VL+ ++ND   ++NL A+KM  +V++N PE L+   +++++PGLI    HE+S +RKASIFCLV I  K+G+ IW +L  +  SK RLL+LYI++  +S
Sbjct:   52 SASADVSMERKRSTGENQGV-GAVDEDVFHQSFVPAMSISAYSSKELTEILGRLKETLSGNPEEWEKRVDALKTLRALLANGAAQFEEFAMLLKTLEVPVDACLRDLRSAVVREACITVAYFSQELKNRFDRFAEAVLQTLIVLLSNSAKIMASSANVAIRFILENTHSPRLFPILVGSLSSKSSVTRKCVCEFLEIIFRVWPLNVLEKHVALLQDSLKKGINDADQEARMFARRAFPLFAAKFPDQANSLLQNLDAQKRKLIEKDLISAGMSGSIMSGDNGTAARSRSNSQTTMAPRSAVTNPVTRRPTRPVLGTVAATVTGARPRPPITTQNEYGTIGRYTRHGSVAPTVDTRSRLSTRKKVSQSQPTSREVSPSRFTYASYGISNDSQGMSYNASGYASRNGLMGHTAGNAGYIPSEGGLIN------STYR----PPVSSRIPRSQGASREGSPTRSVASGYSAASYQNHSQLSQPSPMSRLGQANSSYRTRQRPSLSSMSDCGDMGDPFHSRHLESDDNFSETSSQCSDRSSRSAAGFRRQQSMRVTGNLKEIMALLSGTQWSDRKDGLVNLQNYMRSGSALSPDDIKRLTDAFNKMFADSQSKVVSLFMDTLQFFIKEYNPMLRDWLYTLLIRLLHRQSHEVLGSHQKAIQETLFVLRSHFPLNVQFVTCCHFVMDNTQAPNSKVKVCLLEYLKDLILM----MNPDAIAAPTPEMNLAISRIISWSTEPKSADVRRMASRVIIKLYDLNTSSFSAILQSLPRASQERASEILKTYQKTTTGGGRMDSNLSTGS--WRAPSVDQSD----------------HILSPIDI----GQSVYPP--GDRNHMSPETVNSLIRQASEGIQSLTCGI-----SSGIPTPQRRVSETGLMRSPMGYSPRAD-----SQLSQPAGRVEPTNAVLRTMQ---------PSNIISSPGPIQSTMLEP------APVANSYATPPVPLSDDPSQY-----NPAQQTRSNKLGGIFEQGDGPKLKKPVIGYQTLRKIREMPPEDIMSEILQELSNHNERHEQRKGCMLKLIKLLRDGVIQDWDEYFKPTLLILLETLGDDGVETRALALKVLQELVRTKPDLFHEFACLFVIKVLEACRDGEKTVNRAAEECSKVVAQCLPPDLCLSVLTPLINDWSLQINLPAVKMQEQVVRNAPEPLVSQVVDTIIPGLIVACNHEDSAMRKASIFCLVAIASKLGDVIWDHLTEMHVSKKRLLKLYIDREQAS 1243          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A068WE23 (CLIP associating protein 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000910700 PE=4 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 7.206e-153
Identity = 381/1231 (30.95%), Postives = 620/1231 (50.37%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSN-MEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSN--------------AKQRATNP-------------PTTLKLGT----------SSYGNRXXXXXXXXXXXXELITGKSRTNYS---SLTRSKIKTQSDRGQNIMTSSVSRAAE---SSNIR-----GSNSSLTGYTYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXX-------LRAI------KPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQ-GMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCP------MGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            T    +GA+DE+ F + FST+    + +SR+L E + +I   L  N EDWE+R  ALK L++V  S  + M+EF + LR L+ P+  CL DLRSQVVREA + VAYL+     + +   +  M +L++LIPNSA+IM+TS +T +  I+ N  ++++   ++  ++SKS+  R++    L+ I   W   VLE+ +  +Q  L KG++DADQ+AR+ +R AF  F   FP +   +L  +D  +R  +E+ LS + A    +  S               + +R T P             P  L  G+          S+YG+                TG  + + S   S   S I+T S+   N+  +S +RA     SS I      G  +S T    + ++R  P S   S  G+ P+  V      + N  Y+      +GSV+    +R +L+S     YS F++            RR   SDDN SETSS+ S    +S        LR +      +P +   EI++ L S  WSEKK+GL++ +  L+S + L+  ++ +  EVL+ +F ++ SK+   F+  +Q  I+ + Q+L DW+Y  ++ L ++Q  E L++ QK I +TL  IRS FPL +Q   CCR +ID   +  +K K  ++ + K ++++ P   +      +  ++  ++ W  E K  ++R++++ +++KL +L+P    ++   +P  ++ +   L KT              K   +++   + T   GS+  +        +KP+     +  S + P    A    Q+++D++  + +   ++ ++   R  G + + SY +  P           PP      + N + Q G +++ A  Y    F  +  +++ P +G  +S ++ Q  FSP              YS  P   A      P     S  S+ +L             CP      +G+Q L+KI  +PP D I  IL EL   N R EQRKAC++KL+ L+R+  ++ W E  K  L+ LL+++ DT  E R L+LRVLQEL +T      D+  LTV+KIL +  D DK V+R+AEEC+Q +AR LSQ LC+++L+ V+NDN   +NL A+KM  +V+K     L+   L  ++PGLI    HE+SH+RKASIFCLV+I  K G+ +W YL  L++SK RLLR+YI+K
Sbjct:   15 TKSGSSGAIDEEGFRHAFSTVSSLPIYSSRDLSEYMTKIKESLCVNPEDWERRANALKDLRNVVGSGGHQMDEFPALLRTLETPVLGCLQDLRSQVVREASVTVAYLSQETGSKFDHFAEIIMQTLLNLIPNSAKIMSTSAITAIGFIIRNTFASRLFPIIAGGLSSKSSVLRKYVCIFLDPIFQCWPVHVLERHMALIQEVLCKGVSDADQDARSATRKAFKSFAEKFPDQVETVLRNLDFAKRKAIERSLSLNGADDQSSAASGTSSRTASQTNLACPSAKRTTRPAMGTSGLSGSTRRPNILATGSMMSETGRKNISAYGDSHSH------------TGAKKISMSQPASRETSPIRTASEVDYNVGGASAARAYAKTLSSTISRRKGLGFGASATVRGLRRTSRPVPHSQDHSREGS-PISAV------SANAPYTYGAANAAGSVTN---KRPSLSSMSDAGYSQFKS----------QSRRQYESDDNASETSSMCSERSGQSMPVYRRTHLRPVNRLAVPRPVQGIGEIIKLLGSSQWSEKKEGLLHLKEYLRSGQPLSHAEVMRVAEVLSVIFGESSSKVITPFMETLQLFIKGYHQFLHDWIYIAMVRLFNRQGQEVLSTHQKSIADTLAVIRSHFPLNLQFACCCRFIIDDAMSPTLKVKARVLEYLKDLLVMMPVDTINNPSNEMVKSIARVIAWSTEPKSADVRRLASRVVIKLSDLNPAAFASVVKQMPKASQDQSAKLLKT------------YQKTATASTGSHEATSPDGSRTSNRL------IKPQVGNGGKPFSPISPVYVPA---VQQEVDHF--QASGKNRSTSIPDGRV-GVEPSSSYGQPPPL----------PPL----YSANTVRQNGQMTDGAHHY----FSIATGSSHSPAAG--DSGNLQQ--FSPQ-------------YSYLP---AKSPQQQPPTSILSGFSNDLL-------------CPKLKKPVIGYQTLKKIREMPPEDAITEILQELSNYNDRYEQRKACMLKLIKLLRDGTIQTWEEHSKPTLLILLESLSDTSNETRALALRVLQELVRTQGDLISDYACLTVMKILEACNDIDKGVIRSAEECAQTVARYLSQELCLRLLTTVINDNQTSLNLPAVKMQTQVIKVSSPELVQEVLPDLIPGLIAACNHEDSHMRKASIFCLVQIAIKFGDAVWDYLNELTASKKRLLRIYIDK 1138          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A068YGV2 (CLIP associating protein 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000910700 PE=4 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 1.111e-151
Identity = 382/1226 (31.16%), Postives = 618/1226 (50.41%), Query Frame = 1
Query:   73 TNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSN-MEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSN--------------AKQRATNP-------------PTTLKLGT----------SSYGNRXXXXXXXXXXXXELITGKSRTNYS---SLTRSKIKTQSDRGQNIMTSSVSRAAE---SSNIR-----GSNSSLTGYTYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXX-------LRAI------KPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQ-GMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCP-MGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            T    +GA+DE+ F + FST+    + +SR+L E + +I   L  N EDWE+RV ALK L++V  S  + M+EF + LR L+ P+  CL DLRSQVVREA + VAYL+     + +   +  M +L++LIPNSA+IM+TS +T +  I+ N  ++++   ++  ++SKS+  R++    L+ I   W   VLE+ +  +Q  L KG++DADQ+AR+ +R AF  F   FP +   +L  +D  +R  +E+ LS + A    +  S               + +R T P             P  L  G+          S+YG+                TG  + + S   S   S I+T S+   N+  +S +RA     SS I      G  +S T    + ++R  P S   S  G+ PV  V      + N  Y+      +GSV+    +R +L+S     YS F+             RR   SDDN SETSS+ S    +S        LR +      +P +   EI++ L S  WSEKK+GL++ +  L+S + L+  ++ +  EVL+ +F ++ SK+   F+  +Q  I+ + Q+L DW+Y  ++ L ++Q  E L++ QK I +TL  IRS FPL +Q   CCR +ID   +  +K K  ++ + K ++++ P   +      +  ++  ++ W  E K  ++R++++ +++KL +L+P    ++   +P  ++ +   L            LK   K   +++   + T   GS+  +        ++P+     R  S + P    A    Q+++D++         +++      DG  G        P +S  +     PPY       N + Q G +++ A  Y    F  +  +++ P +G  +S ++ Q  FSP                 Y +  A   +  P     S  S+ +L        Y + + P +G+Q L+KI  +PP D I  IL EL   N R EQRKAC++KL+ L+R+  ++ W E  K  L+ LL+++ DT  E R L+LRVLQEL +T      D+  LTV+KIL +  D DK V+R+AEEC+Q +AR LSQ LC+++L+ V+NDN   +NL A+KM  +V+K     L+   L  ++PGLI    HE+SH+RKASIFCLV+I  K G+ +W YL  L++SK RLLR+YI+K
Sbjct:   15 TKSGSSGAIDEEGFRHAFSTVSSLPIYSSRDLSEYMTKIKESLCVNPEDWERRVNALKDLRNVVGSGGHQMDEFPALLRTLETPVLGCLQDLRSQVVREASVTVAYLSQETGSKFDHFAEIIMQTLLNLIPNSAKIMSTSAITAIGFIIRNTFASRLFPIIAGGLSSKSSVLRKYVCIFLDPIFQCWPVHVLERHMALIQEVLCKGVSDADQDARSATRKAFKSFAEKFPDQVETVLRNLDFTKRKAIERSLSLNGADDQSSAASGTSSRTASQTNLACPSAKRTTRPAMGTSGLSSSTRRPNILATGSMMSETGRKNISAYGDSHSH------------TGAKKISMSQPASRETSPIRTASEVDYNVGGASAARAYAKTLSSTISRRKGLGFGASTTVRGLRRTSRPVPHSQDHSREGS-PVSAV------SANAPYTCGAANAAGSVTN---KRPSLSSMSDAGYSQFKG----------QSRRQYESDDNASETSSMCSERSGQSMPVYRRTHLRPVNRLAVPRPVQGIGEIIKLLGSSQWSEKKEGLLHLKEYLRSDQSLSHAEVMRVAEVLSVIFGESSSKVITPFMETLQLFIKGYHQFLHDWVYIAIVRLFNRQGQEVLSTHQKSIADTLAVIRSHFPLNLQFACCCRFIIDDAMSPTLKVKARVLEYLKDLLVMMPVDTINNPSNEMVKSIARVIAWSTEPKSADVRRLASRVVIKLSDLNPAAFASVVKQMPKASQDQSAKL------------LKTYQKTATASTGSHEATSPDGSRTPNRL------IRPQVGNGGRPFSPISPVYVPA---VQQEVDHFQASGKNRSTSIS------DGRVG------VEPSSSYGQPPPLPPPY-----TANTVGQNGQMTDGAHHY----FSIATGSSHSPAAG--DSGNLQQ--FSPQ----------------YSSPLAKSPHQQPPTSILSGFSNDLL--------YPKLKKPVIGYQTLKKIREMPPEDAITEILQELSNYNDRYEQRKACMLKLIKLLRDGTIQTWEEHSKPTLLILLESLSDTSNETRALALRVLQELVRTQGDLISDYACLTVMKILEACNDIDKGVIRSAEECAQTVARYLSQELCLRLLTTVINDNQTSLNLPAVKMQTQVIKVSSPELVQEVLPDLIPGLIAACNHEDSHMRKASIFCLVQIAIKFGDAVWDYLNELTASKKRLLRIYIDK 1138          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A564YML9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7218 PE=4 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 3.469e-146
Identity = 367/1203 (30.51%), Postives = 597/1203 (49.63%), Query Frame = 1
Query:   91 GAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSN-MEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQV----------------LAQFSNAKQRATNPPTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIR---------GSNSSLTGYTYKXXXXXXXXXXXXXXXGT---APVITVNNGSVHTKNDSYSSYRYKTSGSVSASLP----------RRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXXL---RAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQAL-AVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPY----PDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            GA+DE+ F + FST+    +  SR+L E + +I   +  +SEDWE RV  LK L++V +S  + M++F + LR ++ P+ SC+ DLRSQVVREAC+ VAYL+  +  + +  T+  M  L++LIPNSA+IM+TS +T + II+ +  +++VL  +   + SKSN+ R+     L+ I   W   V+E+ +  +Q AL+KG++DAD+ AR+ +R AF  F   FP +   +L  MD  +R  +E  L+ +                     LA  +   +R T P     +GTS  GN    +         L++  +R N S  T  + +++   G+  M+   SR  E+S +R         GS +S     Y  +  +T    +    G    AP  T  +G    +N   +S     S +VSA+ P           R +L+S     ++ F+        G  SRR+ +S D+    +S           +     ++P     +I++ L+S  WSEKKDGL+N +  L+S + L+  ++ +  EVL+ +F ++ SK+   F+  +Q  I+ + QYL +W+Y  ++ L ++Q  E L++ QK I +TL  IRS FPL +    CCR +ID   +  +K K  ++ + K ++++ P+  +      +  +V  I+ W  E K  ++R++++ +++KL +L+P    ++   +P  ++ +   L KT A          ++  + ++      T   G++          S  P+    N  K     T+    S+ QE   N      E    L ++   R DG            Y  Q++     PPY    P G  NG++ +      +A +  +N      +  +YPP     S +  Q        +LL+G+ + L    YP +        PV                           +G+Q L+KI  +PP D I  IL EL   N R EQRKAC++KL+ L+R+  +  W E  K  L+ LL+++ D   E R L+LRVLQEL +T  +   D+  LTV+KIL +  D+DK V R+AEEC+Q +AR LSQ L +++L+ V+ND+   +NL A+KM  +V+K     LL   L  ++PGLI    HE S +RKASIFCLV+I    G+ +W YL  L++SK RLLR+YI+K
Sbjct:   20 GAIDEEGFRHAFSTVSSLPIYASRDLSEYMAKIKDSVSAHSEDWELRVNGLKDLRNVVASGGHQMDDFPALLRTVEAPVLSCIQDLRSQVVREACITVAYLSQEIGSKFDHFTEVIMQPLLNLIPNSAKIMSTSAITAIGIIIQHTFASRVLPIIIGGLRSKSNAVRKNVCIFLDPIFQYWPVHVIERHMGIIQEALKKGVSDADETARSATRKAFKTFATKFPDQVEPVLRNMDPTKRKAIELLLASNGGDDQSSVTSGASSRTTSQTNLAGLTGTAKRTTRP----AMGTSGLGN--TARRPTVAGTASLMSELTRKNLS--TYGEARSRMGAGKVSMSQPASR--ETSPLRTPSEVDFNTGSTTSAAAKAYAKTISSTLNPRKPLGFGIAARAPRKTSRSG----RNSQGTSREGSPSSAVSATAPYNACSAVGTVNRPSLSSMSDAGFAQFK--------GTYSRRQYESDDNASETSSMCSERSGQSMPVYRRNHMRPIAGIGDIIKLLTSSQWSEKKDGLLNLKEYLRSGQILSHQEVMRIAEVLSVIFGESSSKVITPFMETLQLFIKGYNQYLHEWIYIAMVRLFNRQGQEVLSTHQKSISDTLAVIRSHFPLNLLFACCCRFIIDDAMSPTLKVKGRVLDYLKDLLVMMPADAISNPTPEMVKSVTRIIAWSTEPKSADVRRLASRVVIKLSHLNPVAFNSMVQMMPKASQDQAAKLLKTYA----------KTSTVGNSGVSYVATSPDGTRTA--------SRSPKPTTGNGTKCFSPITATYVPSVAQETPVNQFSPPGELKNPLVSIPDGRVDGLPAE--------YGGQMQAP-PPPPYSANLPMGGQNGDNSHH-YFPMAAGAGNLNSVPQYGQQYSYPP---GRSPEQQQPP------SLLSGITHDL---LYPRFKK------PV---------------------------IGYQTLKKIREMPPEDAITEILQELSNYNGRYEQRKACMLKLIKLLRDGTILTWEEHSKPTLLTLLESLSDISSETRALALRVLQELVRTQGKLISDYACLTVMKILEACNDTDKGVNRSAEECAQTVARYLSQELLLRLLTTVINDSQTPLNLPAVKMQTQVIKVSSPDLLQEVLPDLIPGLIAACNHENSQMRKASIFCLVQIAINFGDAVWDYLGDLNASKKRLLRIYIDK 1127          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A564YKJ3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7218 PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 2.456e-145
Identity = 377/1213 (31.08%), Postives = 606/1213 (49.96%), Query Frame = 1
Query:   91 GAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSN-MEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQV----------------LAQFSNAKQRATNPPTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIR---------GSNSSLTGYTYKXXXXXXXXXXXXXXXGTA---PVITVNNGSVHTKNDSYSSYRYKTSGSVSASLP----------RRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXX-------LRAI------KPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQAL-AVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPY----PDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            GA+DE+ F + FST+    +  SR+L E + +I   +  +SEDWE RV  LK L++V +S  + M++F + LR ++ P+ SC+ DLRSQVVREAC+ VAYL+  +  + +  T+  M  L++LIPNSA+IM+TS +T + II+ +  +++VL  +   + SKSN+ R+     L+ I   W   V+E+ +  +Q AL+KG++DAD+ AR+ +R AF  F   FP +   +L  MD  +R  +E  L+ +                     LA  +   +R T P     +GTS  GN    +         L++  +R N S  T  + +++   G+  M+   SR  E+S +R         GS +S     Y  +  +T    +    G A   P  T  +G    +N   +S     S +VSA+ P           R +L+S     ++ F+        G  SRR+ +S DDN SETSS+ S    +S        +R I      +  E   +I++ L+S  WSEKKDGL+N +  L+S + L+  ++ +  EVL+ +F ++ SK+   F+  +Q  I+ + QYL +W+Y  ++ L ++Q  E L++ QK I +TL  IRS FPL +    CCR +ID   +  +K K  ++ + K ++++ P+  +      +  +V  I+ W  E K  ++R++++ +++KL +L+P    ++   +P  ++ +   L KT A          ++  + ++      T   G++          S  P+    N  K     T+    S+ QE   N      E    L ++   R DG            Y  Q++     PPY    P G  NG++ +      +A +  +N      +  +YPP     S +  Q        +LL+G+ + L    YP +        PV                           +G+Q L+KI  +PP D I  IL EL   N R EQRKAC++KL+ L+R+  +  W E  K  L+ LL+++ D   E R L+LRVLQEL +T  +   D+  LTV+KIL +  D+DK V R+AEEC+Q +AR LSQ L +++L+ V+ND+   +NL A+KM  +V+K     LL   L  ++PGLI    HE S +RKASIFCLV+I    G+ +W YL  L++SK RLLR+YI+K
Sbjct:   20 GAIDEEGFRHAFSTVSSLPIYASRDLSEYMAKIKDSVSAHSEDWELRVNGLKDLRNVVASGGHQMDDFPALLRTVEAPVLSCIQDLRSQVVREACITVAYLSQEIGSKFDHFTEVIMQPLLNLIPNSAKIMSTSAITAIGIIIQHTFASRVLPIIIGGLRSKSNAVRKNVCIFLDPIFQYWPVHVIERHMGIIQEALKKGVSDADETARSATRKAFKTFATKFPDQVEPVLRNMDPTKRKAIELLLASNGGDDQSSVTSGASSRTTSQTNLAGLTGTAKRTTRP----AMGTSGLGN--TARRPTVAGTASLMSELTRKNLS--TYGEARSRMGAGKVSMSQPASR--ETSPLRTPSEVDFNTGSTTSAAAKAYAKTISSTLNPRKPLGFGIAARAPRKTSRSG----RNSQGTSREGSPSSAVSATAPYNACSAVGTVNRPSLSSMSDAGFAQFK--------GTYSRRQYES-DDNASETSSMCSERSGQSMPVYRRNHMRPIARYSVPRTVEGIGDIIKLLTSSQWSEKKDGLLNLKEYLRSGQILSHQEVMRIAEVLSVIFGESSSKVITPFMETLQLFIKGYNQYLHEWIYIAMVRLFNRQGQEVLSTHQKSISDTLAVIRSHFPLNLLFACCCRFIIDDAMSPTLKVKGRVLDYLKDLLVMMPADAISNPTPEMVKSVTRIIAWSTEPKSADVRRLASRVVIKLSHLNPVAFNSMVQMMPKASQDQAAKLLKTYA----------KTSTVGNSGVSYVATSPDGTRTA--------SRSPKPTTGNGTKCFSPITATYVPSVAQETPVNQFSPPGELKNPLVSIPDGRVDGLPAE--------YGGQMQAP-PPPPYSANLPMGGQNGDNSHH-YFPMAAGAGNLNSVPQYGQQYSYPPG---RSPEQQQPP------SLLSGITHDL---LYPRFKK------PV---------------------------IGYQTLKKIREMPPEDAITEILQELSNYNGRYEQRKACMLKLIKLLRDGTILTWEEHSKPTLLTLLESLSDISSETRALALRVLQELVRTQGKLISDYACLTVMKILEACNDTDKGVNRSAEECAQTVARYLSQELLLRLLTTVINDSQTPLNLPAVKMQTQVIKVSSPDLLQEVLPDLIPGLIAACNHENSQMRKASIFCLVQIAINFGDAVWDYLGDLNASKKRLLRIYIDK 1136          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: clasp1a (cytoplasmic linker associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-081104-520])

HSP 1 Score: 263.462 bits (672), Expect = 1.832e-71
Identity = 205/707 (29.00%), Postives = 350/707 (49.50%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHS-VKPRDVYTNRNKSQLKPT--SGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGM-VSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSS 3567
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK+F +FL  +   +  H++ L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + P   +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP          F+  A   L+S LK        NS +     +P +        + +S   P    TN + S L P+       +M  ++I + +R  TE +Q+ +   +     D N    R    +  +  + + P        G+    G+ V     + + N+  +SL NT  P +     +      F+P+      G  +++       YD S       +D      D    +   + + L      GF            D++  +L EL   N+R E+RK  L++L+ + RE+++  W+E FKTIL+ LL+T+ D D  IR L+LRVL+E+ ++ P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM  +V++ + +  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +  +L  L+ SK +LL LYI++  ++
Sbjct:  889 LRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRVLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVTVHREDLQDWLFVLLTQLLKKMGADLLGSVQLKVQKALDVTRESFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPGDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALP--------KTFQDGATKLLHSHLK--------NSSNTSGVSSPSNTMGRTQSRHPYSRTSPLTSPTNCSHSGLSPSMMEYDTENMNSDEIYSSLRGVTEAIQSFSYRSQE----DLNEPIRREGKKDDAVGREAASP--------GSDARLGLDVVEGGRTALDNK--TSLLNTPSPRAFAGPRTR----EFAPY------GYGDTIG-----GYDKSALKEAVFDDDVEQFRDCRRQECGENKMVLSK----GFA----------PDLVADLLKELSNHNERVEERKGALVELLKITREDSMAVWDEHFKTILLLLLETLGDKDHTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEESASTLAGSIHPEQCIKVLCPIVQTADYPINLAAIKMQTKVIERIAKESLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPHLAQLTGSKMKLLNLYIKRAQTT 1534          

HSP 2 Score: 158.688 bits (400), Expect = 1.133e-38
Identity = 82/249 (32.93%), Postives = 143/249 (57.43%), Query Frame = 1
Query:   82 AVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQS-VSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            A AG VDE+ F   F  +   ++ +SRE ++   +I   L  +  DWE RV ALK ++S V +  S  E F+  +R L+   +    DLRSQVVREAC+ + +++ +L  + +   +  MP+L++L+PNSA++MATSG+  + +I+   H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  ++ +EA  +   ++S  +  L+  L
Sbjct:  288 ASAGGVDEEDFIKAFEDVPAVQIYSSREFEDSFTKIREVLSDDKHDWEHRVAALKKVRSLVLAGASEQEGFLQQIRLLEGAFKLSAKDLRSQVVREACITLGHISSVLGNKFDHGAETIMPTLLNLVPNSAKVMATSGVVAIRLILRRTHYPRLIPIITSNCTSKSVAVRRRCYEFLDLLLQEWQTNTLERHVAVLTETIKKGIHDADSEARSVARKCYWGFHGHYSREAEHLFQALESTYQKALQSHL 536          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 165.622 bits (418), Expect = 8.807e-41
Identity = 83/232 (35.78%), Postives = 143/232 (61.64%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKML 780
            AGAVDE+ F   F  +   ++ +SREL++ + +I   L  +  DWE RV ALK ++S+  +  ++ E F+  LRQL+   +    DLRSQVVREAC+ + +L+ +L  + +   ++ MP+L++L+PNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++ 
Sbjct:  286 AGAVDEEDFIRAFEDVPTIQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIPIMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLF 517          

HSP 2 Score: 160.999 bits (406), Expect = 2.321e-39
Identity = 80/198 (40.40%), Postives = 132/198 (66.67%), Query Frame = 1
Query: 2899 DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            +++  +L EL   ++R E+R+A L++L+ + R+++V  W E FKT+L+ LL+T+ D D  IR L+LRVL+E+ ++ P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  ++L A+KM  +V++ +P+  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct: 1241 ELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKDHTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTADYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1438          

HSP 3 Score: 125.946 bits (315), Expect = 1.243e-28
Identity = 67/217 (30.88%), Postives = 118/217 (54.38%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S++ L+ ++LK+  E+   +F D   K+F +FL  +   I  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + PS  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  816 MRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALP 1030          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 165.622 bits (418), Expect = 8.885e-41
Identity = 83/232 (35.78%), Postives = 143/232 (61.64%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKML 780
            AGAVDE+ F   F  +   ++ +SREL++ + +I   L  +  DWE RV ALK ++S+  +  ++ E F+  LRQL+   +    DLRSQVVREAC+ + +L+ +L  + +   ++ MP+L++L+PNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++ 
Sbjct:  286 AGAVDEEDFIRAFEDVPTIQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIPIMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLF 517          

HSP 2 Score: 160.999 bits (406), Expect = 2.339e-39
Identity = 80/198 (40.40%), Postives = 132/198 (66.67%), Query Frame = 1
Query: 2899 DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            +++  +L EL   ++R E+R+A L++L+ + R+++V  W E FKT+L+ LL+T+ D D  IR L+LRVL+E+ ++ P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  ++L A+KM  +V++ +P+  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct: 1268 ELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKDHTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTADYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1465          

HSP 3 Score: 125.561 bits (314), Expect = 1.622e-28
Identity = 67/217 (30.88%), Postives = 118/217 (54.38%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S++ L+ ++LK+  E+   +F D   K+F +FL  +   I  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + PS  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  803 MRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALP 1017          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 165.622 bits (418), Expect = 8.989e-41
Identity = 83/232 (35.78%), Postives = 143/232 (61.64%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKML 780
            AGAVDE+ F   F  +   ++ +SREL++ + +I   L  +  DWE RV ALK ++S+  +  ++ E F+  LRQL+   +    DLRSQVVREAC+ + +L+ +L  + +   ++ MP+L++L+PNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++ 
Sbjct:  286 AGAVDEEDFIRAFEDVPTIQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIPIMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLF 517          

HSP 2 Score: 160.999 bits (406), Expect = 2.346e-39
Identity = 80/198 (40.40%), Postives = 132/198 (66.67%), Query Frame = 1
Query: 2899 DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            +++  +L EL   ++R E+R+A L++L+ + R+++V  W E FKT+L+ LL+T+ D D  IR L+LRVL+E+ ++ P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  ++L A+KM  +V++ +P+  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct: 1273 ELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKDHTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTADYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1470          

HSP 3 Score: 125.561 bits (314), Expect = 1.557e-28
Identity = 67/217 (30.88%), Postives = 118/217 (54.38%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S++ L+ ++LK+  E+   +F D   K+F +FL  +   I  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + PS  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  808 MRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALP 1022          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 165.622 bits (418), Expect = 9.189e-41
Identity = 83/232 (35.78%), Postives = 143/232 (61.64%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKML 780
            AGAVDE+ F   F  +   ++ +SREL++ + +I   L  +  DWE RV ALK ++S+  +  ++ E F+  LRQL+   +    DLRSQVVREAC+ + +L+ +L  + +   ++ MP+L++L+PNSA+IMATSG+  + +I+ + H  +++  ++S   SKS + RR   + L+ +   W    LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++ 
Sbjct:  286 AGAVDEEDFIRAFEDVPTIQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIPIMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLF 517          

HSP 2 Score: 160.999 bits (406), Expect = 2.146e-39
Identity = 80/198 (40.40%), Postives = 132/198 (66.67%), Query Frame = 1
Query: 2899 DMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            +++  +L EL   ++R E+R+A L++L+ + R+++V  W E FKT+L+ LL+T+ D D  IR L+LRVL+E+ ++ P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  ++L A+KM  +V++ +P+  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +
Sbjct: 1281 ELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKDHTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTADYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1478          

HSP 3 Score: 125.561 bits (314), Expect = 1.523e-28
Identity = 67/217 (30.88%), Postives = 118/217 (54.38%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++ +E+  E+L   +S +WSE+K+GL+  QNLL+S++ L+ ++LK+  E+   +F D   K+F +FL  +   I  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP + Q     R ++D  Q   +K K++I+ + +++   + PS  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  816 MRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALP 1030          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003792.1 (pep scaffold:Pmarinus_7.0:GL477033:101956:230147:1 gene:ENSPMAG00000003427.1 transcript:ENSPMAT00000003792.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.72 bits (587), Expect = 8.751e-62
Identity = 203/732 (27.73%), Postives = 344/732 (46.99%), Query Frame = 1
Query: 1477 ENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVI-VAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFK----------TSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQ-LKPTSGSA-----------------NSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYP-PSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYL--NQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            E+  E+L + +S +W+E+K+GLI  Q L +S R L+ ++LK+  E+   +F D  SK +F        QL + H   L DWLY LL  L+ K  A+ L S Q  +Q  L+  R  F  + Q     R ++D  Q   +K K++++ + +++ + + P+  +  S   L   V+ I+ W  E K  ++RK + A+L+ L  L+      +   LP   ++    L            TS+ G   +R   R+ + R +        + G+ +       G  + PR +     + Q L P S  A                  ++  EDI + +R  +E +Q L+   +  D T+     S T   +S +   L+D   P         +   V   A   +++   SSL NT  P P+G  +SS +++D    H  + L  + +        + D +G   +   D                   +  QC M                +  IL EL       R E+R+  L++L+ L RE+A+   +E FK +L+ LLDT+KD D  +RTL+LRVL+E+ +  P  F ++  LT+++ L +HKD  K VVRAAEE +  +A  +    C++VL  ++       NL A+KML  V++ +    LL  + +++PGL++  ++ ES +RKAS+FCLV ++  IG+ +  +L  L+ SK +LL LYI++  + S
Sbjct:  877 EDVAELLNRCASANWTERKEGLIGLQALFKSQRTLSRVELKRLCEIFTRMFADPPSKEVFS------SQLFKVHFDELHDWLYLLLTQLLKKMGADLLGSVQTKVQRCLDVTRDSFQFDQQFNILMRFIVDQTQTPNLKVKVAVLKYIESLALQMDPADFVNSSETRLA--VSRIITWTSEPKSSDVRKAAQAVLIALFELNTPEFTMLLGSLPKTFQEGATKLLHNHLRNTSNAGTSSPGSTVTRGTPRASLGRVSPLTSPTMTSQGALSPSRAWGLGADLSPRSLALPTFRPQPLSPLSAYAPKGIWRKYSPSLLDYDTENLNAEDIYSSLRGVSEAIQNLSFRSQE-DLTEPPHKESDTASRDSGIAASLTDVRGPS--------SADSVDGPAGRTVLDNKTSSLLNTLAPRPAG--SSSRLVRDYNPLHYADTLIAIGSV-------HEDEAGQLRHGAGD-------------------MSEQCAM----------------VSDILRELAADADGSRGEERRTALLELLKLAREDALGTRDESFKAVLVTLLDTLKDADYTVRTLALRVLREIVRNRPDPFKNYAELTIIRSLEAHKDPHKEVVRAAEETAMALATSIQPEQCLQVLCPIVQTATYPTNLAAIKMLTRVVERISHGDLLPLVPAVIPGLLQGYDNTESSVRKASVFCLVAVHSVIGDDLKPHLAQLTGSKIKLLNLYIKRAQTGS 1547          

HSP 2 Score: 154.451 bits (389), Expect = 4.885e-38
Identity = 82/227 (36.12%), Postives = 138/227 (60.79%), Query Frame = 1
Query:   82 AVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQS-VSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFP 759
            A AGAVDE+ F      +   ++ ++R+L+E + ++   L  +  DWE+RV ALK L+S V +  +  + F  +LR L   L+    DLRSQVVREAC+ +++L  +LK + +   ++ +P+L++L+ NSA+IMATSG+  + II+ N H+ +++  +++   SKS + RR   + L+ +   W    LEK +  L + ++KG+ DAD +AR  +R A+ G   NFP
Sbjct:  302 AGAGAVDEEDFTRCIEDVTPAQIFSTRDLEESLAKVREVLADDKHDWEQRVTALKKLRSLVIAGATEYDCFFQHLRLLDAALKLSAKDLRSQVVREACITLSHLALVLKNKFDHTAESTLPTLLNLVANSAKIMATSGVVAIRIIIRNTHAPRLIPLLTNNCTSKSVAVRRRCFEFLDLMLHEWQQNTLEKHIGLLVDTIKKGIHDADSDARMEARKAYWGLRGNFP 528          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006778.1 (pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 gene:ENSPMAG00000006089.1 transcript:ENSPMAT00000006778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 5.250e-39
Identity = 89/244 (36.48%), Postives = 148/244 (60.66%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIE-VKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            AGAVDED F   F  +  V +V +SREL+E I  +   L  +  DWE+RV ALK L+ +  +  +  + F  +LR L+   +    DLRSQVVREAC+ + Y + +L  R +   +  MP+L +L+PNSA++MATSG+  + +I+ + H+A+++  ++S  +SKS + RR   + ++ +   W  + LE+ +  L + ++KGM DAD +ARA +R A+ GF  +FP E++ +   ++   + LL
Sbjct:  231 AGAVDEDDFTRVFEEVALVHQVHSSRELEESISGVRDVLCDDKNDWEQRVAALKKLRGLLLAGAAEQDSFPGHLRLLEPAFKLSAKDLRSQVVREACITLGYFSTVLGNRFDHCAETLMPTLFNLVPNSAKVMATSGVAAIRLIIRHTHTARLIPLITSNCSSKSVAVRRRCFEFMDLLLQVWQISSLERHVTVLSDTIKKGMHDADADARAEARKAYWGFRSHFPSESDALYAALEPKYQKLL 474          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006783.1 (pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 gene:ENSPMAG00000006089.1 transcript:ENSPMAT00000006783.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 7.385e-39
Identity = 89/244 (36.48%), Postives = 148/244 (60.66%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIE-VKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLL 813
            AGAVDED F   F  +  V +V +SREL+E I  +   L  +  DWE+RV ALK L+ +  +  +  + F  +LR L+   +    DLRSQVVREAC+ + Y + +L  R +   +  MP+L +L+PNSA++MATSG+  + +I+ + H+A+++  ++S  +SKS + RR   + ++ +   W  + LE+ +  L + ++KGM DAD +ARA +R A+ GF  +FP E++ +   ++   + LL
Sbjct:  228 AGAVDEDDFTRVFEEVALVHQVHSSRELEESISGVRDVLCDDKNDWEQRVAALKKLRGLLLAGAAEQDSFPGHLRLLEPAFKLSAKDLRSQVVREACITLGYFSTVLGNRFDHCAETLMPTLFNLVPNSAKVMATSGVAAIRLIIRHTHTARLIPLITSNCSSKSVAVRRRCFEFMDLLLQVWQISSLERHVTVLSDTIKKGMHDADADARAEARKAYWGFRSHFPSESDALYAALEPKYQKLL 471          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008085.1 (pep scaffold:Pmarinus_7.0:GL476334:564674:633296:-1 gene:ENSPMAG00000007261.1 transcript:ENSPMAT00000008085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 5.275e-38
Identity = 79/231 (34.20%), Postives = 133/231 (57.58%), Query Frame = 1
Query:   88 AGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQS-VSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            AG+VD + F   F  + V ++ +SR+L++ +  I   L  +  DWEKR+ ALK L+S V +     + F  +LR L    +    DLRSQVVREAC+ + +L  +L+ + +   +A +P+L +L+PN AR++ATSG+  + +I+ + H  +++  ++    SKS + RR   + L  +   W   +LE+ +  L   ++KG+ DAD EAR  +R A+ G   +FP EA  +
Sbjct:    7 AGSVDHEDFIRGFEDVPVVQIYSSRDLEDSLNIIRGTLSDDKHDWEKRIAALKKLRSLVIAGAPEYDCFFQHLRLLDSAFKLSAKDLRSQVVREACITLGHLATVLRSKFDHAAEAIIPTLFNLVPNCARVIATSGVAAIRLIIRHTHVPRLIPLITGNCTSKSVAVRRRCYEFLNLLLHEWQSHILERHVAVLVETIKKGIPDADAEARVEARRAYWGLYSHFPAEAEAL 237          

HSP 2 Score: 89.7373 bits (221), Expect = 2.611e-18
Identity = 63/230 (27.39%), Postives = 105/230 (45.65%), Query Frame = 1
Query: 1468 KPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRK-LNTLDLKKYIEVLNTLFNDTKSK-IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESK-WQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKT 2148
            +P E+   +L   SS  W E+KDGL   + LL SR+ L+  +L++  +    +F D   K +F +FL  +   +      L  WLY LL  L+S+  A  L S Q  +Q  L+  R  FP + Q     + ++D  Q    K KL+ M + + +     S     S +     V+ ++ W  E+K   E RK++ A+L+ L  L+      +   LP   ++    L  +
Sbjct:  593 RPPESVAALLSHCSSADW-ERKDGLRGLRALLASRRPLSQAELRRLCDTFTRMFADPHGKQVFCVFLDTLVDFVAQCHSELHHWLYVLLTQLLSRACASLLGSVQAKVQRGLDITRDCFPFDQQFNIIMKCIVDQSQTA--KMKLATMRYLEGLARRMDSEHFANS-SETRHAVSRVITWSTEAKSSSETRKVAQAVLIALFELNTAEFTMLLGALPRTFQEGATRLLHS 818          

HSP 3 Score: 82.0333 bits (201), Expect = 6.044e-16
Identity = 72/211 (34.12%), Postives = 115/211 (54.50%), Query Frame = 1
Query: 2938 NQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
             ++ E+ +A L  L  L  +  + +       +L+ L D V D D  +R L+L VL+E+    P+ F     + V++ L +H+D  K VV AAEE +  +A  L    C+++L   +       NL A+KM  +V       +LLS L  +VPGL++  ++ E+ +RKAS+FCLV I   IG+ +  +L  LSSSK +LL LYI++  + S
Sbjct: 1009 ERQGERMRAALQDLWRLAHDGWLTDSGST--PLLLTLTDAVADPDHTVRMLALHVLREMALNRPESFASHVEVAVIRTLEAHRDPHKEVVHAAEEAAAALASALPPEPCLRLLWPFVQTATYPGNLAAIKMQTKVXGIRSLDVLLSLLPDVVPGLVQGYDNAETSVRKASVFCLVAIYTVIGDELTPHLALLSSSKMKLLNLYIKRAQAGS 1217          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002178.1 (pep scaffold:Pmarinus_7.0:GL493696:28:2121:1 gene:ENSPMAG00000001982.1 transcript:ENSPMAT00000002178.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 3.520e-27
Identity = 63/158 (39.87%), Postives = 98/158 (62.03%), Query Frame = 1
Query: 3097 RVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSS 3570
            R+  E  +  P  F  +  LT++K+L +H+D  K V RAAEE + V+A  L    C+KVL  ++   D  +NL A+KM   V++ +P + L   L  ++PGL++  ++ ES +RKAS+FCLV I+  IGE++  YL  LS SK +LL LYI++  S++
Sbjct:    1 RLCFEFLRRQPTCFRKYAELTIMKVLEAHRDPHKEVCRAAEETASVLAASLPAEQCLKVLCPIVQTADFPINLAAIKMQTRVMQRLPHTALTQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIHTAIGESLTPYLTHLSGSKMKLLNLYIQRAESNA 158          
BLAST of CLIP-associating protein 1 vs. Ensembl Nematostella
Match: EDO44820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW5])

HSP 1 Score: 141.354 bits (355), Expect = 1.088e-34
Identity = 66/185 (35.68%), Postives = 113/185 (61.08%), Query Frame = 1
Query: 2938 NQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            + R ++++  L+ L+ ++RE     W   F  +   L+ ++ D  P IR+L++RVL+++ +  P  F D    TV K+L +HKD  K VVR AEE +  +AR ++   CM+VL  ++ND++  V+L ALKML +V++ V    +   L  ++PGL++  +H ES +RKAS+F LV ++  +GE +
Sbjct:  408 SDRMDEKRGSLVDLLRMIREEIPALW-AAFPKVFSALIRSIDDVQPSIRSLAIRVLKDMVRAQPHTFHDVIGTTVSKVLQAHKDPQKEVVRLAEEAAATIARSVAPEDCMRVLGPIINDSEFPVSLAALKMLTKVVEGVDSVTIEEHLPDLIPGLVKCYDHVESSVRKASVFSLVALHAIVGEEV 591          

HSP 2 Score: 90.8929 bits (224), Expect = 1.351e-18
Identity = 56/198 (28.28%), Postives = 100/198 (50.51%), Query Frame = 1
Query: 1522 SEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            ++++DG+      L+S R ++ ++L K  + L  LF D  +K++  FL  + + I  HK  L DWL+ LL  L+ K   + L S Q  I   L+ IR  FP ++Q     R + D  Q   +K K++++ + + ++ ++ PS         L   V+ I+ W  E K  ++RK S A+++ L  L+      + + LP
Sbjct:   17 TDRRDGISGLLAFLKSSRVMSDVELSKIKDCLTRLFCDPNNKVYSAFLDALCEFIVVHKVDLNDWLFVLLSRLLIKLGTDILGSMQSKIVRVLDVIRDSFPYDLQFSILTRFITDQTQTPNLKVKIAVLQYLQGLISLMDPSDFTNSGETRL--AVSRIISWTTEPKSADVRKESAAVIVALFELNTPEFSMMLSVLP 212          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:101157230])

HSP 1 Score: 176.022 bits (445), Expect = 4.100e-44
Identity = 89/204 (43.63%), Postives = 136/204 (66.67%), Query Frame = 1
Query: 2881 STLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            S L  ++++  +L EL   N+R E+RKA L +L+ L+REN ++ W+E FKTIL+ LL+T+ D +  IRTL+LRVL+E+    P RF ++  LT++K L +HKD  K VVRAAEE + ++A  +S   C+KVL  ++   D  +NL A+KM  +V++ +P   L+S L  +VPGL++  ++ ES +RKA +FCLV I   IGE +
Sbjct: 1019 SGLDQSELVAELLKELSNHNERIEERKAALWELLKLIRENTLQVWDEHFKTILLLLLETMGDREHVIRTLALRVLREILGKQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEETAAMLALSISPEQCIKVLCPIIQSADYPINLAAIKMQTKVVERIPREGLISMLPEIVPGLVQGYDNSESSVRKACVFCLVAIYAVIGEDL 1222          

HSP 2 Score: 142.51 bits (358), Expect = 8.662e-34
Identity = 80/251 (31.87%), Postives = 141/251 (56.18%), Query Frame = 1
Query:   28 SASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            SA++ P+ T   +     AVA  +DE+ F   F+ +   ++ ++R+L+  + +I      +  DW++R  ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ VA+L+ +L  + +   +A +P L +LIPN A++MA SG++ + II+ + H  +++  ++S   SKS + RR     L+ +   W    LE+    L  +++KG+ D D EAR  +R A+ G   +FP EA+ +
Sbjct:   36 SAARRPSATGGKLVSKESAVA--IDEEDFVKAFTDVPTVQIYSARDLEGNLNKIREICSDDKHDWDQRANALKKIRSLLVAGAAGYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAHLSSVLGNKFDHGAEAIVPVLFNLIPNCAKVMAMSGVSAIRIIIRHTHVPRLIPLITSNCTSKSVAVRRRCYDFLDLLLQEWQTHSLERHTAVLVESIKKGIHDPDSEARVEARKAYWGLRNHFPAEADAL 284          

HSP 3 Score: 115.931 bits (289), Expect = 1.430e-25
Identity = 107/377 (28.38%), Postives = 168/377 (44.56%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSK--------------------IFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIV--APSTV--MEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRD-------VYTNRNKSQLKPTSGS----ANSMTQEDIDNYIRRNTEDLQALAV--------AYERYDG---TDGNR 2454
            ++ +E+  E+L + +S +WSE+K+GL+  Q LL++ R L+ ++LK+  E+   +F D  SK                    +F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q  L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+ +   AP  V   E  LA     V+ I+ W  E K  ++RK + A+L+ L  L+      +   LP           KT  DG         +K+L++   H KNT   GS A    G       PR        V +  N SQ  P+  +      +M  EDI + ++  TE +Q  +V          +R DG    DG R
Sbjct:  623 MRQTEDVAEVLNRCASANWSERKEGLLGLQALLKNQRTLSRVELKRLCEIFTRMFADPHSKRDSGRVYGTAESGISSASFKVFSMFLETLVDFILVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQRALDITRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEAPDFVNSSETRLA-----VSRIITWTTEPKSSDVRKAAQAVLIALFQLNTPEFTMLLAALP-----------KTFQDG--------ATKLLQN---HLKNT---GSVAQAPMGSPLTRHTPRSPASWSSPVTSPTNTSQNTPSPSAFDYDTENMNSEDIYSSLKGVTEAIQNFSVRSQEDMNDPVQRRDGEELVDGGR 969          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:101157230])

HSP 1 Score: 174.866 bits (442), Expect = 1.025e-43
Identity = 89/204 (43.63%), Postives = 136/204 (66.67%), Query Frame = 1
Query: 2881 STLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETI 3492
            S L  ++++  +L EL   N+R E+RKA L +L+ L+REN ++ W+E FKTIL+ LL+T+ D +  IRTL+LRVL+E+    P RF ++  LT++K L +HKD  K VVRAAEE + ++A  +S   C+KVL  ++   D  +NL A+KM  +V++ +P   L+S L  +VPGL++  ++ ES +RKA +FCLV I   IGE +
Sbjct: 1217 SGLDQSELVAELLKELSNHNERIEERKAALWELLKLIRENTLQVWDEHFKTILLLLLETMGDREHVIRTLALRVLREILGKQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEETAAMLALSISPEQCIKVLCPIIQSADYPINLAAIKMQTKVVERIPREGLISMLPEIVPGLVQGYDNSESSVRKACVFCLVAIYAVIGEDL 1420          

HSP 2 Score: 143.28 bits (360), Expect = 6.540e-34
Identity = 80/251 (31.87%), Postives = 141/251 (56.18%), Query Frame = 1
Query:   28 SASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV-SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKM 777
            SA++ P+ T   +     AVA  +DE+ F   F+ +   ++ ++R+L+  + +I      +  DW++R  ALK ++S+  +  +  + F  +LR L    +    DLRSQVVREAC+ VA+L+ +L  + +   +A +P L +LIPN A++MA SG++ + II+ + H  +++  ++S   SKS + RR     L+ +   W    LE+    L  +++KG+ D D EAR  +R A+ G   +FP EA+ +
Sbjct:  273 SAARRPSATGGKLVSKESAVA--IDEEDFVKAFTDVPTVQIYSARDLEGNLNKIREICSDDKHDWDQRANALKKIRSLLVAGAAGYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAHLSSVLGNKFDHGAEAIVPVLFNLIPNCAKVMAMSGVSAIRIIIRHTHVPRLIPLITSNCTSKSVAVRRRCYDFLDLLLQEWQTHSLERHTAVLVESIKKGIHDPDSEARVEARKAYWGLRNHFPAEADAL 521          

HSP 3 Score: 126.716 bits (317), Expect = 6.253e-29
Identity = 107/357 (29.97%), Postives = 168/357 (47.06%), Query Frame = 1
Query: 1465 IKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIV--APSTV--MEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRD-------VYTNRNKSQLKPTSGS----ANSMTQEDIDNYIRRNTEDLQALAV--------AYERYDG---TDGNR 2454
            ++ +E+  E+L + +S +WSE+K+GL+  Q LL++ R L+ ++LK+  E+   +F D  SK+F +FL  +   I  HK  L DWL+ LL  L+ K  A+ L S Q  +Q  L+  R  FP ++Q     R  +D  Q   +K K++I+ + +T+ +   AP  V   E  LA     V+ I+ W  E K  ++RK + A+L+ L  L+      +   LP           KT  DG         +K+L++   H KNT   GS A    G       PR        V +  N SQ  P+  +      +M  EDI + ++  TE +Q  +V          +R DG    DG R
Sbjct:  841 MRQTEDVAEVLNRCASANWSERKEGLLGLQALLKNQRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFILVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQRALDITRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEAPDFVNSSETRLA-----VSRIITWTTEPKSSDVRKAAQAVLIALFQLNTPEFTMLLAALP-----------KTFQDG--------ATKLLQN---HLKNT---GSVAQAPMGSPLTRHTPRSPASWSSPVTSPTNTSQNTPSPSAFDYDTENMNSEDIYSSLKGVTEAIQNFSVRSQEDMNDPVQRRDGEELVDGGR 1167          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: CLASP1 (H(+)/Cl(-) exchange transporter 4 [Source:NCBI gene;Acc:101155751])

HSP 1 Score: 164.851 bits (416), Expect = 1.350e-40
Identity = 83/249 (33.33%), Postives = 149/249 (59.84%), Query Frame = 1
Query:   82 AVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            A AGAVDE+ F   F  +   ++ ++RE++E + +I   L  +  DWE RV ALK L+S+  +  +  + F+  LR ++   +    DLRSQVVREAC+ + Y + +L  R +   +A MP+L++L+PNSA++MATSG+  + +I+ + H  +++  ++S   SK+ + RR   + ++ +   W  + LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++   ++S  +  L+  L
Sbjct:  288 ATAGAVDEEDFIQAFEDVPSIQIYSNREVEEALTKIRDVLSDDKRDWELRVAALKKLRSLLLAGAAEFDGFLQQLRLMEAAFKLSAKDLRSQVVREACITLGYFSLVLGGRFDHAAEAVMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIPIITSNCTSKAVAVRRRCFEFVDLLLHEWQASSLERHVAVLMETIKKGIHDADAEARSVARKCYWGFHAHFSREAEQLFQALESSYQKALQAHL 536          

HSP 2 Score: 149.443 bits (376), Expect = 6.943e-36
Identity = 85/202 (42.08%), Postives = 132/202 (65.35%), Query Frame = 1
Query: 2950 EQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            E+R+  L++L+ + RE+A+  W+E FKT+L+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM    ++ + +  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +  YL  L+ SK +LL LYI++
Sbjct: 1325 EERRGTLLELLKVAREDALMVWDEHFKTMLLLLLETLGDKDHTIRALALRVLKEILRNQPARFKNYAELTIMKALEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTADYPINLAAIKMQTRAIERISKEPLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKR 1526          

HSP 3 Score: 120.168 bits (300), Expect = 8.189e-27
Identity = 63/188 (33.51%), Postives = 104/188 (55.32%), Query Frame = 1
Query: 1477 ENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRK 2034
            E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK+F +FL  +   +  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP E Q     R ++D  Q   +K K++I+ + + +   + P+  +  S   L   V+ I+ W  E K  ++RK
Sbjct:  859 EDVAEVLNHCASANWSERKEGLLGLQNLLKSQRMLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVVLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPYEQQFNILMRFIVDQTQTPNLKVKVAILRYIEALARQMDPADFVNSSETRL--AVSRIITWTTEPKSSDVRK 1044          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: CLASP1 (H(+)/Cl(-) exchange transporter 4 [Source:NCBI gene;Acc:101155751])

HSP 1 Score: 164.851 bits (416), Expect = 1.440e-40
Identity = 83/249 (33.33%), Postives = 149/249 (59.84%), Query Frame = 1
Query:   82 AVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            A AGAVDE+ F   F  +   ++ ++RE++E + +I   L  +  DWE RV ALK L+S+  +  +  + F+  LR ++   +    DLRSQVVREAC+ + Y + +L  R +   +A MP+L++L+PNSA++MATSG+  + +I+ + H  +++  ++S   SK+ + RR   + ++ +   W  + LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++   ++S  +  L+  L
Sbjct:  288 ATAGAVDEEDFIQAFEDVPSIQIYSNREVEEALTKIRDVLSDDKRDWELRVAALKKLRSLLLAGAAEFDGFLQQLRLMEAAFKLSAKDLRSQVVREACITLGYFSLVLGGRFDHAAEAVMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIPIITSNCTSKAVAVRRRCFEFVDLLLHEWQASSLERHVAVLMETIKKGIHDADAEARSVARKCYWGFHAHFSREAEQLFQALESSYQKALQAHL 536          

HSP 2 Score: 149.443 bits (376), Expect = 8.300e-36
Identity = 85/202 (42.08%), Postives = 132/202 (65.35%), Query Frame = 1
Query: 2950 EQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            E+R+  L++L+ + RE+A+  W+E FKT+L+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM    ++ + +  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +  YL  L+ SK +LL LYI++
Sbjct: 1290 EERRGTLLELLKVAREDALMVWDEHFKTMLLLLLETLGDKDHTIRALALRVLKEILRNQPARFKNYAELTIMKALEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTADYPINLAAIKMQTRAIERISKEPLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKR 1491          

HSP 3 Score: 119.783 bits (299), Expect = 1.053e-26
Identity = 63/188 (33.51%), Postives = 104/188 (55.32%), Query Frame = 1
Query: 1477 ENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRK 2034
            E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK+F +FL  +   +  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP E Q     R ++D  Q   +K K++I+ + + +   + P+  +  S   L   V+ I+ W  E K  ++RK
Sbjct:  824 EDVAEVLNHCASANWSERKEGLLGLQNLLKSQRMLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVVLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPYEQQFNILMRFIVDQTQTPNLKVKVAILRYIEALARQMDPADFVNSSETRL--AVSRIITWTTEPKSSDVRK 1009          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: CLASP1 (H(+)/Cl(-) exchange transporter 4 [Source:NCBI gene;Acc:101155751])

HSP 1 Score: 164.851 bits (416), Expect = 1.506e-40
Identity = 83/249 (33.33%), Postives = 149/249 (59.84%), Query Frame = 1
Query:   82 AVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVS-SSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL 825
            A AGAVDE+ F   F  +   ++ ++RE++E + +I   L  +  DWE RV ALK L+S+  +  +  + F+  LR ++   +    DLRSQVVREAC+ + Y + +L  R +   +A MP+L++L+PNSA++MATSG+  + +I+ + H  +++  ++S   SK+ + RR   + ++ +   W  + LE+ +  L   ++KG+ DAD EAR+++R  + GF  +F +EA ++   ++S  +  L+  L
Sbjct:  288 ATAGAVDEEDFIQAFEDVPSIQIYSNREVEEALTKIRDVLSDDKRDWELRVAALKKLRSLLLAGAAEFDGFLQQLRLMEAAFKLSAKDLRSQVVREACITLGYFSLVLGGRFDHAAEAVMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIPIITSNCTSKAVAVRRRCFEFVDLLLHEWQASSLERHVAVLMETIKKGIHDADAEARSVARKCYWGFHAHFSREAEQLFQALESSYQKALQAHL 536          

HSP 2 Score: 149.058 bits (375), Expect = 9.156e-36
Identity = 85/202 (42.08%), Postives = 132/202 (65.35%), Query Frame = 1
Query: 2950 EQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEK 3555
            E+R+  L++L+ + RE+A+  W+E FKT+L+ LL+T+ D D  IR L+LRVL+E+ +  P RF ++  LT++K L +HKDS K VVRAAEE +  +A  +    C+KVL  ++   D  +NL A+KM    ++ + +  L   L  ++PGL++  ++ ES +RKAS+FCLV I   IGE +  YL  L+ SK +LL LYI++
Sbjct: 1352 EERRGTLLELLKVAREDALMVWDEHFKTMLLLLLETLGDKDHTIRALALRVLKEILRNQPARFKNYAELTIMKALEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTADYPINLAAIKMQTRAIERISKEPLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKR 1553          

HSP 3 Score: 126.331 bits (316), Expect = 1.089e-28
Identity = 68/213 (31.92%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 1477 ENTQEILRQLSSVHWSEKKDGLINFQNLLQS-RKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVV-IVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLP 2109
            E+  E+L   +S +WSE+K+GL+  QNLL+S R L+ ++LK+  E+   +F D  SK+F +FL  +   +  H+  L DWL+ LL  L+ K  A+ L S Q  +Q+ L+  R  FP E Q     R ++D  Q   +K K++I+ + + +   + P+  +  S   L   V+ I+ W  E K  ++RK +  +L+ L  L+      +   LP
Sbjct:  878 EDVAEVLNHCASANWSERKEGLLGLQNLLKSQRMLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVVLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPYEQQFNILMRFIVDQTQTPNLKVKVAILRYIEALARQMDPADFVNSSETRL--AVSRIITWTTEPKSSDVRKAAQVVLIALFELNTPEFTMLLGALP 1088          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000016277.1 (SMESG000016277.1)

HSP 1 Score: 2318.5 bits (6007), Expect = 0.000e+0
Identity = 1193/1193 (100.00%), Postives = 1193/1193 (100.00%), Query Frame = 1
Query:   19 MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGYTYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXXLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSSRMTESNIAM 3597
            MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTSSYGNRSVKKSSVSDSGDELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGYTYKSSARTTPQSTRRSSSGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGSETSSIESSEVSRSSLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPESLLLSSLESMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYLQSLSSSKTRLLRLYIEKNNSSSRMTESNIAM
Sbjct:    1 MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTSSYGNRSVKKSSVSDSGDELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGYTYKSSARTTPQSTRRSSSGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGSETSSIESSEVSRSSLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPESLLLSSLESMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYLQSLSSSKTRLLRLYIEKNNSSSRMTESNIAM 1193          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000016277.1 (SMESG000016277.1)

HSP 1 Score: 2222.97 bits (5759), Expect = 0.000e+0
Identity = 1158/1193 (97.07%), Postives = 1158/1193 (97.07%), Query Frame = 1
Query:   19 MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGYTYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXXLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYXXXXXXXXXXXXXXYIEKNNSSSRMTESNIAM 3597
            MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTSSYGNRSVKKSSVSDSGDELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGYTYKSSARTTPQSTRRSSSGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGSETSSIESSEVSRSSLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKM                                   RDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPESLLLSSLESMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYLQSLSSSKTRLLRLYIEKNNSSSRMTESNIAM
Sbjct:    1 MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTSSYGNRSVKKSSVSDSGDELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGYTYKSSARTTPQSTRRSSSGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGSETSSIESSEVSRSSLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKM-----------------------------------RDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLGALKMLLEVLKNVPESLLLSSLESMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYLQSLSSSKTRLLRLYIEKNNSSSRMTESNIAM 1158          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 429.869 bits (1104), Expect = 5.529e-131
Identity = 363/1201 (30.22%), Postives = 602/1201 (50.12%), Query Frame = 1
Query:   79 QAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV--SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL-SFHPAGQVLAQFSNAKQRATNP-PTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSS---------LTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGY-TYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXXLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK---IMNLF----------KTSAD-GDLNSRLK---MRSKILRSNSFHDKNTENPGSK-ALDHYGYYGHSVKPRDVYTNRN--KSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTD-----GNRS----------YSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTN-YPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTD---------PEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDN-DCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWT 3498
            Q      +EDF   +  T E+ E+ + +EL+E +  I + L  +++DW+ RV  L+ L+ +  ++ F   ++F+  ++ L + +++C+SDLRSQVVREAC+ VA+L+  +K + +   +  + SL++L+ N  +IM+TSG   L  IV N +S ++L   +++   SKS S R+F S+LL+ IC +W+   LEK   N+  A++KG++DAD++ RA SR AF  F   FP+   K+L  +D  ++  L+KEL SF   G  +      K   TN   TT+K  TS   N                TG++R N +             ++I T   RG+      VS++  S+    S S  +GY TY              S+G +     NN       ++YSS RYK +             T   +GL     N  D              SDDN SETSS+ S ++         PS N  E++  L+S  W+++K GL   +  +    L  L+ K  I++ N++F + ++ +   FL  +   ++ +  +L DWLY L++ L+  QA E + S +  IQ+ LN +   +   +    CC+ V D      +K +L ++ + K ++ ++  ++++ +   L P +  I+ W  E+K  ++RKIS+ +++KL +L+      +   LP   + +   I+N +          +T++D GD    +K     SK  RSNSFH K T+   +K    +  Y  H+     V  ++   K +++P   S           +I+ NTE LQ L++  + +D T       N+S          Y +    N   +T+ S  P P  N N    N    +N   SY     Q  L + N +P   I N    +  S  P   N  + VDN       P Y +SG    P++   S  S++   + N   +    +  +G+Q L+KI+ LPP DM+  IL EL   N R E+RKACL +L+ + REN   +W+E FKT+L  LL+T+ D +          EIR  SLRVLQEL K+   RF ++T LT+LK+L +HKD +K+V++AAEECS+V+   + + +C+K+L +V++D  + ++ L ALKML++++KN     + + + ++   L     H+ES +RK S+ C+VE+++ IGE IW+
Sbjct:    5 QEFGAVTEEDFEQTFEQTPEI-EISSIKELRESLLNINNKL--HADDWQHRVDNLRILRGIIKANRFP-TDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFK--GDEIDSADVFKVPITNAVKTTVKSVTSKPSN---------------FTGRTRVNSAKSENPSAKPKTATARIDTSDPRGR---IQKVSQSQPSTR-DPSPSCKSGYITY--------------SNGASDYKYTNNFQKKASPNTYSSLRYKDAFE-----------TQVAEGLKKSRRNSHD-----------HYQSDDNTSETSSVISDQL---------PSFN--EVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHTKTTKVYNTKKTASNTTYSSHNSNMSSVSFHKRTPKQKIEPEKSSE----------FIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLN----NYSPANN--YSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNE-SNVDNKYN----PEYYSSG----PID--TSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS 1106          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 424.476 bits (1090), Expect = 1.645e-129
Identity = 351/1172 (29.95%), Postives = 582/1172 (49.66%), Query Frame = 1
Query:   79 QAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV--SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL-SFHPAGQVLAQFSNAKQRATNP-PTTLKLGTSSYGNRXXXXXXXXXXXXELITGKSRTNYSS---------LTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGY-TYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXXLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTD-----GNRS----------YSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTN-YPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDN-DCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWT 3498
            Q      +EDF   +  T E+ E+ + +EL+E +  I + L  +++DW+ RV  L+ L+ +  ++ F   ++F+  ++ L + +++C+SDLRSQVVREAC+ VA+L+  +K + +   +  + SL++L+ N  +IM+TSG   L  IV N +S ++L   +++   SKS S R+F S+LL+ IC +W+   LEK   N+  A++KG++DAD++ RA SR AF  F   FP+   K+L  +D  ++  L+KEL SF   G  +      K   TN   TT+K  TS   N                TG++R N +             ++I T   RG+      VS++  S+    S S  +GY TY              S+G +     NN       ++YSS RYK +             T   +GL     N  D              SDDN SETSS+ S ++         PS N  E++  L+S  W+++K GL   +  +    L  L+ K  I++ N++F + ++ +   FL  +   ++ +  +L DWLY L++ L+  QA E + S +  IQ+ LN +   +   +    CC+ V D      +K +L ++ + K ++ ++  ++++ +   L P +  I+ W  E+K  ++RKIS+ +++KL +L+      +   LP        N F+  A   LN+ L  +  +  + +  D                 G    P        K +++P   S           +I+ NTE LQ L++  + +D T       N+S          Y +    N   +T+ S  P P  N N    N    +N   SY     Q  L + N +P   I N    +  S  P   N  + VDN       P Y +SG    P++   S  S++   + N   +    +  +G+Q L+KI+ LPP DM+  IL EL   N R E+RKACL +L+ + REN   +W+E FKT+L  LL+T+ D + EIR  SLRVLQEL K+   RF ++T LT+LK+L +HKD +K+V++AAEECS+V+   + + +C+K+L +V++D  + ++ L ALKML++++KN     + + + ++   L     H+ES +RK S+ C+VE+++ IGE IW+
Sbjct:    5 QEFGAVTEEDFEQTFEQTPEI-EISSIKELRESLLNINNKL--HADDWQHRVDNLRILRGIIKANRFPT-DDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFK--GDEIDSADVFKVPITNAVKTTVKSVTSKPSN---------------FTGRTRVNSAKSENPSAKPKTATARIDTSDPRGR---IQKVSQSQPSTR-DPSPSCKSGYITY--------------SNGASDYKYTNNFQKKASPNTYSSLRYKDAFE-----------TQVAEGLKKSRRNSHD-----------HYQSDDNTSETSSVISDQL---------PSFN--EVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLP--------NTFQDRATSILNAYLSSQQAVRSTETASD----------------VGDCRTP--------KQKIEPEKSSE----------FIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLN----NYSPANN--YSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNE-SNVDNKYN----PEYYSSG----PID--TSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNESEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS 1045          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.425e-125
Identity = 351/1186 (29.60%), Postives = 589/1186 (49.66%), Query Frame = 1
Query:   79 QAVAGAVDEDFFYNYFSTIEVKEVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV--SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKEL-SFHPAGQVLAQFSNAKQRATNP-PTTLKLGTS--------SYGNRXXXXXXXXXXXXELITGKSRTNYS------SLTRSKIKTQSDRGQNIMTSSVSRAAESSNIRGSNSSLTGY-TYKXXXXXXXXXXXXXXXGTAPVITVNNGSVHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGXXXXXXXXXXXXXXXLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGTD-----GNRS----------YSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTN-YPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTD---------PEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDN-DCRVNLGALKMLLEVLKNVPXXXXXXXXXXMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWT 3498
            Q      +EDF   +  T E+ E+ + +EL+E +  I + L  +++DW+ RV  L+ L+ +  ++ F   ++F+  ++ L + +++C+SDLRSQVVREAC+ VA+L+  +K + +   +  + SL++L+ N  +IM+TSG   L  IV N +S ++L   +++   SKS S R+F S+LL+ IC +W+   LEK   N+  A++KG++DAD++ RA SR AF  F   FP+   K+L  +D  ++  L+KEL SF   G  +      K   TN   TT+K  TS        +  N +  ++  ++S  E +  K ++N+           ++I T   RG+      VS++  S+    S S  +GY TY              S+G +     NN       ++YSS RYK +             T   +GL     N  D              SDDN SETSS+ S ++         PS N  E++  L+S  W+++K GL   +  +    L  L+ K  I++ N++F + ++ +   FL  +   ++ +  +L DWLY L++ L+  QA E + S +  IQ+ LN +   +   +    CC+ V D      +K +L ++ + K ++ ++  ++++ +   L P +  I+ W  E+K  ++RKIS+ +++KL +L+      +   LP        N F+  A   LN+ L  +  +  + +  D                 G    P        K +++P   S           +I+ NTE LQ L++  + +D T       N+S          Y +    N   +T+ S  P P  N N    N    +N   SY     Q  L + N +P   I N    +  S  P   N  + VDN       P Y +SG    P++   S  S++   + N   +    +  +G+Q L+KI+ LPP DM+  IL EL   N R E+RKACL +L+ + REN   +W+E FKT+L  LL+T+ D +          EIR  SLRVLQEL K+   RF ++T LT+LK+L +HKD +K+V++AAEECS+V+   + + +C+K+L +V++D  + ++ L ALKML++++KN     + + + ++   L     H+ES +RK S+ C+VE+++ IGE IW+
Sbjct:    5 QEFGAVTEEDFEQTFEQTPEI-EISSIKELRESLLNINNKL--HADDWQHRVDNLRILRGIIKANRFP-TDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFK--GDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGR---IQKVSQSQPSTR-DPSPSCKSGYITY--------------SNGASDYKYTNNFQKKASPNTYSSLRYKDAFE-----------TQVAEGLKKSRRNSHD-----------HYQSDDNTSETSSVISDQL---------PSFN--EVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLP--------NTFQDRATSILNAYLSSQQAVRSTETASD----------------VGDCRTP--------KQKIEPEKSSE----------FIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLN----NYSPANN--YSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNE-SNVDNKYN----PEYYSSG----PID--TSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS 1074          
The following BLAST results are available for this feature:
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLASP11.434e-7329.47cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP12.947e-7229.43cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP14.820e-7229.43cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP14.970e-7229.43cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP28.704e-7228.93cytoplasmic linker associated protein 2 [Source:HG... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cls-21.221e-2226.86pep chromosome:WBcel235:III:9055052:9058843:1 gene... [more]
cls-21.221e-2226.86pep chromosome:WBcel235:III:9055052:9058882:1 gene... [more]
cls-21.235e-2226.86pep chromosome:WBcel235:III:9055052:9058849:1 gene... [more]
cls-21.235e-2226.86pep chromosome:WBcel235:III:9055052:9058882:1 gene... [more]
cls-36.653e-1927.00pep chromosome:WBcel235:III:9186556:9191127:-1 gen... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
chb1.446e-2829.32gene:FBgn0021760 transcript:FBtr0089460[more]
chb1.446e-2829.32gene:FBgn0021760 transcript:FBtr0089461[more]
chb1.446e-2829.32gene:FBgn0021760 transcript:FBtr0089462[more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clasp1a8.860e-7128.29cytoplasmic linker associated protein 1a [Source:Z... [more]
clasp24.058e-4143.22cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp24.120e-4143.22cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp28.316e-4143.22cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp1a4.153e-4041.92cytoplasmic linker associated protein 1a [Source:Z... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clasp11.023e-7329.56CLIP associating protein 1 [Source:MGI Symbol;Acc:... [more]
Clasp16.072e-7329.52CLIP associating protein 1 [Source:MGI Symbol;Acc:... [more]
Clasp27.507e-7329.07CLIP associating protein 2 [Source:MGI Symbol;Acc:... [more]
Clasp21.239e-7229.07CLIP associating protein 2 [Source:MGI Symbol;Acc:... [more]
Clasp11.400e-7229.00CLIP associating protein 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99JD4|CLAP2_RAT7.517e-7229.21CLIP-associating protein 2 OS=Rattus norvegicus OX... [more]
sp|Q8BRT1|CLAP2_MOUSE8.452e-7229.07CLIP-associating protein 2 OS=Mus musculus OX=1009... [more]
sp|Q80TV8|CLAP1_MOUSE1.235e-7129.00CLIP-associating protein 1 OS=Mus musculus OX=1009... [more]
sp|O75122|CLAP2_HUMAN1.185e-6928.89CLIP-associating protein 2 OS=Homo sapiens OX=9606... [more]
sp|Q7Z460|CLAP1_HUMAN4.668e-4237.74CLIP-associating protein 1 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of CLIP-associating protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RUN06.571e-16932.51CLIP-associating protein 1 OS=Fasciola hepatica OX... [more]
A0A068WE237.206e-15330.95CLIP associating protein 1 OS=Echinococcus granulo... [more]
A0A068YGV21.111e-15131.16CLIP associating protein 1 OS=Echinococcus multilo... [more]
A0A564YML93.469e-14630.51Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YKJ32.456e-14531.08Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clasp1a1.832e-7129.00cytoplasmic linker associated protein 1a [Source:Z... [more]
CLASP18.807e-4135.78cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP18.885e-4135.78cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP18.989e-4135.78cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP19.189e-4135.78cytoplasmic linker associated protein 1 [Source:HG... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003792.18.751e-6227.73pep scaffold:Pmarinus_7.0:GL477033:101956:230147:1... [more]
ENSPMAT00000006778.15.250e-3936.48pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 ge... [more]
ENSPMAT00000006783.17.385e-3936.48pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 ge... [more]
ENSPMAT00000008085.15.275e-3834.20pep scaffold:Pmarinus_7.0:GL476334:564674:633296:-... [more]
ENSPMAT00000002178.13.520e-2739.87pep scaffold:Pmarinus_7.0:GL493696:28:2121:1 gene:... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO448201.088e-3435.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clasp24.100e-4443.63cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp21.025e-4343.63cytoplasmic linker associated protein 2 [Source:NC... [more]
CLASP11.350e-4033.33H(+)/Cl(-) exchange transporter 4 [Source:NCBI gen... [more]
CLASP11.440e-4033.33H(+)/Cl(-) exchange transporter 4 [Source:NCBI gen... [more]
CLASP11.506e-4033.33H(+)/Cl(-) exchange transporter 4 [Source:NCBI gen... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016277.10.000e+0100.00SMESG000016277.1[more]
SMESG000016277.10.000e+097.07SMESG000016277.1[more]
SMESG000072426.15.529e-13130.22SMESG000072426.1[more]
SMESG000072426.11.645e-12929.95SMESG000072426.1[more]
SMESG000072426.11.425e-12529.60SMESG000072426.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019032 ID=SMED30019032|Name=CLIP-associating protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3634bp
TATATAAATCTTATATGAATGTCTCGGTCAGCATCTCAAACACCTAATCT
AACGAGGAAAAACATTCCGAAAACTAATCAAGCTGTTGCTGGTGCTGTTG
ATGAGGACTTTTTCTACAACTATTTCTCCACCATTGAGGTGAAAGAGGTC
GGCAACTCTAGGGAGCTGCAAGAAGTCATTGGAGAAATCATATCTGGATT
AAAAGGCAACAGCGAAGACTGGGAAAAGCGAGTGAAAGCGCTGAAAACTC
TTCAATCAGTTTCCTCCTCCTTTTCAAATATGGAAGAATTTATATCATAC
CTTCGGCAGTTGCAAGTGCCTTTGCAATCTTGTCTATCTGATTTGAGGTC
CCAGGTCGTCCGGGAAGCATGTTTAGCTGTAGCTTATCTAACTCATATTC
TGAAAATCCGAGCCGAAGTCCTAACAGATGCCTTCATGCCATCTCTAATC
AGCCTCATTCCTAATAGCGCAAGAATTATGGCTACAAGTGGAATGACTTG
TCTTTCTATTATTGTCACGAACATTCATTCAGCAAAGGTCCTGATTCATG
TTTCATCGGCCATGAATTCCAAGTCTAATTCCACGAGGAGGTTTGCCAGC
AAACTGTTGGAAACTATTTGCTCATCGTGGGATCCGACAGTATTAGAAAA
ACAATTACCAAACCTTCAAAATGCCCTTGAAAAAGGAATGGCTGACGCTG
ATCAAGAAGCCAGAGCAATATCACGCAGTGCGTTTATTGGATTCGTTTTG
AACTTTCCTCAAGAAGCCAATAAAATGTTGGTGCTCATGGATTCTGGTCG
GAGAAGTTTGCTGGAAAAGGAGCTGTCCTTTCACCCTGCCGGCCAAGTAC
TCGCTCAATTTAGTAACGCAAAACAGAGAGCAACGAATCCTCCGACCACA
TTAAAACTTGGCACAAGTAGTTATGGAAATAGGTCAGTAAAGAAGAGTTC
GGTTTCTGACAGTGGAGATGAATTAATTACCGGGAAATCGAGGACTAATT
ATTCTTCTTTAACACGCTCGAAAATCAAAACTCAGTCAGACCGAGGCCAA
AATATCATGACATCATCTGTTTCACGGGCAGCTGAATCGTCAAATATCAG
AGGCAGTAATTCCAGTTTAACTGGGTACACGTATAAAAGTTCCGCCAGAA
CGACGCCTCAATCAACACGCAGGTCGTCCAGTGGCACTGCTCCGGTAATT
ACGGTAAATAATGGCTCAGTCCACACCAAGAATGACTCGTATTCATCTTA
CCGATACAAAACATCGGGCTCCGTTTCGGCATCTTTACCAAGGAGAAAAA
ATTTAACCTCAACTGGAAAAGGTTTATATTCCGGGTTCGAAAATGGTGTG
GACCCGCCAAATAGTGGCTTATTAAGCAGAAGGAGAATGGACAGTTCTGA
TGACAATGGCAGTGAGACTTCGTCGATCGAGTCTTCTGAAGTGTCTAGAT
CTAGTCTAAGAGCTATCAAACCCAGTGAGAATACGCAGGAAATATTGCGT
CAACTCTCCTCCGTTCATTGGTCAGAAAAAAAAGATGGATTGATCAATTT
TCAAAATTTGCTTCAGAGCAGAAAATTAAACACTTTAGATTTGAAAAAAT
ATATTGAGGTGCTCAACACTTTATTTAATGACACAAAAAGCAAAATCTTT
CCTCTGTTTTTGATTTGTATCCAACAACTGATCGAGAATCATAAGCAGTA
TTTGTTTGATTGGCTGTATCCACTGCTTTTGAATTTGATTTCGAAACAAG
CTGCTGAAACCTTAGCAAGCCGTCAGAAGCCAATACAGGAAACCCTAAAT
ACAATTAGGTCCCAGTTCCCTCTGGAAATCCAGGTCCGTGACTGCTGTCG
GGTGGTGATTGACAGCTATCAAAATACCGGCATGAAATTCAAATTGTCAA
TAATGGCATTTTTCAAGACTGTCGTTATCGTGGCCCCCTCAACAGTGATG
GAACAGTCTCTGGCCAGCCTCACTCCTACTGTCAATATCATTGTAGAATG
GATATTCGAGTCGAAATGGCAAGAAATCAGAAAGATATCAAACGCATTGC
TGTTGAAGTTGCACAATCTTCACCCCCAGGTCATGGAGGCAATATCAAAT
TGTTTACCGCCGGTTACAAGACAGAAAATTATGAATCTCTTCAAGACATC
TGCCGATGGAGATTTGAATAGTCGACTGAAAATGAGAAGCAAAATTTTGC
GATCAAACTCTTTCCACGATAAAAACACCGAAAATCCTGGGTCCAAGGCT
CTGGATCACTATGGTTACTATGGGCACTCGGTCAAGCCGCGGGACGTGTA
CACAAATAGGAACAAATCCCAATTGAAACCAACATCAGGCTCGGCTAATT
CAATGACACAGGAAGATATTGACAATTATATTCGAAGAAACACAGAAGAT
TTGCAAGCGTTAGCAGTTGCCTATGAACGCTACGACGGGACAGATGGAAA
CCGCTCGTACTCTAGGACGCGTCCATACAATAGCCAGCTGAGAACACAAC
TCAGTGATCCACCGTATCCAGATGGCAATGCAAATGGGAACCATATCAAT
CAGGGCATGGTCTCAAATTCCGCAGCCAGTTATATGATCAACAGATTTCA
GTCTTCTTTGCGAAATACTAATTACCCTCCTTCTGGTATCAGCAACAGCT
CAGATATGCTGCAGGATTCATTCTCACCGCACAACAGAAACTTGTTGGCT
GGTGTGGACAACTCTTTGGCCTACAGTTGCTATCCGAATTATGATGCAAG
TGGTTACAATTACTATCCAGTGAATGATGCCGCCTCAACTTTATCCGATC
AGATGCTAATGAAAATGAACACTTCAGATGTATACTTGCAGTCTCAGTGT
CCAATGGGCTTCCAAATGCTTCAGAAAATCTCCACCCTACCTCCGAACGA
TATGATCGTGACAATTCTCGCGGAACTATGTTATCTAAATCAAAGGACCG
AGCAGAGAAAGGCCTGCCTGATGAAGTTAATGAATTTGGTGAGAGAGAAT
GCAGTCGAGAATTGGAATGAGGTATTCAAGACGATTCTGATGAGACTACT
CGACACAGTGAAAGATACAGATCCAGAAATTCGCACTTTGTCGTTGAGAG
TACTGCAGGAGCTAACAAAGACAATGCCCCAAAGATTTGATGATTTCACT
CATTTGACAGTATTGAAGATTTTACACTCCCACAAGGATTCTGACAAAAC
AGTTGTCCGTGCAGCGGAAGAATGCAGCCAAGTCATGGCCCGGTGTCTGT
CACAGAATCTCTGTATGAAGGTCTTATCTGAGGTTCTCAATGACAATGAT
TGTCGAGTAAATCTTGGAGCATTGAAAATGCTGCTTGAAGTTCTTAAAAA
TGTTCCTGAGTCTTTGTTACTGTCATCACTGGAAAGCATGGTGCCTGGTC
TCATTAGGACATCTGAACACGAAGAGAGTCACATTCGGAAAGCGAGTATT
TTCTGCTTGGTGGAAATTAACAGGAAGATCGGTGAGACAATTTGGACCTA
TTTGCAAAGTCTCAGCAGTAGCAAAACTCGACTGCTTCGTTTGTATATTG
AGAAAAACAATTCATCCTCGAGAATGACAGAGTCGAACATTGCCATGTAA
ACCAGAGCTCCGTGGAGTCGGTCTCTCTCGCGCT
back to top

protein sequence of SMED30019032-orf-1

>SMED30019032-orf-1 ID=SMED30019032-orf-1|Name=SMED30019032-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1194bp
MSRSASQTPNLTRKNIPKTNQAVAGAVDEDFFYNYFSTIEVKEVGNSREL
QEVIGEIISGLKGNSEDWEKRVKALKTLQSVSSSFSNMEEFISYLRQLQV
PLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNS
ARIMATSGMTCLSIIVTNIHSAKVLIHVSSAMNSKSNSTRRFASKLLETI
CSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEA
NKMLVLMDSGRRSLLEKELSFHPAGQVLAQFSNAKQRATNPPTTLKLGTS
SYGNRSVKKSSVSDSGDELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSS
VSRAAESSNIRGSNSSLTGYTYKSSARTTPQSTRRSSSGTAPVITVNNGS
VHTKNDSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSG
LLSRRRMDSSDDNGSETSSIESSEVSRSSLRAIKPSENTQEILRQLSSVH
WSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLIC
IQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQF
PLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLAS
LTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVT
RQKIMNLFKTSADGDLNSRLKMRSKILRSNSFHDKNTENPGSKALDHYGY
YGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAV
AYERYDGTDGNRSYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSN
SAASYMINRFQSSLRNTNYPPSGISNSSDMLQDSFSPHNRNLLAGVDNSL
AYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQM
LQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWN
EVFKTILMRLLDTVKDTDPEIRTLSLRVLQELTKTMPQRFDDFTHLTVLK
ILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDNDCRVNLG
ALKMLLEVLKNVPESLLLSSLESMVPGLIRTSEHEESHIRKASIFCLVEI
NRKIGETIWTYLQSLSSSKTRLLRLYIEKNNSSSRMTESNIAM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR034085TOG
IPR028399CLASP_1
IPR024395CLASP_N_dom
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0043515kinetochore binding
GO:0051010microtubule plus-end binding
Vocabulary: cellular component
TermDefinition
GO:0005828kinetochore microtubule
GO:0005881cytoplasmic microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034085TOG domainSMARTSM01349TOG_3coord: 962..1186
e-value: 2.9E-16
score: 70.0
coord: 49..274
e-value: 7.7E-7
score: 38.7
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 484..712
e-value: 1.1E-40
score: 141.8
coord: 962..1180
e-value: 2.1E-27
score: 98.3
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 26..277
e-value: 1.5E-57
score: 197.1
IPR024395CLASP N-terminal domainPFAMPF12348CLASP_Ncoord: 55..265
e-value: 5.6E-31
score: 107.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..481
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..401
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 463..481
NoneNo IPR availablePANTHERPTHR21567CLASPcoord: 457..1187
NoneNo IPR availablePANTHERPTHR21567CLASPcoord: 18..405
IPR028399CLIP-associating protein 1PANTHERPTHR21567:SF28CLIP-ASSOCIATING PROTEIN 1coord: 457..1187
IPR028399CLIP-associating protein 1PANTHERPTHR21567:SF28CLIP-ASSOCIATING PROTEIN 1coord: 18..405
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 49..1169