MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30019025
Length (bp)2284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30019025) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30019025) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019025

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019025h1SMcG0007234 Contig1397newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019025h1SMcG0007234 Contig1397uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30019025h1SMcG0007234 SmedASXL_015223SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019025h1SMcG0007234 dd_Smed_v4_15464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019025h1SMcG0007234 dd_Smed_v4_15464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019025h1SMcG0007234 dd_Smed_v6_15464_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: Sugb (gene:FBgn0036191 transcript:FBtr0273362)

HSP 1 Score: 68.5514 bits (166), Expect = 1.329e-11
Identity = 67/265 (25.28%), Postives = 116/265 (43.77%), Query Frame = 3
Query:  783 SAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQ----YSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMI-----FMGASPF------LLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNV 1532
            + + S+ D++ F  L  D  H +G  R+ GSLG   F+L+  L                + + M L +    Y+  F +  L+    +  S  L++     S +  K    +F +     F L+ VA G  T+++  + F+ +     +L K F G   SI T+  ++     F G  PF      +L  + +   +S+    + ++++ Y  + N W ++ IEL+NG  FGL    M SY S  A   T   MQS+  ++F  V
Sbjct:  269 AVVVSIGDAICFGIL-GDRHHLYGKQRLCGSLGWGVFALLAGL----------------LVDHMSLGEVNKNYTAVFWMALLIMGFDVFASSKLRHTPTHLSSNILKDVGQMFLSVRCVIFFLWCVAIGLGTALIWNFLFIYL----EELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGV 512          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: Sugb (gene:FBgn0036191 transcript:FBtr0344966)

HSP 1 Score: 68.1662 bits (165), Expect = 1.778e-11
Identity = 67/265 (25.28%), Postives = 116/265 (43.77%), Query Frame = 3
Query:  783 SAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQ----YSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMI-----FMGASPF------LLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNV 1532
            + + S+ D++ F  L  D  H +G  R+ GSLG   F+L+  L                + + M L +    Y+  F +  L+    +  S  L++     S +  K    +F +     F L+ VA G  T+++  + F+ +     +L K F G   SI T+  ++     F G  PF      +L  + +   +S+    + ++++ Y  + N W ++ IEL+NG  FGL    M SY S  A   T   MQS+  ++F  V
Sbjct:  269 AVVVSIGDAICFGIL-GDRHHLYGKQRLCGSLGWGVFALLAGL----------------LVDHMSLGEVNKNYTAVFWMALLIMGFDVFASSKLRHTPTHLSSNILKDVGQMFLSVRCVIFFLWCVAIGLGTALIWNFLFIYL----EELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGV 512          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: Sugb (gene:FBgn0036191 transcript:FBtr0300100)

HSP 1 Score: 68.1662 bits (165), Expect = 1.933e-11
Identity = 67/265 (25.28%), Postives = 116/265 (43.77%), Query Frame = 3
Query:  783 SAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQ----YSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMI-----FMGASPF------LLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNV 1532
            + + S+ D++ F  L  D  H +G  R+ GSLG   F+L+  L                + + M L +    Y+  F +  L+    +  S  L++     S +  K    +F +     F L+ VA G  T+++  + F+ +     +L K F G   SI T+  ++     F G  PF      +L  + +   +S+    + ++++ Y  + N W ++ IEL+NG  FGL    M SY S  A   T   MQS+  ++F  V
Sbjct:  269 AVVVSIGDAICFGIL-GDRHHLYGKQRLCGSLGWGVFALLAGL----------------LVDHMSLGEVNKNYTAVFWMALLIMGFDVFASSKLRHTPTHLSSNILKDVGQMFLSVRCVIFFLWCVAIGLGTALIWNFLFIYL----EELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGV 512          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0340024)

HSP 1 Score: 56.6102 bits (135), Expect = 6.903e-8
Identity = 60/258 (23.26%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  780 FSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKS-SLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKNDVPK--HSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHM------FHDLPKYFPGLVFSIFTIS-EMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIEL-LNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSL 1520
            F+  +S++D+  F  L  +E  K+G  RV+G++G  A +++  + +  +     KS + +LI             I+C    + +   S   K  +PK   S+S W     + R   +  FL FA   G + S +I + F  +  +       H + K   GLV +   ++ E+ F   S  ++  L     +S+ F  +A++     ++ N W L+ +EL   G  + L   C+++Y S  A   T   +Q + + +
Sbjct:  219 FNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNWWTTDAVKSLTPALI-------------IMCVFSLLDLFSVS---KLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQI-KLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0344080)

HSP 1 Score: 56.6102 bits (135), Expect = 6.903e-8
Identity = 60/258 (23.26%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  780 FSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKS-SLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKNDVPK--HSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHM------FHDLPKYFPGLVFSIFTIS-EMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIEL-LNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSL 1520
            F+  +S++D+  F  L  +E  K+G  RV+G++G  A +++  + +  +     KS + +LI             I+C    + +   S   K  +PK   S+S W     + R   +  FL FA   G + S +I + F  +  +       H + K   GLV +   ++ E+ F   S  ++  L     +S+ F  +A++     ++ N W L+ +EL   G  + L   C+++Y S  A   T   +Q + + +
Sbjct:  219 FNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNWWTTDAVKSLTPALI-------------IMCVFSLLDLFSVS---KLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQI-KLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267FST2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g3 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.247e-19
Identity = 109/463 (23.54%), Postives = 208/463 (44.92%), Query Frame = 3
Query:  180 LFMYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREXXXXXXXLCVLLNEFQIAIPK--NYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSC----WPSILTNCSRNSTPVEISPLSLFPANITCSSFQ----VYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSGXXXXXXXXXXXXXXXXXHGLFSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNVEK 1538
            L MYL  F+ + G+   EL +I+ + +I  FL RP+ G +AD++Q YR +++   +L     +  + +P+      +N TF       ND       ++C+A  ++ +      P  L NC ++++   +   ++   N   S       +Y+    N ++  +S  S++   C   Q+ + + K   +     L   +           +S +  L D+VTF  L    S  +G TR++GS GI   +L+T  +LY + +A    +            Y+  FIL  ++       +  LK      + +  K+   +  ++ +  F +  +  G    +  E +  ++L    D P YF G++F++  + E      S  +++ +       I FL +A+++L    V N WLL+ +  L+G +FGLM P M+ + +K A +  QG +Q + S L+F V +
Sbjct:   24 LIMYLNMFLMQRGINEFELGLIDTVGYIVGFLMRPVCGAVADRYQAYRPVLLALMLLSAAGFDGMLLLPQPLQAAAYNETFSIVNASYND---TGYASLCLATDSMTNNSYYQAPISLCNC-KSASKDRLDRGTITRLNFLGSESDKQCILYEPASYNYSAKFVSNNSKL--ICKACQLTNSSSKAKSNWNVNFLLALVLKTIGLAG---YSPLLCLLDAVTFSLLGPKPSD-YGWTRMYGSFGIFITALLTGFALYGYSMAWSFRT-----------DYTASFILATVLLAVAAAVTVTLKVPTSTRTLNPLKALPLMCLSWRIGIFYILVLLSGAAFGIF-ESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQAPEGWQGTVQGLVSGLYFGVGQ 464          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8JJH3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g2 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.460e-19
Identity = 108/463 (23.33%), Postives = 208/463 (44.92%), Query Frame = 3
Query:  180 LFMYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREXXXXXXXLCVLLNEFQIAIPK--NYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSC----WPSILTNCSRNSTPVEISPLSLFPANITCSSFQ----VYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSGXXXXXXXXXXXXXXXXXHGLFSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNVEK 1538
            L MYL  F+ + G+   EL +I+ + +I  FL RP+ G +AD++Q YR +++   +L     +  + +P+      +N TF       ND       ++C+A  ++ +      P  L NC ++++   +   ++   N   S       +Y+    N ++  +S  S++   C   Q+ + + K   +     L   +           +S +  L D+VTF  L    S  +G TR++GS GI   +L+T  +LY + +A    +            Y+  FIL  ++       +  LK      + +  K+   +  ++ +  F +  +  G    +  E +  ++L    D P YF G++F++  + E      S  +++ +       I FL +A+++L    V N WLL+ +  L+G +FGLM P M+ + +K + +  QG +Q + S L+F V +
Sbjct:   24 LIMYLNMFLMQRGINEFELGLIDTVGYIVGFLMRPVCGAVADRYQAYRPVLLALMLLSAAGFDGMLLLPQPLQAAAYNETFSIVNASYND---TGYASLCLATDSMTNNSYYQAPISLCNC-KSASKDRLDRGTITRLNFLGSESDKQCILYEPASYNYSAKFVSNNSKL--ICKACQLTNSSSKAKSNWNVNFLLALVLKTIGLAG---YSPLLCLLDAVTFSLLGPKPSD-YGWTRMYGSFGIFITALLTGFALYGYSMAWSFRT-----------DYTASFILATVLLAVAAAVTVTLKVPTSTRTLNPLKALPLMCLSWRIGIFYILVLLSGAAFGIF-ESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQSPEGWQGTVQGLVSGLYFGVGQ 464          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A4Z2D5B1 (Major facilitator superfamily domain-containing 6-like (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_004423 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.275e-17
Identity = 114/474 (24.05%), Postives = 216/474 (45.57%), Query Frame = 3
Query:  171 VSCLFMYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLAD--KFQRYREXXXXXXXLCVLLNEFQIAIPKNYNTHNNTFPHGYFLI-------NDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPV---------EISPLSLFPANITCSSFQ----VYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSGXXXXXXXXXXXXXXXXXHGLFSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSS---------LSLIANMMKLSQYSPCFI---LCGLVFIGV-IITSFFLKNDVPKHSDSSW-KSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEM-IFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEK 1481
            +S LF+Y+ P +  +G+ + +L + +  S+  S ++R   G +AD  K + Y  +++ S+ L ++L    I   K Y  + N   +G F++       N+  +N   T+      +  CWP+IL  C  N   +         E +   L    +  +++     + Q +Q   +  I  +CS+I      +    I +   D+ ++  L   +       AH   + I +L DSVTF  L  +++H +G +R  GS G +  SL+T  +++ +   N   S         L   +N + ++  SP +I   +   + +G+  I S F   D  K  ++ + K+     R+  +   L+ A   G + S + EY +LI+  ++H +P YF GL+ +I  I E+   +  S  ++ +        IS ++  I++L Y +  NYW L+I E+    A+G+  P +M+ +    EK
Sbjct:    1 ISSLFIYMNPILATYGLNSYQLGITSLFSNAFSCIARITFGMIADRTKHRNYVLVVLSSTSLGLMLLFLTIPRHKEYVFNGNINENGGFVMHLTPVLRNESQSNYVETLSNDKLHIQPCWPTILKQCHSNDYSIISNDNYHLKEFNSYKLSNVYVNDNNYSYDTLINQKQQFQISKTIQIICSEIVTLNESNCTPLICEHIRDASWSVVLFVLILRCLINSAH---APISNLLDSVTFSILGSEKAHFYGRSRALGSFGFMIGSLLTGFAVHQYTPTNYNHSKQEEINSNVLYYTSNSLNINPISPNYIPAVIIAAISVGIGTIASGFCNYDYTKSIETHFTKALTTAIRSPIMIQCLMVAFITGLIISFIGEYNYLILTTVYH-VPHYFLGLLTTIAIIVEIPTLLFISGIMVKHFGAITCQVISQIMLTIRFLFYAYSINYWYLLIGEI----AYGISYPILMNALLLQTEK 466          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A5K4E8E8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.090e-15
Identity = 112/475 (23.58%), Postives = 216/475 (45.47%), Query Frame = 3
Query:  189 YLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLAD--KFQRYREXXXXXXXLCVLLNEFQIAIPKNYNTHNNTFPHGYFLI-------NDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFPANITC---SSFQVYQSRQSNDASVIIS----LCSQIYKFCTESQVLS-------ITQKFNDSGXXXXXXXXXXXXXXXXXHGLFSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIAN-----KKSSLSLI---ANMMKLSQYSPCFI---LCGLVFIGV-IITSFFLKNDVPKHSDSSW-KSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEM-IFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQ 1502
            Y+ P +  +G+ + +L + +  S+  S ++R + G +AD  K + Y  + + S+ L ++L    I   K Y  + N   +G FL+       ND   N   T+      +  CWP +L  C+ N   + IS  + +         S   V     S D S+ +     +   I   C E +  +       + +   D+ ++  +T  +       AH   + I +L DSVTF  L  +++H +G +R  GS G +  SL+T  ++Y +   N      +++L+L+   +N + ++  +P +I   +  L+ +G+  + S F   D     ++ + K+     R+  +   L+ A   G + S + EY +LI+  ++H +P YF GL+ +     E+   +  S  L+ +    +   IS ++  I ++ Y + TNYW L+I E+    A+G+  P +M+ +    EK +  +M 
Sbjct:   31 YMNPILATYGLNSYQLGITSLFSNACSCIARIVFGMIADHTKHRNYVLMALSSTSLGLMLLFLTIPRNKAYVFNGNINENGEFLMHLTPLLKNDSQNNYMETLFNDGLNIPPCWPLVLKQCTSNENSI-ISEKNYYQRAFNSHKLSRVYVGDENHSYDLSIHVQQKFPINKTIQLSCVEIETTNGSNCAPLVCEHIRDASWSVVITVLILRCLVSSAH---APISNLLDSVTFSILGSEKAHFYGKSRALGSFGFMIGSLLTGFAVYQYTSINYHHTINETNLNLLYYSSNSLNINSVNPNYIPPIIIALLSVGIGTVASIFCNYDNSNSVETHFTKALTTAIRSPTMIQCLMVAFMTGLIISFVSEYNYLILTTIYH-VPHYFLGLLTTTAITVEIPTLVFVSGILVKHFGAIVCQVISQILLTICFIFYTYSTNYWYLLIGEI----AYGISYPILMNALLLQTEKVSFEKMN 496          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A5J4NIJ3 (MFS_1_like domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014931 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.208e-15
Identity = 70/261 (26.82%), Postives = 123/261 (47.13%), Query Frame = 3
Query:  795 SLTDSVTFVTLEKDESHKFGITRVFGSLG-----ILAFSLITALSLYLFDIANKKSSLSLIANMMK--LSQYSPCFILCGL-VFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLML------PCMMSYISKFAEKSTQGRMQSIFSSLFFNVE 1535
            +L DS T+  L  D++H +G +R FGS G     ++A +LI+  S    D  + +S      ++ +   S Y+P  +L G+   IG II+    K DV   +    ++ +   R+  + + LL A   G V ++L EY FLI      ++P YF G++ ++  +SE+     S   +        IS +  ++A++  S+ F  NYW  +I + L GPAF L+             ++K         MQ++ +++ F V 
Sbjct:    8 NLLDSTTYGILGPDKTHFYGRSRAFGSAGYVFGAVVAGALISGFSQIGMDQQHTRSPTFASPDISRSPTSNYTPAIVLGGMFALIGTIISGIPSK-DVKSMNMELKQALLTALRSSTMLTCLLNAFLSGLVYAILFEYQFLIFTQQL-NIPPYFMGILIAMIVVSEIPAFFVSGLFIRRFGETTCISFAHALFALRLFSFAFFHNYWFYLITDCLFGPAFPLLYNAFANQSAQAGCVTKGVASGVVASMQALMNAMLFGVS 266          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO37839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEM6])

HSP 1 Score: 61.2326 bits (147), Expect = 9.696e-10
Identity = 55/225 (24.44%), Postives = 106/225 (47.11%), Query Frame = 3
Query:  798 LTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGL-VFIGVIITSFF-LKNDVPKHS-DSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYI 1463
            LTDS T   L   E H++G  R+FGSLG  A +L+    +  F       +++          Y P F +  L +F+  ++T FF  K+   K + D S+   + +F N + +SF+   +  GF  S+ + + F   L      P  F  +V  + ++SE+     S + +  + N+  + +    + +++L Y ++   W ++ +E+L G  +G +    +SY+
Sbjct:  322 LTDSGTLSLLTGKE-HEYGKQRLFGSLGWGAGALVAGFVVTAFHSCQYSDNIN----------YVPVFYVFALAMFLNFVVTLFFRFKSGGEKSAWDKSYTEGLKVFCNVKNASFIFVLLFLGFSHSLQLSFLFW-FLQDIGGTPMLFT-MVMLVNSLSEVFMFLWSTYAVQRIGNDGMLYVGLGCYGVRFLFYSYIEQPWYVLPLEILQGATYGGVWTASVSYV 533          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO46692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP85])

HSP 1 Score: 58.5362 bits (140), Expect = 8.410e-9
Identity = 63/247 (25.51%), Postives = 112/247 (45.34%), Query Frame = 3
Query:  798 LTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSF--MYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNV 1532
            L DS     L   ES ++G  R+ GS G+   +L+ AL   L+   +   +++          Y PCF L  +     II S F K D P    +    F  +  F+      FLL     GF  S+ I + F   L      P  F  ++  +++ +E++   +S F++  + ++  +S++   +  ++L Y  +T+ WL+I IEL+ G  +G +     +YIS   E S+   +Q+I    ++ V
Sbjct:  346 LADSEVVQALANTES-RYGDQRLLGSFGLALAALLAALWTTLWSECHYTDTIN----------YLPCFYLFEIALAATIIISLFFKLDSPDIEGNEVNIFDGLKFFKTPRAGFFLLTIFLLGFAHSIQISFLFWF-LQDLGGTPILF-AVIIIVYSFAEVVMYFSSSFVVQKIGHQGTLSLALACYTARFLMYANLTDPWLVIPIELVQGLTYGGVWSIAPTYISVPEEASSM--IQNILQGAYWGV 577          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO37430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX7])

HSP 1 Score: 56.6102 bits (135), Expect = 2.838e-8
Identity = 66/247 (26.72%), Postives = 117/247 (47.37%), Query Frame = 3
Query:  795 SLTDSVTFVTLEKDESHKFGITRVFGSL--GILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGLVFIGVIITSF---FLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAG---GFVTSVLIEYYFLIILHMFHDLPKYFPG--LVFSIFT----ISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQG 1493
            SL D+VT   L  D+ H++G+ R++GSL  G+ AF +   +S   + + +   S ++  +      Y+PCF          +ITSF   F  +  PK   S     +Y  R+     FL+F +     GF+ +    + F    H+     K   G  L+F I T    I+E+     S  LL ++++   + + FL +AI+  +Y  +T+ W+++ +E+L+G         M++++S   E ST G
Sbjct:   17 SLADTVTMHNLGGDK-HRYGVQRLWGSLGFGVAAFGIGALVSARGYCMGDSGDSQTVDVD------YTPCFYSFAAFLSCALITSFKFNFPNDTCPKGKTSDR---LYTVRSLLRGRFLMFLLVAFHFGFMIAFTKTFLF---WHL-----KELGGTQLLFCIITAVNCIAEVTMYFLSAKLLTFITHTRVLYMGFLCYAIRAFAYYLITSPWMVLTVEILSGITSAASWAAMLAFVS---ENSTPG 242          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO38796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW5])

HSP 1 Score: 50.0618 bits (118), Expect = 2.423e-6
Identity = 50/235 (21.28%), Postives = 101/235 (42.98%), Query Frame = 3
Query:  843 HKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILC-----GLVFIGVIITSFFLKNDV-PKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFN 1529
             ++G  R++G+ G    SL+T  ++      ++ S ++ I     L  + P F+       GL    +++  F  +  +  K    ++   + +    E   FL+     G    V++ + F  +  +     +   GLV  +   +EM+    +  ++  L +   I ++     I+ L Y F+ N W ++++E +NG  F  M    +SY S  A    Q  MQ + SS+++N
Sbjct:  174 ERYGHQRLYGAFGFGIGSLVTGFAM------DQTSHVTYIPG--SLPHHGPNFLTAFIINFGLSVFALLLIGFTFEITINEKKIPPNFAKHIGLLIRKETVLFLIILFITGVANGVIMSFLFWFLRDI--GASQTLLGLVTVVMCSAEMLVFSCTGTMIGRLGHVGVIILALACTIIRLLIYPFLENPWYVLLVEPMNGITFAAMWATCVSYASILAPNEVQSTMQGVVSSVYYN 398          
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Match: EDO42918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S083])

HSP 1 Score: 48.9062 bits (115), Expect = 8.318e-6
Identity = 52/240 (21.67%), Postives = 107/240 (44.58%), Query Frame = 3
Query:  795 SLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSL-YLFDIANKKSSLSLIANMMKLSQYSPCF----ILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKF--AEKSTQG 1493
            +L D+ T   L  D   ++G  R++GS+G    + I   +L YL ++    + LS+         Y PCF    IL G+    ++I   F   DV K  +++    +    N +   F+L  +  G     L  + F  +L +     ++    + ++  +SE++    S  L+     +  + +  + +A+++ +Y FVT+ WL + +E L+G ++  +    + ++     A  + QG
Sbjct:  423 TLADTTTLRGL-GDNVEEYGRQRMWGSIGWGMGAFIVGSTLSYLQELNGCNNPLSV--------DYMPCFYAFAILMGVT---ILIGGLFEFEDV-KRDETTLLQGLNNLCNIQYLYFILTMLFCGGAFGCLQTFLFWHLLEI--GGTQFLFSAITAVQCVSEILMFSMSGVLIRCCGYQRVLYLGLICYAVRFFAYAFVTDCWLALPLECLHGVSYAAVWSAAVVFVGLIPGANNTMQG 647          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000030276.1 (SMESG000030276.1)

HSP 1 Score: 473.781 bits (1218), Expect = 3.648e-164
Identity = 240/240 (100.00%), Postives = 240/240 (100.00%), Query Frame = 3
Query: 1452 MSYISKFAEKSTQGRMQSIFSSLFFNVEKMQPYKIPKIAKPNTSTEDTLHRQRQVSYKKYAEHELTLGTWFAPEAAKAVQQHIHRINQAFSRPRSGHEIKFXXXXXXXXXXXXXXLQNSTYQKETLPPAKTGDAVNVIWLRDHFSGKCFKRVRRGISPEFVKRDISVHKFHAYINDEMKISLVVKLMVETPQPRQQEVMETQNSSTSVEYWTDDFSDEICHTVPQVGTTKFKFFRYQKLP 2171
            MSYISKFAEKSTQGRMQSIFSSLFFNVEKMQPYKIPKIAKPNTSTEDTLHRQRQVSYKKYAEHELTLGTWFAPEAAKAVQQHIHRINQAFSRPRSGHEIKFNSGNSHSGESNHQSLQNSTYQKETLPPAKTGDAVNVIWLRDHFSGKCFKRVRRGISPEFVKRDISVHKFHAYINDEMKISLVVKLMVETPQPRQQEVMETQNSSTSVEYWTDDFSDEICHTVPQVGTTKFKFFRYQKLP
Sbjct:    1 MSYISKFAEKSTQGRMQSIFSSLFFNVEKMQPYKIPKIAKPNTSTEDTLHRQRQVSYKKYAEHELTLGTWFAPEAAKAVQQHIHRINQAFSRPRSGHEIKFNSGNSHSGESNHQSLQNSTYQKETLPPAKTGDAVNVIWLRDHFSGKCFKRVRRGISPEFVKRDISVHKFHAYINDEMKISLVVKLMVETPQPRQQEVMETQNSSTSVEYWTDDFSDEICHTVPQVGTTKFKFFRYQKLP 240          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000030270.1 (SMESG000030270.1)

HSP 1 Score: 382.104 bits (980), Expect = 5.407e-124
Identity = 225/463 (48.60%), Postives = 314/463 (67.82%), Query Frame = 3
Query:  150 YFFELSAVSCLFMYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREXXXXXXXLCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFPANITCSSFQVYQSRQSN--DASVIISLCSQIYKFCTESQVLSITQKFNDSGXXXXXXXXXXXXXXXXXHGLFSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNV 1532
            YFFELS V+CLF+YL PFM E GV+ SELAVINF++HI +F +RP  G++ADK QRYREI+ +S+ LC ++N  Q+ IPK Y   N      YFL+ +   N+  T+C +N + + C P    N   +S  ++IS +  +P NI CS   ++Q   +N  +AS   + C+ +   C +  + S+ +   +SG T SLTF+LF I K   H  +SA  SLTD+VTFVTL KD+ HKFG+TR+FG+LGIL FSL TA+ L LF    ++ + S I+ +  +S Y+PCFIL   +F  V++ S  L ND P HS+  W S   +FRN E+S F +F++ GGF+ S LIEYYF++I  MF  +PKYFPGL+F++ TI+E IF GAS  +L + ++E WIS +F  WA++WLSY  +TNYW  ++IE LNGPAFGL+LPCMM++ISKFA +STQGR+Q +F+ LFFN+
Sbjct:   16 YFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPK-YQKSN-----PYFLLANFEENDNFTVCFSNSSNILCQP---CNNGSSSQVLDIS-IYRYPINIQCSGIPIFQLNSTNHFNAS---NFCNNLSTPCFD-YLKSLNKSETNSGLTCSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFF---QQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGNDKPLHSEPFWTSLGLLFRNLEISIFFIFSIFGGFIFSTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNI 461          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000030274.1 (SMESG000030274.1)

HSP 1 Score: 348.591 bits (893), Expect = 3.423e-116
Identity = 176/178 (98.88%), Postives = 176/178 (98.88%), Query Frame = 3
Query:  186 MYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREXXXXXXXLCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFPANITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSG 719
            MYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREIIIISSILCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFP NITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDS 
Sbjct:    1 MYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREIIIISSILCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFPTNITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSA 178          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000030274.1 (SMESG000030274.1)

HSP 1 Score: 335.495 bits (859), Expect = 2.687e-111
Identity = 170/172 (98.84%), Postives = 170/172 (98.84%), Query Frame = 3
Query:  204 MYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREXXXXXXXLCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFPANITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSG 719
            MYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREIIIISSILCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFP NITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDS 
Sbjct:    1 MYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREIIIISSILCVLLNEFQIAIPKNYNTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSLFPTNITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQKFNDSA 172          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000008715.1 (SMESG000008715.1)

HSP 1 Score: 260.381 bits (664), Expect = 2.162e-77
Identity = 180/482 (37.34%), Postives = 281/482 (58.30%), Query Frame = 3
Query:  150 YFFELSAVSCLFMYLTPFMYEFGVTASELAVINFLSHISSFLSRPILGFLADKFQRYREXXXXXXXLCVLLNEFQIAIPKNY-NTHNNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEISPLSL--FPANITCSSFQVYQSRQSNDASVIIS---LCSQIYKFC---TESQVLSITQKFNDSGXXXXXXXXXXXXXXXXXHGLFSAIHSLTDSVTFVTLEKDESHKFGITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFILCGLVFIGVIITSFFLKND--VPKHSDSSWKSFMYIFRN--------FE--LSSFLLFAVAGGFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLNYLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMMSYISKFAEKSTQGRMQSIFSSLFFNV 1532
            YFFELS  S + +YL+PFM ++GVT SELAVINF  HI +F SRP+ GF+ADK+Q ++++II  +I   +     +A+P++     N +     F++ND      + +C +N + V CWPS ++NC    T   +S ++L  +  N TC+ ++   + QSN    I+S    C  + + C   T+S V    + +     T+S TF++  I +     + S + +LTDS+ F+ L    S+++G TR+FG++G+   S +T   LYL DI  K SSL  IAN+   SQ+S CF+L  LV++ +I+   F+ +D  V +   S  KS +  F +        F+  L+ F LF V  GFV +V  EY+ +I+   F+ +PK+ PGL+  I T+SE +  G S  +L+    E W+S SFLVW  +WL+Y F+  +W  +I E+++G  FGL +  M+SYI K  + STQGR+Q +FSSL+FN+
Sbjct:   16 YFFELSVYSVIIIYLSPFMVKWGVTMSELAVINFAVHIVTFFSRPLFGFIADKYQNFKQLIIFIAITSSISFFLFLAVPRHVPKVLNYSLEKNLFMVNDS-RIGFMGICASNISGV-CWPSNMSNC----TFCGLSKINLTRYYYNETCAFYRFDSANQSNYNKAILSDSMKCLNVDQNCGNHTKSHVF--FEIYKKISLTWSSTFWMLGILRIIGFAVCSPLSNLTDSLIFIVLGPKRSNEYGHTRMFGTVGVFVLSFVTGGLLYLMDILTKYSSL--IANIQSYSQFSLCFLLEVLVYVTIIVIVSFVTHDKVVQEKRKSRNKSCIRKFMDKTSLNMVCFDSNLAIFFLFTVLAGFVETVHCEYFMVILFQKFNYVPKFLPGLLVGIMTLSESLVFGISRKMLDLCRYEFWVSFSFLVWFFRWLTYTFIKYFWQFLITEIIHGFTFGLQIASMVSYIGKRTDPSTQGRVQGLFSSLYFNI 487          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sugb1.329e-1125.28gene:FBgn0036191 transcript:FBtr0273362[more]
Sugb1.778e-1125.28gene:FBgn0036191 transcript:FBtr0344966[more]
Sugb1.933e-1125.28gene:FBgn0036191 transcript:FBtr0300100[more]
CG157066.903e-823.26gene:FBgn0034093 transcript:FBtr0340024[more]
CG157066.903e-823.26gene:FBgn0034093 transcript:FBtr0344080[more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FST21.247e-1923.54MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8JJH33.460e-1923.33MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A4Z2D5B11.275e-1724.05Major facilitator superfamily domain-containing 6-... [more]
A0A5K4E8E83.090e-1523.58Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5J4NIJ36.208e-1526.82MFS_1_like domain-containing protein OS=Paragonimu... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO378399.696e-1024.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466928.410e-925.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374302.838e-826.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387962.423e-621.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429188.318e-621.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030276.13.648e-164100.00SMESG000030276.1[more]
SMESG000030270.15.407e-12448.60SMESG000030270.1[more]
SMESG000030274.13.423e-11698.88SMESG000030274.1[more]
SMESG000030274.12.687e-11198.84SMESG000030274.1[more]
SMESG000008715.12.162e-7737.34SMESG000008715.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019025 ID=SMED30019025|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2284bp
TTTATTTCAAACCAATTTTTATGATAATTACATAGAAAAATTAATTAGAT
AAATCTAGTAATTATCTTTTCAAAAATAAAATTTTCCATAATTGGCACTT
AAAAATGCCTTTTAAAATCAATAAGAAATTGTTGATAATCAAAATTCTTT
ATTTTTTTGAATTATCAGCAGTTTCTTGTCTTTTCATGTATTTAACGCCT
TTCATGTATGAATTTGGAGTAACCGCTTCGGAATTAGCTGTGATAAATTT
TCTCAGTCACATATCCTCTTTTCTCAGCAGACCAATTCTTGGATTTTTGG
CCGATAAGTTTCAGCGATATCGAGAAATCATAATTATAAGCTCAATTCTA
TGTGTTTTGCTCAATGAATTTCAAATTGCTATTCCAAAGAATTATAATAC
TCATAATAATACATTCCCTCATGGATATTTCCTAATAAATGATTTAATTA
CAAATAATAAATTAACAATGTGTATTGCTAATAAGACGGTGGTCTCGTGC
TGGCCTTCAATTCTTACGAATTGTTCGCGAAATTCAACTCCAGTTGAAAT
TTCACCATTGTCATTATTCCCAGCTAATATTACATGTAGCAGTTTTCAAG
TCTATCAATCAAGACAGTCAAATGATGCGAGTGTGATTATCTCGCTTTGC
TCGCAAATCTATAAATTTTGTACGGAATCTCAAGTACTCTCAATTACACA
AAAATTCAACGATTCTGGCTTTACATTTTCTTTGACATTTTTTCTTTTTG
CGATTTTCAAATTTTTTGCTCATGGACTATTTTCTGCTATACACAGCTTG
ACGGATTCTGTGACTTTTGTCACTTTAGAAAAAGATGAATCACACAAATT
CGGTATCACGAGAGTTTTTGGATCTCTGGGAATTCTGGCATTCTCTTTGA
TAACGGCTCTATCTCTTTATCTTTTTGATATAGCGAACAAGAAGTCCAGT
TTATCCTTAATTGCTAACATGATGAAGCTGAGTCAATACTCACCATGTTT
CATTTTATGTGGCTTAGTTTTTATCGGGGTGATTATCACTTCTTTCTTCT
TGAAGAATGATGTACCGAAACATTCAGATTCCTCCTGGAAGTCTTTCATG
TATATTTTTCGGAATTTTGAGCTTTCAAGTTTCTTATTATTTGCAGTAGC
TGGAGGATTTGTCACGTCAGTATTGATCGAATATTATTTCCTTATAATTT
TGCACATGTTCCATGATCTACCAAAATACTTTCCAGGTCTTGTGTTTTCA
ATTTTTACAATTTCAGAAATGATATTCATGGGAGCCTCTCCTTTCTTACT
GAATTATTTGAGTAATGAATTGTGGATCTCCATATCATTTTTAGTGTGGG
CAATCAAATGGCTAAGTTACCTATTTGTGACCAACTATTGGTTATTAATA
ATAATTGAATTACTAAATGGACCAGCTTTCGGGTTGATGCTCCCCTGTAT
GATGTCATATATCAGTAAATTTGCCGAAAAATCAACACAAGGGCGGATGC
AGAGTATCTTCTCCAGCTTATTCTTTAACGTCGAAAAGATGCAACCTTAC
AAGATCCCGAAAATCGCAAAACCTAATACCTCTACAGAAGATACATTACA
TCGCCAACGCCAGGTGAGTTATAAGAAGTATGCTGAACACGAGCTCACGC
TGGGCACGTGGTTTGCCCCGGAAGCCGCGAAGGCTGTTCAACAACACATC
CATCGAATTAACCAAGCGTTTAGCCGGCCGCGATCTGGCCATGAAATTAA
ATTTAATAGCGGCAACTCACATTCCGGAGAAAGTAACCATCAATCCCTAC
AAAACTCCACGTATCAGAAAGAAACATTACCCCCAGCTAAAACAGGCGAC
GCCGTCAACGTCATCTGGCTGAGGGACCATTTTTCTGGCAAATGCTTCAA
ACGTGTTAGAAGAGGCATCAGCCCAGAATTTGTAAAACGAGACATCTCAG
TGCACAAATTCCATGCCTACATAAATGACGAAATGAAAATTAGCTTGGTC
GTAAAATTGATGGTGGAGACGCCACAACCCAGACAGCAGGAGGTCATGGA
GACTCAAAATTCGTCAACTTCTGTCGAGTATTGGACCGATGACTTCAGTG
ACGAGATCTGTCACACAGTCCCACAAGTTGGAACAACCAAGTTTAAATTT
TTCCGATATCAGAAACTCCCGTAGATATGGATGAGGATACTCGAGATATT
CTCATCGATTTTCGAGAACTTTTAGATTAATAAATATCGAATTAACTATT
TCGTCTTTAGACGTATCATTTTGTTTTTGTGTAA
back to top

protein sequence of SMED30019025-orf-1

>SMED30019025-orf-1 ID=SMED30019025-orf-1|Name=SMED30019025-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=690bp
MPFKINKKLLIIKILYFFELSAVSCLFMYLTPFMYEFGVTASELAVINFL
SHISSFLSRPILGFLADKFQRYREIIIISSILCVLLNEFQIAIPKNYNTH
NNTFPHGYFLINDLITNNKLTMCIANKTVVSCWPSILTNCSRNSTPVEIS
PLSLFPANITCSSFQVYQSRQSNDASVIISLCSQIYKFCTESQVLSITQK
FNDSGFTFSLTFFLFAIFKFFAHGLFSAIHSLTDSVTFVTLEKDESHKFG
ITRVFGSLGILAFSLITALSLYLFDIANKKSSLSLIANMMKLSQYSPCFI
LCGLVFIGVIITSFFLKNDVPKHSDSSWKSFMYIFRNFELSSFLLFAVAG
GFVTSVLIEYYFLIILHMFHDLPKYFPGLVFSIFTISEMIFMGASPFLLN
YLSNELWISISFLVWAIKWLSYLFVTNYWLLIIIELLNGPAFGLMLPCMM
SYISKFAEKSTQGRMQSIFSSLFFNVEKMQPYKIPKIAKPNTSTEDTLHR
QRQVSYKKYAEHELTLGTWFAPEAAKAVQQHIHRINQAFSRPRSGHEIKF
NSGNSHSGESNHQSLQNSTYQKETLPPAKTGDAVNVIWLRDHFSGKCFKR
VRRGISPEFVKRDISVHKFHAYINDEMKISLVVKLMVETPQPRQQEVMET
QNSSTSVEYWTDDFSDEICHTVPQVGTTKFKFFRYQKLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR024989MFS_assoc_dom
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024989Major facilitator superfamily associated domainPFAMPF12832MFS_1_likecoord: 5..187
e-value: 1.7E-16
score: 60.1
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 37..190
e-value: 4.9E-23
score: 83.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..288
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..287
NoneNo IPR availablePANTHERPTHR16172:SF30SUGAR BABY, ISOFORM Ccoord: 4..185
NoneNo IPR availablePANTHERPTHR16172UNCHARACTERIZEDcoord: 4..185
NoneNo IPR availableCDDcd17335MFS_MFSD6coord: 7..186
e-value: 5.60899E-25
score: 103.047
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 10..184