SMED30019013

Overview
NameSMED30019013
Smed IDSMED30019013
Length (bp)456
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019013

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30019013SMESG000048308.1 Contig4262_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019013 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000062:11015..13579 -2252
Homology
BLAST of SMED30019013 vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.032 bits (593), Expect = 9.494e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   18 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 167          
BLAST of SMED30019013 vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.032 bits (593), Expect = 9.494e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   18 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 167          
BLAST of SMED30019013 vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.032 bits (593), Expect = 9.494e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   18 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 167          
BLAST of SMED30019013 vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.032 bits (593), Expect = 9.494e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   18 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 167          
BLAST of SMED30019013 vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.032 bits (593), Expect = 9.494e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   18 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 167          
BLAST of SMED30019013 vs. Ensembl Celegans
Match: ben-1 (Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:Q18817])

HSP 1 Score: 235.728 bits (600), Expect = 5.964e-77
Identity = 120/150 (80.00%), Postives = 137/150 (91.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            YKG+SDLQLERI VYYNEA GGK+VPRA+L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+DNV++VVRKE+E C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ SFS VPSPKVSD VVEPYNA
Sbjct:   36 YKGESDLQLERINVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 233.417 bits (594), Expect = 4.596e-76
Identity = 119/150 (79.33%), Postives = 137/150 (91.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+GGK+VPRA L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+DNV++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YNGDSDLQLERINVYYNEASGGKYVPRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAESCDCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Celegans
Match: tbb-1 (Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:O17921])

HSP 1 Score: 232.261 bits (591), Expect = 1.269e-75
Identity = 118/150 (78.67%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            +KG+SDLQLERI VYYNEA  GK+VPRA+L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+DNV++V+RKE+E C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREEFPDRI+ SFS VPSPKVSD VVEPYNA
Sbjct:   36 FKGESDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMSSFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Celegans
Match: tbb-1 (Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:O17921])

HSP 1 Score: 232.261 bits (591), Expect = 1.269e-75
Identity = 118/150 (78.67%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            +KG+SDLQLERI VYYNEA  GK+VPRA+L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+DNV++V+RKE+E C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREEFPDRI+ SFS VPSPKVSD VVEPYNA
Sbjct:   36 FKGESDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMSSFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 230.335 bits (586), Expect = 8.893e-75
Identity = 116/150 (77.33%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            +KG++DLQLERI VYYNEA  GK+VPRA+L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+DNV++V+RKE+E C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ SFS VPSPKVSD VVEPYNA
Sbjct:   36 FKGETDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 232.261 bits (591), Expect = 1.607e-75
Identity = 119/150 (79.33%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATG K+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKESE C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YYGDSDLQLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 230.335 bits (586), Expect = 7.976e-75
Identity = 116/150 (77.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+GGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ ++S VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086537)

HSP 1 Score: 229.95 bits (585), Expect = 1.330e-74
Identity = 116/150 (77.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+GGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ ++S VPSPKVSD VVEPYNA
Sbjct:   45 YHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 194          
BLAST of SMED30019013 vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 223.787 bits (569), Expect = 3.393e-72
Identity = 117/155 (75.48%), Postives = 137/155 (88.39%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEAT-----GGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLER+ VYYNEA+     GGK+VPRAIL DLEPGTM+S+R G  G LFRPDNF++G +GAGNNWAKGHYT+GAEL+DNV++VVRKE ENC+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ ++S VPSPKVSD VVEPYNA
Sbjct:   36 YVGDSDLQLERVSVYYNEASVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 190          
BLAST of SMED30019013 vs. Ensembl Fly
Match: betaTub97EF (gene:FBgn0003890 transcript:FBtr0300611)

HSP 1 Score: 223.787 bits (569), Expect = 3.516e-72
Identity = 115/151 (76.16%), Postives = 135/151 (89.40%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
            +Y G+S LQ ERI VYYNEA+ GK+VPRA+L DLEPGTMDS+R   VG LFRPDNF++G +GAGNNWAKGHYT+GAELID+V+EV+RKESE C+CLQGFQ+ H+LGGGTG+G+GTLLISKIREE+PDRI+ SFS VPSPKVSD VVEPYNA
Sbjct:   35 YYHGESALQHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 233.417 bits (594), Expect = 9.701e-78
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 233.417 bits (594), Expect = 9.701e-78
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Zebrafish
Match: tubb5 (tubulin, beta 5 [Source:ZFIN;Acc:ZDB-GENE-031110-4])

HSP 1 Score: 233.802 bits (595), Expect = 5.027e-76
Identity = 119/150 (79.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKESE+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Zebrafish
Match: zgc:153426 (zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220])

HSP 1 Score: 233.032 bits (593), Expect = 1.037e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 232.646 bits (592), Expect = 1.224e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 233.032 bits (593), Expect = 1.303e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 233.032 bits (593), Expect = 1.611e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 232.646 bits (592), Expect = 2.021e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+GGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKESE+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVMDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 231.491 bits (589), Expect = 5.028e-75
Identity = 118/150 (78.67%), Postives = 137/150 (91.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATG KFVPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS +PSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGNKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Xenopus
Match: tubb3 (tubulin beta 3 class III [Source:NCBI gene;Acc:395045])

HSP 1 Score: 229.95 bits (585), Expect = 2.611e-74
Identity = 118/150 (78.67%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+  K+VPRAIL DLEPGTMDS+R G  G+LFRPDNFIFG +GAGNNWAKGHYT+GAEL+D+V++VVRKE ENC+CLQGFQ+ H+LGGGTG+GMGTLLISK+REE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YIGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 233.032 bits (593), Expect = 1.220e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 232.646 bits (592), Expect = 1.279e-75
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 231.491 bits (589), Expect = 4.625e-75
Identity = 118/150 (78.67%), Postives = 137/150 (91.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATG K+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKESE+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS +PSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Mouse
Match: Tubb4a (tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:MGI:107848])

HSP 1 Score: 231.106 bits (588), Expect = 4.966e-75
Identity = 118/150 (78.67%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGG +VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREEFPDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Mouse
Match: Tubb3 (tubulin, beta 3 class III [Source:MGI Symbol;Acc:MGI:107813])

HSP 1 Score: 230.72 bits (587), Expect = 1.097e-74
Identity = 118/150 (78.67%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+  K+VPRAIL DLEPGTMDS+R G  G+LFRPDNFIFG +GAGNNWAKGHYT+GAEL+D+V++VVRKE ENC+CLQGFQ+ H+LGGGTG+GMGTLLISK+REE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. UniProt/SwissProt
Match: sp|O44388|TBB_TRITR (Tubulin beta chain OS=Trichuris trichiura OX=36087 PE=3 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.050e-76
Identity = 122/150 (81.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+GGK+VPRAIL DLEPGTMDS+R G  G LFRPDNFIFG +GAGNNWAKGHYT+GAEL+DNV++VVRKESE+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRAGPFGTLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMTTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. UniProt/SwissProt
Match: sp|O59837|TBB_PHYCI (Tubulin beta chain OS=Phytophthora cinnamomi OX=4785 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 4.767e-76
Identity = 121/150 (80.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGG++VPRAIL DLEPGTMDS+R G  G LFRPDNF+FG TGAGNNWAKGHYT+GAELID+V++VVRKE+E+C+CLQGFQI H+LGGGTG+GMGTLLISKIREE+PDRI+C++S  PSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGRYVPRAILMDLEPGTMDSVRAGPYGQLFRPDNFVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAESCDCLQGFQITHSLGGGTGSGMGTLLISKIREEYPDRIMCTYSVCPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. UniProt/SwissProt
Match: sp|P07436|TBB1_PHYPO (Tubulin beta-1 chain OS=Physarum polycephalum OX=5791 GN=BETA PE=1 SV=4)

HSP 1 Score: 236.498 bits (602), Expect = 5.101e-76
Identity = 120/150 (80.00%), Postives = 139/150 (92.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y G+SDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG TGAGNNWAKGHYT+GAELID+V++VVRKE+E+C+CLQGFQI H+LGGGTG+GMGTLLISKIREE+PDR++C+FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGESDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRAGPFGQIFRPDNFVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAESCDCLQGFQIAHSLGGGTGSGMGTLLISKIREEYPDRMMCTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. UniProt/SwissProt
Match: sp|P18241|TBB1_BRUPA (Tubulin beta-1 chain OS=Brugia pahangi OX=6280 PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 7.243e-76
Identity = 119/150 (79.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            YKGDSDLQ+ERI VYYNEA GGK+VPRA+L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+DNV++V+RKE+E C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ SFS VPSPKVSDVV+EPYNA
Sbjct:   36 YKGDSDLQIERINVYYNEANGGKYVPRAVLVDLEPGTMDSIRGGEFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDVVLEPYNA 185          
BLAST of SMED30019013 vs. UniProt/SwissProt
Match: sp|P41352|TBB_TETTH (Tubulin beta chain OS=Tetrahymena thermophila OX=5911 GN=BTU1 PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.176e-75
Identity = 121/150 (80.67%), Postives = 137/150 (91.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGG++VPRAIL DLEPGTMDS+R G  G LFRPDNF+FG TGAGNNWAKGHYT+GAELID+V++VVRKE+E C+CLQGFQI H+LGGGTG+GMGTLLISK+REE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGRYVPRAILMDLEPGTMDSVRAGPFGQLFRPDNFVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAEGCDCLQGFQITHSLGGGTGSGMGTLLISKVREEYPDRIMETFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. TrEMBL
Match: H2KQS1 (Tubulin beta chain (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_104575 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.034e-81
Identity = 131/151 (86.75%), Postives = 145/151 (96.03%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
            FY+GD+DLQLERICVYYNEA GGKFVPR+IL DLEPGTMD++RCG VG LFRPDN++FGSTGAGNNWAKGHYTDGAELIDNV+EVVRKE+E CEC+QGFQ+VHALGGGTGAGMGTLLI+K+REEFPDR+VCSFS VPSPKVSDVVVEPYNA
Sbjct:   16 FYQGDTDLQLERICVYYNEAIGGKFVPRSILCDLEPGTMDAVRCGPVGQLFRPDNYVFGSTGAGNNWAKGHYTDGAELIDNVLEVVRKEAELCECMQGFQVVHALGGGTGAGMGTLLINKVREEFPDRVVCSFSTVPSPKVSDVVVEPYNA 166          
BLAST of SMED30019013 vs. TrEMBL
Match: A0A419PIP4 (Tubulin beta chain OS=Clonorchis sinensis OX=79923 GN=tbb-4 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 6.573e-81
Identity = 131/151 (86.75%), Postives = 145/151 (96.03%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
            FY+GD+DLQLERICVYYNEA GGKFVPR+IL DLEPGTMD++RCG VG LFRPDN++FGSTGAGNNWAKGHYTDGAELIDNV+EVVRKE+E CEC+QGFQ+VHALGGGTGAGMGTLLI+K+REEFPDR+VCSFS VPSPKVSDVVVEPYNA
Sbjct:   35 FYQGDTDLQLERICVYYNEAIGGKFVPRSILCDLEPGTMDAVRCGPVGQLFRPDNYVFGSTGAGNNWAKGHYTDGAELIDNVLEVVRKEAELCECMQGFQVVHALGGGTGAGMGTLLINKVREEFPDRVVCSFSTVPSPKVSDVVVEPYNA 185          
BLAST of SMED30019013 vs. TrEMBL
Match: A0A074ZDG4 (Tubulin beta chain OS=Opisthorchis viverrini OX=6198 GN=T265_07310 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 6.573e-81
Identity = 131/151 (86.75%), Postives = 145/151 (96.03%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
            FY+GD+DLQLERICVYYNEA GGKFVPR+IL DLEPGTMD++RCG VG LFRPDN++FGSTGAGNNWAKGHYTDGAELIDNV+EVVRKE+E CEC+QGFQ+VHALGGGTGAGMGTLLI+K+REEFPDR+VCSFS VPSPKVSDVVVEPYNA
Sbjct:   35 FYQGDTDLQLERICVYYNEAIGGKFVPRSILCDLEPGTMDAVRCGPVGQLFRPDNYVFGSTGAGNNWAKGHYTDGAELIDNVLEVVRKEAELCECMQGFQVVHALGGGTGAGMGTLLINKVREEFPDRVVCSFSTVPSPKVSDVVVEPYNA 185          
BLAST of SMED30019013 vs. TrEMBL
Match: A0A4S2LW18 (Tubulin beta chain OS=Opisthorchis felineus OX=147828 GN=CRM22_004465 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 6.644e-81
Identity = 131/151 (86.75%), Postives = 145/151 (96.03%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
            FY+GD+DLQLERICVYYNEA GGKFVPR+IL DLEPGTMD++RCG VG LFRPDN++FGSTGAGNNWAKGHYTDGAELIDNV+EVVRKE+E CEC+QGFQ+VHALGGGTGAGMGTLLI+K+REEFPDR+VCSFS VPSPKVSDVVVEPYNA
Sbjct:   35 FYQGDTDLQLERICVYYNEAIGGKFVPRSILCDLEPGTMDAVRCGPVGQLFRPDNYVFGSTGAGNNWAKGHYTDGAELIDNVLEVVRKEAELCECMQGFQVVHALGGGTGAGMGTLLINKVREEFPDRVVCSFSTVPSPKVSDVVVEPYNA 185          
BLAST of SMED30019013 vs. TrEMBL
Match: I6TL06 (Tubulin beta chain OS=Spirometra erinaceieuropaei OX=99802 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 2.176e-80
Identity = 134/151 (88.74%), Postives = 142/151 (94.04%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
             YKGDSDLQLERI VYYNEATGGKFVPRA+LTDLEPGTMD++R G VGNLFRPDNF+FG+TGAGNNWAKGHYTDGAELID+V EVVRKE+E  ECLQGFQI HALGGGTGAGMGTLLISKIREEFPDRI+CSFS VPSPKVSDVVVEPYNA
Sbjct:   35 LYKGDSDLQLERISVYYNEATGGKFVPRAVLTDLEPGTMDAVRSGPVGNLFRPDNFVFGATGAGNNWAKGHYTDGAELIDSVTEVVRKEAEYSECLQGFQITHALGGGTGAGMGTLLISKIREEFPDRIICSFSTVPSPKVSDVVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 238.81 bits (608), Expect = 4.456e-77
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y+G+S+LQLERI VYYNEATG KFVPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKESENC+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS +PSPKVSD VVEPYNA
Sbjct:  113 YQGESELQLERINVYYNEATGSKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNA 262          
BLAST of SMED30019013 vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 233.032 bits (593), Expect = 9.832e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 187.578 bits (475), Expect = 3.387e-58
Identity = 96/130 (73.85%), Postives = 117/130 (90.00%), Query Frame = -2
Query:    3 GGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 392
            GGK+VPRA+L DLEPGTMDS+R   +G LFRPDNFI G++GAGNNWAKGHYT+GAEL++ V++ VR E+E+C+CLQGFQ VH+LGGGTG+GMGTL+I+KIREE+PDRI+ SFS +PSPKVSD VVEPYNA
Sbjct:   30 GGKYVPRALLVDLEPGTMDSVRGSRIGQLFRPDNFIHGNSGAGNNWAKGHYTEGAELVEQVVDRVRNEAESCDCLQGFQFVHSLGGGTGSGMGTLIINKIREEYPDRIMNSFSIMPSPKVSDTVVEPYNA 159          
BLAST of SMED30019013 vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 1.179e-39
Identity = 74/93 (79.57%), Postives = 88/93 (94.62%), Query Frame = -2
Query:    3 GSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 281
            G +GAGNNWAKGHYT+GAEL+D+V++VVRKESE+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   12 GQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 104          
BLAST of SMED30019013 vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 116.701 bits (291), Expect = 3.324e-31
Identity = 61/137 (44.53%), Postives = 90/137 (65.69%), Query Frame = -2
Query:    3 VYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 413
             +++E   GK+VPRAI  DLEP  +D +R G    LF P+  I G   A NN+A+GHYT G E+ID+V++ +RK ++ C  LQGF + H+ GGGTG+G  +LL+ ++  +F  +    F+  P+P+VS  VVEPYN+
Sbjct:   51 TFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNS 187          
BLAST of SMED30019013 vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 210.69 bits (535), Expect = 1.306e-68
Identity = 111/151 (73.51%), Postives = 134/151 (88.74%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCS-FSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEA+GGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+  +++ +  +  PSPKVSD VVEPYNA
Sbjct:   18 YHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNA 168          
BLAST of SMED30019013 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009623.1 (pep scaffold:Pmarinus_7.0:GL485233:4234:10583:1 gene:ENSPMAG00000008696.1 transcript:ENSPMAT00000009623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 1.153e-57
Identity = 92/124 (74.19%), Postives = 115/124 (92.74%), Query Frame = -2
Query:   84 YKG-DSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREE 452
            Y+G ++ LQ+ERI VYY+EAT GKFVPRAI+ DLEPGTMD++R G +G++FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+ENC+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE
Sbjct:   36 YRGYNARLQMERINVYYSEATSGKFVPRAIMVDLEPGTMDAVRSGPLGHMFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREE 159          
BLAST of SMED30019013 vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 111.694 bits (278), Expect = 1.541e-30
Identity = 59/137 (43.07%), Postives = 88/137 (64.23%), Query Frame = -2
Query:    3 VYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 413
             +++E   GK VPRA+  DLEP  +D +R G    LF P+  I G   A NN+A+GHYT G E++D V++ +RK ++ C  LQGF I H+ GGGTG+G  +LL+ ++  ++  +    F+  P+P+VS  VVEPYN+
Sbjct:   51 TFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNS 187          
BLAST of SMED30019013 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005307.1 (pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 gene:ENSPMAG00000004835.1 transcript:ENSPMAT00000005307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 2.766e-18
Identity = 32/74 (43.24%), Postives = 47/74 (63.51%), Query Frame = -2
Query:  192 VYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRK 413
             +++E   GK VPRA+  DLEP  + ++R G    LF P+  I G   A NN+A+GHYT G E++D V++ +RK
Sbjct:   51 TFFSETGAGKHVPRAVFVDLEPTVVGAVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRK 124          
BLAST of SMED30019013 vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 75.8702 bits (185), Expect = 3.691e-17
Identity = 41/144 (28.47%), Postives = 79/144 (54.86%), Query Frame = -2
Query:    3 ERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGST--GAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSP-KVSDVVVEPYNA 425
            +R  V++ +A    ++PRA+L DLEP  ++S+      NL+ P+N        GAGNNWA GH + G ++ + + +++ +E++  + L+   +         +      + K    FP +++ ++S  P+  ++SDVVV+PYN+
Sbjct:   46 DRKDVFFYQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASGH-SQGEKIHEEIFDIIDREADGSDSLEKCPLTR-----RLSATNWNELCKYFCRFPKKLIQTYSVFPNQDEMSDVVVQPYNS 183          
BLAST of SMED30019013 vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 203.756 bits (517), Expect = 3.667e-65
Identity = 102/150 (68.00%), Postives = 129/150 (86.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y G  D+Q ER+ VY+NEA+ GK+VPR+I  DLEPGT+D++R   +GNLFRPDN+IFG + AGN WAKGHYT+GAEL+D+V++V+R+E+E C+ LQGFQI H+LGGGTG+GMGTLLISKIREEFPDR++ +FS +PSPK SD VVEPYNA
Sbjct:   36 YHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 110.538 bits (275), Expect = 7.221e-30
Identity = 64/141 (45.39%), Postives = 90/141 (63.83%), Query Frame = -2
Query:    3 ERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 425
            E    +++E   GKFVPRAI  DLEP  +D +R G    LF P+  I G   A NN+A+GHYT G E++D V E +RK ++ C+ LQGF   H+LGGGTG+G+G+LL+  +  E+  +    F+  P+P++S  VVEPYN 
Sbjct:   48 EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNT 188          
BLAST of SMED30019013 vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 108.227 bits (269), Expect = 5.454e-29
Identity = 63/141 (44.68%), Postives = 93/141 (65.96%), Query Frame = -2
Query:    3 ERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 425
            E    +++E   GKFVPRAI  DLEP  +D +R G   +LF P+  I G   A NN+A+GHYT G E++ +V++ +RK ++ C+ LQGF   H+LGGGTG+G+G+LL+ ++  E+  +    F+  P+P+VS  VVEPYN 
Sbjct:   48 EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNT 188          
BLAST of SMED30019013 vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 70.4774 bits (171), Expect = 1.835e-15
Identity = 48/138 (34.78%), Postives = 82/138 (59.42%), Query Frame = -2
Query:    3 YYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTG--AGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 410
            ++ E +  KF PRAI+ D EP  +  +     G  F P N    S G  AGN+WA G Y  G    D+++  + KE ++ +  +GFQ++H++ GGTG+G+G+ L+  + + +P +I+ ++S  P+ + S+VVV+ YN 
Sbjct:   53 FFRENSRNKFTPRAIMMDSEPSVIADVENTFRG-FFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNT 187          
BLAST of SMED30019013 vs. Ensembl Nematostella
Match: EDO35973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX5])

HSP 1 Score: 229.565 bits (584), Expect = 2.095e-77
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 233.417 bits (594), Expect = 2.194e-76
Identity = 119/150 (79.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 229.95 bits (585), Expect = 4.321e-75
Identity = 116/150 (77.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPR++L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+C+QGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELMDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 229.18 bits (583), Expect = 7.691e-75
Identity = 115/150 (76.67%), Postives = 136/150 (90.67%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+C+QGFQ+ H+LGGGTG+GM TLLI KIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   32 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 181          
BLAST of SMED30019013 vs. Ensembl Nematostella
Match: EDO49518 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG3])

HSP 1 Score: 194.897 bits (494), Expect = 1.768e-61
Identity = 96/147 (65.31%), Postives = 128/147 (87.07%), Query Frame = -2
Query:    3 DSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 443
            D+  + +RI VY++E  GG++VPR+IL DLEPGTMD++R G +GN+FRPDNF+   +GA NNWAKGHY++GAELIDN+ +V+RKE+ENC+C+QG Q++ ALGGGTG+G+GTL++SKIREE+PDRI+ +FS VPSPKVS+ VVEPYNA
Sbjct:   41 DTHGRFDRIDVYFHEGNGGRYVPRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELIDNIFDVLRKEAENCDCMQGVQLIQALGGGTGSGLGTLILSKIREEYPDRILSAFSVVPSPKVSETVVEPYNA 187          
BLAST of SMED30019013 vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 233.802 bits (595), Expect = 4.234e-76
Identity = 119/150 (79.33%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQL+RI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G +FRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKESE+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 233.032 bits (593), Expect = 1.127e-75
Identity = 119/150 (79.33%), Postives = 137/150 (91.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y+GDSDLQLERI VYYNEA+G K+VPRAIL DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+D V++VVRKESENC+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS +PSPKVSD VVEPYNA
Sbjct:   36 YQGDSDLQLERINVYYNEASGSKYVPRAILVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 214.927 bits (546), Expect = 1.644e-68
Identity = 110/150 (73.33%), Postives = 134/150 (89.33%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y+GDS LQLERI VY++EA GGK+VPRA+L DLEPGTMDS+R   +G LFRPDNFI G++GAGNNWAKGHYT+GAEL++ V++ VR ESE C+CLQGFQ+VH+LGGGTG+GMGTL+I+KI+EEFPDRI+ +FS +PSPKVSD VVEPYNA
Sbjct:   36 YEGDSTLQLERINVYFSEAYGGKYVPRALLVDLEPGTMDSIRGSRIGALFRPDNFIHGNSGAGNNWAKGHYTEGAELVEQVVDRVRHESEGCDCLQGFQLVHSLGGGTGSGMGTLIINKIKEEFPDRIMNTFSIMPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Ensembl Medaka
Match: ENSORLT00000000055.2 (tubulin alpha-1C chain [Source:NCBI gene;Acc:101166777])

HSP 1 Score: 114.775 bits (286), Expect = 1.357e-30
Identity = 63/137 (45.99%), Postives = 88/137 (64.23%), Query Frame = -2
Query:    3 VYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 413
             +++E    K+VPRAI  DLEP  +D +R G    LF P+  I G   A NN+A+GHYT G E IDNV++ +RK S+ C  LQGF I H+ GGGTG+G  +LL+ ++  +F  +    F+  P+P+VS  VVEPYN+
Sbjct:   51 TFFSETGNSKYVPRAIFVDLEPTVIDEIRTGPYRQLFHPEQMISGKEDAANNYARGHYTVGKEHIDNVLDRIRKLSDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNS 187          
BLAST of SMED30019013 vs. Ensembl Medaka
Match: ENSORLT00000037900.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 114.005 bits (284), Expect = 2.831e-30
Identity = 61/137 (44.53%), Postives = 88/137 (64.23%), Query Frame = -2
Query:    3 VYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 413
             +++E   GK VPRA+  DLEP  +D +R G    LF P+  I G   A NN+A+GHYT G E+ID V++ +RK ++ C  LQGF + H+ GGGTG+G  +LL+ ++  ++  +    FS  P+P+VS  VVEPYNA
Sbjct:   51 TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNA 187          
BLAST of SMED30019013 vs. Planmine SMEST
Match: SMESG000048308.1 (SMESG000048308.1)

HSP 1 Score: 283.108 bits (723), Expect = 1.176e-95
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = -2
Query:    3 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 455
            FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHALGGGTGAGMGTLLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA
Sbjct:   35 FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHALGGGTGAGMGTLLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 185          
BLAST of SMED30019013 vs. Planmine SMEST
Match: SMESG000074579.1 (SMESG000074579.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.304e-77
Identity = 120/150 (80.00%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Planmine SMEST
Match: SMESG000074423.1 (SMESG000074423.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.304e-77
Identity = 120/150 (80.00%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRAIL DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Planmine SMEST
Match: SMESG000050810.1 (SMESG000050810.1)

HSP 1 Score: 234.572 bits (597), Expect = 1.298e-76
Identity = 120/150 (80.00%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G LFRPDNFIFG +GAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   36 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRAGPFGQLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 185          
BLAST of SMED30019013 vs. Planmine SMEST
Match: SMESG000047284.1 (SMESG000047284.1)

HSP 1 Score: 234.187 bits (596), Expect = 1.791e-76
Identity = 118/150 (78.67%), Postives = 138/150 (92.00%), Query Frame = -2
Query:    3 YKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHXXXXXXXXXXXXXLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNA 452
            Y GDSDLQLERI VYYNEATGGK+VPRA+L DLEPGTMDS+R G  G LFRPDNF+FG +GAGNNWAKGHYT+GAEL+D+V+++VRKE+E+C+CLQGFQ+ H+LGGGTG+GMGTLLISKIREE+PDRI+ +FS VPSPKVSD VVEPYNA
Sbjct:   30 YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNA 179          
The following BLAST results are available for this feature:
BLAST of SMED30019013 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB9.494e-7678.67tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB9.494e-7678.67tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB9.494e-7678.67tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB9.494e-7678.67tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB9.494e-7678.67tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ben-15.964e-7780.00Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:Q... [more]
tbb-44.596e-7679.33Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-11.269e-7578.67Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:O... [more]
tbb-11.269e-7578.67Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:O... [more]
tbb-28.893e-7577.33Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub85D1.607e-7579.33gene:FBgn0003889 transcript:FBtr0082046[more]
betaTub56D7.976e-7577.33gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub56D1.330e-7477.33gene:FBgn0284243 transcript:FBtr0086537[more]
betaTub60D3.393e-7275.48gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub97EF3.516e-7276.16gene:FBgn0003890 transcript:FBtr0300611[more]
back to top
BLAST of SMED30019013 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:554619.701e-7878.67zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554619.701e-7878.67zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
tubb55.027e-7679.33tubulin, beta 5 [Source:ZFIN;Acc:ZDB-GENE-031110-4... [more]
zgc:1534261.037e-7578.67zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220][more]
zgc:554611.224e-7578.67zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of SMED30019013 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reps21.303e-7578.67RALBP1 associated Eps domain containing 2 [Source:... [more]
tubb1.611e-7578.67tubulin beta class I [Source:NCBI gene;Acc:448742][more]
ubxn112.021e-7578.67UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
znf3305.028e-7578.67zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
tubb32.611e-7478.67tubulin beta 3 class III [Source:NCBI gene;Acc:395... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb51.220e-7578.67tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb4b1.279e-7578.67tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb2b4.625e-7578.67tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb4a4.966e-7578.67tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:... [more]
Tubb31.097e-7478.67tubulin, beta 3 class III [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30019013 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O44388|TBB_TRITR1.050e-7681.33Tubulin beta chain OS=Trichuris trichiura OX=36087... [more]
sp|O59837|TBB_PHYCI4.767e-7680.67Tubulin beta chain OS=Phytophthora cinnamomi OX=47... [more]
sp|P07436|TBB1_PHYPO5.101e-7680.00Tubulin beta-1 chain OS=Physarum polycephalum OX=5... [more]
sp|P18241|TBB1_BRUPA7.243e-7679.33Tubulin beta-1 chain OS=Brugia pahangi OX=6280 PE=... [more]
sp|P41352|TBB_TETTH1.176e-7580.67Tubulin beta chain OS=Tetrahymena thermophila OX=5... [more]
back to top
BLAST of SMED30019013 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KQS14.034e-8186.75Tubulin beta chain (Fragment) OS=Clonorchis sinens... [more]
A0A419PIP46.573e-8186.75Tubulin beta chain OS=Clonorchis sinensis OX=79923... [more]
A0A074ZDG46.573e-8186.75Tubulin beta chain OS=Opisthorchis viverrini OX=61... [more]
A0A4S2LW186.644e-8186.75Tubulin beta chain OS=Opisthorchis felineus OX=147... [more]
I6TL062.176e-8088.74Tubulin beta chain OS=Spirometra erinaceieuropaei ... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB2A4.456e-7778.67tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
zgc:554619.832e-7678.67tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB13.387e-5873.85tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000019550.21.179e-3979.57pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tuba8l23.324e-3144.53tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb21.306e-6873.51tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000009623.11.153e-5774.19pep scaffold:Pmarinus_7.0:GL485233:4234:10583:1 ge... [more]
TUBA3C1.541e-3043.07tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000005307.12.766e-1843.24pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 ... [more]
tubg13.691e-1728.47tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB23.667e-6568.00Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB37.221e-3045.39Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB15.454e-2944.68Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB41.835e-1534.78Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO359732.095e-7778.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399452.194e-7679.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359584.321e-7577.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428907.691e-7576.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495181.768e-6165.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019013 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb54.234e-7679.33tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
tubb21.127e-7579.33tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
ENSORLT00000045809.11.644e-6873.33tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
ENSORLT00000000055.21.357e-3045.99tubulin alpha-1C chain [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000037900.12.831e-3044.53tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
back to top
BLAST of SMED30019013 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048308.11.176e-95100.00SMESG000048308.1[more]
SMESG000074579.14.304e-7780.00SMESG000074579.1[more]
SMESG000074423.14.304e-7780.00SMESG000074423.1[more]
SMESG000050810.11.298e-7680.00SMESG000050810.1[more]
SMESG000047284.11.791e-7678.67SMESG000047284.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019013 ID=SMED30019013|Name=SMED30019013|organism=Schmidtea mediterranea sexual|type=transcript|length=456bp
GTTGCATTATAAGGTTCAACAACGACATCAGACACCTTTGGCGATGGAAC
ACAGGAAAAACTACAAACGATTCGATCAGGGAATTCCTCTCGAATCTTAC
TGATCAAAAGCGTTCCCATTCCAGCACCAGTTCCACCACCAAGTGCATGG
ACGATTTGAAATCCTTGCAAACATTCACAGTTCTCTGATTCCTTCCTAAC
TACTTCAATGACATTATCGATCAGTTCAGCGCCATCGGTATAATGACCTT
TAGCCCAGTTATTTCCCGCTCCAGTACTACCGAAAATGAAATTATCCGGC
CTAAATAGATTTCCCACAACACCGCATCTCAATGAATCCATTGTTCCTGG
CTCCAAATCAGTTAGAATTGCTCTTGGCACAAATTTTCCTCCAGTTGCTT
CGTTATAATACACGCAAATCCTTTCCAATTGCAAATCACTGTCACCTTTG
TAAAAT
back to top

protein sequence of SMED30019013-orf-1

>SMED30019013-orf-1 ID=SMED30019013-orf-1|Name=SMED30019013-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
FYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNL
FRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQ
IVHALGGGTGAGMGTLLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYN
A
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR000217Tubulin
IPR002453Beta_tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR017975Tubulin_CS
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 7..24
score: 77.37
coord: 54..65
score: 74.95
coord: 118..130
score: 79.21
coord: 74..92
score: 65.17
IPR000217TubulinPRINTSPR01161TUBULINcoord: 72..96
score: 54.44
coord: 98..116
score: 68.79
coord: 17..36
score: 64.53
coord: 59..70
score: 69.02
coord: 142..151
score: 57.14
coord: 117..138
score: 46.26
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..151
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 13..151
e-value: 9.9E-9
score: 45.0
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 11..151
e-value: 1.9E-39
score: 135.9
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..151
e-value: 2.1E-61
score: 209.7
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 2..151
NoneNo IPR availablePANTHERPTHR11588:SF43TUBULIN BETA-3 CHAINcoord: 2..151
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 106..112