ras-specific guanine nucleotide-releasing factor 1

Overview
Nameras-specific guanine nucleotide-releasing factor 1
Smed IDSMED30019001
Length (bp)5784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras-specific guanine nucleotide-releasing factor 1 (SMED30019001) t-SNE clustered cells

Violin plots show distribution of expression levels for ras-specific guanine nucleotide-releasing factor 1 (SMED30019001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras-specific guanine nucleotide-releasing factor 1 (SMED30019001) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras-specific guanine nucleotide-releasing factor 1 (SMED30019001) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019001h1SMcG0006436 SmedASXL_017049SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 SmedASXL_017050SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019001h1SMcG0006436 dd_Smed_v4_18313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019001h1SMcG0006436 dd_Smed_v4_18313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019001h1SMcG0006436 dd_Smed_v4_18313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30019001h1SMcG0006436 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019001h1SMcG0006436 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019001h1SMcG0006436 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019001h1SMcG0006436 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019001h1SMcG0012664 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019001h1SMcG0012664 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019001h1SMcG0012664 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019001h1SMcG0012664 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 dd_Smed_v6_18313_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 dd_Smed_v6_3107_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0012664 dd_Smed_v6_3107_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 OX_Smed_1.0.10259ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 OX_Smed_1.0.09165ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 OX_Smed_1.0.14981ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019001h1SMcG0006436 OX_Smed_1.0.12923ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019001h1SMcG0006436 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019001h1SMcG0012664 dd_Smed_v4_3107_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Human
Match: RASGRF1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:HGNC Symbol;Acc:HGNC:9875])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 389/723 (53.80%), Postives = 505/723 (69.85%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKS--NDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEE-------LAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  +  L   AR+DG  T  G+L K+SSD  KWQ ++F L +NLLFY++ + S RPSG+ LLEGC C++  + K   + K    + + F + +  E Q+  +LRT+   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+       L AE+  L  +   ++ ++    N     +E  +++KIKKVQSF RGWLCRR+WK I+++YIRS HA+SMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMI+EGC+ILLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G I+L+DCTL+E+ +      +         G G    HL                 DF+I +E K+SPP ++ L+ASS QEKAAW SDISQC++ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT  I +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVASLGLLARKDG--TRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPN-----DEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVISLIDCTLLEEPESTEEEAK---------GSGQDIDHL-----------------DFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKP 685          

HSP 2 Score: 362.073 bits (928), Expect = 1.251e-102
Identity = 168/326 (51.53%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+++ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I L+ I         + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK +K E+ P+++  +  FN++S L+ SEI+   DIN RV+ IEKW A+ADICRC+HNYN VL+I ++   S+++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+IE   +VT YLLD++ +++EE  Y++SLRIEP+
Sbjct:  929 VIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPK 1254          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Human
Match: RASGRF2 (Ras protein specific guanine nucleotide releasing factor 2 [Source:HGNC Symbol;Acc:HGNC:9876])

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 385/724 (53.18%), Postives = 508/724 (70.17%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQG---------YCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+     +  +    QG         Y F + +  EGQ+  +LR + E +   W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +   S   +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q F+RQGSLIQV + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L+DCTLIE+      P   D+ + G   V                    +  +DF+I++E  ++   ++ LLA S QEKAAW SDISQC++ +  + L+     E S V++P  I+SD +L++DD DI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKSVRYNEGHALYLAFLARKEG--TKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEGCSCER---TPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLS----LKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEE------PDASDDDSKGSGQV--------------------FGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRP 689          

HSP 2 Score: 234.958 bits (598), Expect = 6.925e-62
Identity = 113/235 (48.09%), Postives = 161/235 (68.51%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREAL 5091
            +I   AT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K A  +LR L  D      + L+ I+        + F++LSA+++AEQ+T LDH IFRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I++  D++ R   IEKW A+ADICRC+HNYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L
Sbjct:  909 IIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAAANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETL 1143          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Human
Match: RASGRF2 (Ras protein specific guanine nucleotide releasing factor 2 [Source:HGNC Symbol;Acc:HGNC:9876])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 385/724 (53.18%), Postives = 508/724 (70.17%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQG---------YCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+     +  +    QG         Y F + +  EGQ+  +LR + E +   W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +   S   +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q F+RQGSLIQV + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L+DCTLIE+      P   D+ + G   V                    +  +DF+I++E  ++   ++ LLA S QEKAAW SDISQC++ +  + L+     E S V++P  I+SD +L++DD DI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKSVRYNEGHALYLAFLARKEG--TKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEGCSCER---TPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLS----LKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEE------PDASDDDSKGSGQV--------------------FGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRP 689          

HSP 2 Score: 357.836 bits (917), Expect = 2.620e-101
Identity = 167/326 (51.23%), Postives = 232/326 (71.17%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I   AT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K A  +LR L  D      + L+ I+        + F++LSA+++AEQ+T LDH IFRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I++  D++ R   IEKW A+ADICRC+HNYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQT YRI+  P+V  YLLD+  +++E+  Y+ SL+IEPR
Sbjct:  909 IIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAAANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPR 1234          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Human
Match: RASGRF1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:HGNC Symbol;Acc:HGNC:9875])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 390/736 (52.99%), Postives = 505/736 (68.61%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKS--NDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEE-------LAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSI-------------RSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  +  L   AR+DG  T  G+L K+SSD  KWQ ++F L +NLLFY++ + S RPSG+ LLEGC C++  + K   + K    + + F + +  E Q+  +LRT+   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+       L AE+  L  +   ++ ++    N     +E  +++KIKKVQSF RGWLCRR+WK I+++YIRS HA+SMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMI+EGC+ILLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G I+L+DCTL+E+ +      +         G G    HL                 DF+I +E K+SPP ++ L+ASS QEKAAW SDISQC++ +  + L+ ++  E S V++PQ I             RSD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT  I +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVASLGLLARKDG--TRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPN-----DEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVISLIDCTLLEEPESTEEEAK---------GSGQDIDHL-----------------DFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKP 698          

HSP 2 Score: 362.073 bits (928), Expect = 1.766e-102
Identity = 168/326 (51.53%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+++ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I L+ I         + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK +K E+ P+++  +  FN++S L+ SEI+   DIN RV+ IEKW A+ADICRC+HNYN VL+I ++   S+++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+IE   +VT YLLD++ +++EE  Y++SLRIEP+
Sbjct:  945 VIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPK 1270          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Human
Match: RASGRF2 (Ras protein specific guanine nucleotide releasing factor 2 [Source:HGNC Symbol;Acc:HGNC:9876])

HSP 1 Score: 511.916 bits (1317), Expect = 6.723e-163
Identity = 268/471 (56.90%), Postives = 353/471 (74.95%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQG---------YCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSL 1512
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+     +  +    QG         Y F + +  EGQ+  +LR + E +   W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +   S   +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q F+RQG++
Sbjct:    1 MQKSVRYNEGHALYLAFLARKEG--TKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEGCSCER---TPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGTM 466          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Celegans
Match: sos-1 (Son of sevenless homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D3])

HSP 1 Score: 114.775 bits (286), Expect = 4.145e-25
Identity = 72/278 (25.90%), Postives = 133/278 (47.84%), Query Frame = 1
Query: 4648 DSFD--TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGA----------------------LNVSE--------NKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLD-------RTRLLEEEKTYQASLRIEPR 5364
            D +D  TL  ++I  QLT L   ++R+I+  EL+   W KA+K  K+P +L ++     L+  V   IV    + +R+A   +   +  +   +HN+ G++   +A  +S ++RLK  W+ +  + +   ++   L   + R++ M++ L   +PPCIP+ G YL+++ F+E+G                       L  S+         +L++F K+R I++ IREIQ +Q   Y +   P +  +          ++    EE  Y  SL I+P+
Sbjct:  889 DHYDLLTLHPIEIGRQLTLLHSDLYRAIQPIELVEAAWTKAEKWRKSPQLLRLTDHSTLLTYWVSRSIVETESLEERMAMFNRVLEVMSVFEELHNFTGLVAFYSALNSSCIFRLKWCWDGLDNEKKKCFDRFNTLC--ERRWQEMQKRLSSINPPCIPFFGHYLSNIYFLEQGNSTFVNKSPPHGAAGAQKQQKDDLKASDPENSNKQFKQLVSFLKLRKISNVIREIQIFQDQRYSLTLEPTIRQFFESINPKNDFKSNEDLEEYLYNKSLEIQPK 1164          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 100.523 bits (249), Expect = 1.002e-20
Identity = 61/205 (29.76%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 4660 TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRC--DPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRI 5268
            +L+A  +A QLT  D  +F +I  +E L+  + K D    +P +      FN     V +EI +   +  R   I+K+  +A  CR + N+N +  I +     +V RL  +WE+V  +    ++++  LV         R+ L     +PP +P   +   DL+F  +G    SE KLINF K+R+IA +IR + +    PY I
Sbjct:  769 SLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLF-KLDSKYGSPKLEEFEQLFNREMWWVATEICTERHVQKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQEPPVVPIYPVIKKDLTFAHDGNATYSE-KLINFEKLRLIAKSIRGVMKLSSAPYEI 971          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 100.523 bits (249), Expect = 1.002e-20
Identity = 61/205 (29.76%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 4660 TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRC--DPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRI 5268
            +L+A  +A QLT  D  +F +I  +E L+  + K D    +P +      FN     V +EI +   +  R   I+K+  +A  CR + N+N +  I +     +V RL  +WE+V  +    ++++  LV         R+ L     +PP +P   +   DL+F  +G    SE KLINF K+R+IA +IR + +    PY I
Sbjct:  769 SLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLF-KLDSKYGSPKLEEFEQLFNREMWWVATEICTERHVQKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQEPPVVPIYPVIKKDLTFAHDGNATYSE-KLINFEKLRLIAKSIRGVMKLSSAPYEI 971          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 100.523 bits (249), Expect = 1.033e-20
Identity = 61/205 (29.76%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 4660 TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRC--DPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRI 5268
            +L+A  +A QLT  D  +F +I  +E L+  + K D    +P +      FN     V +EI +   +  R   I+K+  +A  CR + N+N +  I +     +V RL  +WE+V  +    ++++  LV         R+ L     +PP +P   +   DL+F  +G    SE KLINF K+R+IA +IR + +    PY I
Sbjct:  892 SLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLF-KLDSKYGSPKLEEFEQLFNREMWWVATEICTERHVQKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQEPPVVPIYPVIKKDLTFAHDGNATYSE-KLINFEKLRLIAKSIRGVMKLSSAPYEI 1094          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 100.523 bits (249), Expect = 1.033e-20
Identity = 61/205 (29.76%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 4660 TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRC--DPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRI 5268
            +L+A  +A QLT  D  +F +I  +E L+  + K D    +P +      FN     V +EI +   +  R   I+K+  +A  CR + N+N +  I +     +V RL  +WE+V  +    ++++  LV         R+ L     +PP +P   +   DL+F  +G    SE KLINF K+R+IA +IR + +    PY I
Sbjct:  892 SLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLF-KLDSKYGSPKLEEFEQLFNREMWWVATEICTERHVQKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQEPPVVPIYPVIKKDLTFAHDGNATYSE-KLINFEKLRLIAKSIRGVMKLSSAPYEI 1094          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Fly
Match: Sos (gene:FBgn0001965 transcript:FBtr0080541)

HSP 1 Score: 169.859 bits (429), Expect = 1.075e-41
Identity = 113/344 (32.85%), Postives = 185/344 (53.78%), Query Frame = 1
Query: 4408 MRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVL-----------KKI------DLDVILTPIHIPSRD-SFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSEN-KLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYL--LDRTRLLEEEKT----YQASLRIEPR 5364
             RVLNV+RHW+     DF+ DP        LLE L+   N +  EH V G+ +R+ +D  L +           KKI      D   I   + +P+ + +  TL  L++A QLT L+ +++++++ SEL+   W K DK  K+P++L +      ++R +   I    +  +R+A +++   +  +   ++N+NG+L I AA   +SVYRL+ T++ +P++ R  +E+ + L  SD   K  +E L   +PPC+P+ G YLT++  +EEG  ++  N +LINF K R +A  I EIQQYQ  PY +     +  +   LD    L +++     Y  SLRIEPR
Sbjct:  738 FRVLNVLRHWVDHHFYDFEKDP-------MLLEKLL---NFL--EH-VNGKSMRKWVDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECREL--SDDHLKKYQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPR 1066          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Fly
Match: CG5522 (gene:FBgn0034158 transcript:FBtr0087031)

HSP 1 Score: 117.472 bits (293), Expect = 3.332e-26
Identity = 80/268 (29.85%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 4594 LKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIE-----EGALNVSE--NKLINFCKMRMIAHTIREIQQYQQTPYR-IERHPRVTDYL-----LDRTRLLEEEKTYQASLRIE 5358
            +K++D  VIL+ + +P+    D L     A Q+T LD  +F  I+  EL +  W K DK    P+++  + RFN  S   V EI++      R   I  +  +A     ++N + +  I +A  ++S+YRL +TW  + K+ R   ++L ++ S    + N+R  L     PCIPYLG++LTDL +I+     +G L   +  NK+ N          +R I  YQQ+ Y+ +++H     YL     ++  + + EE  Y+ SL +E
Sbjct:  152 IKQLDA-VILSALRVPA----DVL-----ANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNI---------LRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLE 400          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Fly
Match: CG5522 (gene:FBgn0034158 transcript:FBtr0087028)

HSP 1 Score: 117.472 bits (293), Expect = 3.332e-26
Identity = 80/268 (29.85%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 4594 LKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIE-----EGALNVSE--NKLINFCKMRMIAHTIREIQQYQQTPYR-IERHPRVTDYL-----LDRTRLLEEEKTYQASLRIE 5358
            +K++D  VIL+ + +P+    D L     A Q+T LD  +F  I+  EL +  W K DK    P+++  + RFN  S   V EI++      R   I  +  +A     ++N + +  I +A  ++S+YRL +TW  + K+ R   ++L ++ S    + N+R  L     PCIPYLG++LTDL +I+     +G L   +  NK+ N          +R I  YQQ+ Y+ +++H     YL     ++  + + EE  Y+ SL +E
Sbjct:  152 IKQLDA-VILSALRVPA----DVL-----ANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNI---------LRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLE 400          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Fly
Match: CG5522 (gene:FBgn0034158 transcript:FBtr0087027)

HSP 1 Score: 117.472 bits (293), Expect = 3.332e-26
Identity = 80/268 (29.85%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 4594 LKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIE-----EGALNVSE--NKLINFCKMRMIAHTIREIQQYQQTPYR-IERHPRVTDYL-----LDRTRLLEEEKTYQASLRIE 5358
            +K++D  VIL+ + +P+    D L     A Q+T LD  +F  I+  EL +  W K DK    P+++  + RFN  S   V EI++      R   I  +  +A     ++N + +  I +A  ++S+YRL +TW  + K+ R   ++L ++ S    + N+R  L     PCIPYLG++LTDL +I+     +G L   +  NK+ N          +R I  YQQ+ Y+ +++H     YL     ++  + + EE  Y+ SL +E
Sbjct:  152 IKQLDA-VILSALRVPA----DVL-----ANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNI---------LRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLE 400          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Fly
Match: CG5522 (gene:FBgn0034158 transcript:FBtr0087030)

HSP 1 Score: 117.087 bits (292), Expect = 4.834e-26
Identity = 80/268 (29.85%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 4594 LKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIE-----EGALNVSE--NKLINFCKMRMIAHTIREIQQYQQTPYR-IERHPRVTDYL-----LDRTRLLEEEKTYQASLRIE 5358
            +K++D  VIL+ + +P+    D L     A Q+T LD  +F  I+  EL +  W K DK    P+++  + RFN  S   V EI++      R   I  +  +A     ++N + +  I +A  ++S+YRL +TW  + K+ R   ++L ++ S    + N+R  L     PCIPYLG++LTDL +I+     +G L   +  NK+ N          +R I  YQQ+ Y+ +++H     YL     ++  + + EE  Y+ SL +E
Sbjct:  152 IKQLDA-VILSALRVPA----DVL-----ANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNI---------LRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLE 400          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Zebrafish
Match: rasgrf2b (Ras protein-specific guanine nucleotide-releasing factor 2b [Source:NCBI gene;Acc:553520])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 390/718 (54.32%), Postives = 517/718 (72.01%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM--VNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEE--LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE     L+  AR++G  T  G+L KK+++  KW +++F LY+N+LFY+D ++S RPSG+ LLEGC CE++  + V +  K+  ++   F + +  +GQ+  +LRT+ E +C+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +++           E E+  ++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE+             AN E            +N+ +V     +  +DF+I++E  ++P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKSVRYNEGHALFLSVIARKEG--TKRGYLSKKTTENSKWHEKFFALYQNVLFYFDTDQSARPSGIYLLEGCTCERVPALKVSTVGKDALDKLQYFLVVFGHDGQKPLELRTEEESDCDEWVEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIALNKTKERM-RPYHVFQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPD-----------ANDEDA----------KNSGQV-----FGHLDFKIVVEPSDAPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMEKLADIYKKP 685          

HSP 2 Score: 377.481 bits (968), Expect = 4.938e-108
Identity = 173/326 (53.07%), Postives = 236/326 (72.39%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  + CLLE+++ + +L+P E K    +L  L  D     ++ ++ IL     P  + F++LSA++IAEQ+T LDH +FRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I+S  D+  R   IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT YLLD+T +++E+  Y  SL+IEPR
Sbjct:  916 IIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMGVICLLEEVLRDPDLLPQERKATANILSALSQDDQDDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLLDHIVFRSIPYEEFLGQGWMKTDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRAGSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQYLLDKTLIMDEDTLYDLSLKIEPR 1241          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Zebrafish
Match: rasgrf2a (Ras protein-specific guanine nucleotide-releasing factor 2a [Source:ZFIN;Acc:ZDB-GENE-111128-1])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 390/719 (54.24%), Postives = 515/719 (71.63%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM----VNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESE-ELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +L+  AR++G     G L KK+++  +W ++YF LY+N+LFY++ E+S RPSG+ LLEG  CE++    V+    + +++ Q Y F + +  +GQ+  +LR++ E +CN WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +S+          +E + +++KIK VQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + EK K  + RLGS       RKE  RQ FLFT H LI TR S G+LHL K  G ++L++CTLIE    EL   ++D +A G+                        N ++F+I++E  +    S+ LLA S QEKAAW SDISQCI+ +  + L+NS   + S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P
Sbjct:    1 MQKSVRYNEGHALYLSMVARKEG--IKRGHLSKKAAENNRWNEKYFALYQNVLFYFENEQSTRPSGIYLLEGSTCERIPAPKVSTVGKESSDKQQHY-FLVIFGHDGQKPLELRSEEEADCNEWVEVIQQASYSDLIIEREVLMQKYIHLVQIMETEKVAANQLRTQLEDQDTEIERLKAEIVVLNKSKERMLPFQSFQDEEDPDIKKIKMVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVLQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSKMMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVEKGKLSKVRLGSLTL----RKEAERQCFLFTKHFLICTRTSGGKLHLLKQGGTLSLIECTLIE----ELDTSDEDYNAAGQ----------------------GLNHLEFKIVVEPADGSSFSVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMNSVFEDNSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVMDKLADIYKKP 686          

HSP 2 Score: 365.155 bits (936), Expect = 3.075e-104
Identity = 167/344 (48.55%), Postives = 246/344 (71.51%), Query Frame = 1
Query: 4333 ANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            ++P G       ++K   +I  AAT RVLNV+RHW+SK  +DF+ + EL   +  LLE+++ + +L+P E K A  +L  L  ++    ++ ++ I+  +  P  + F++LSA+++AEQ+T LDH +FR+I   E L Q WMK DK E+ P+++  S  FN++S LV SEI++  D++ R   I+KW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  +++LQ +VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQ PYRIE  P+VT +LLD+T +++E+  Y+ SL+IEPR
Sbjct:  843 SSPQGFTNPEKSYDKEF-LIRRAATNRVLNVLRHWVSKHSQDFEMNAELTTAVMALLEEVLRDPDLLPQERKAAVNILSALSQEEQDDSQLKIEDIVQMVDCPRAECFESLSAMELAEQITLLDHIVFRNIPYEEFLGQGWMKMDKNERTPYIMKTSQHFNDMSNLVASEIMAHADVSSRAGSIDKWLAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDRLQKIVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQAPYRIELQPKVTQFLLDKTLVMDEDTLYELSLKIEPR 1185          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Zebrafish
Match: rasgrf2a (Ras protein-specific guanine nucleotide-releasing factor 2a [Source:ZFIN;Acc:ZDB-GENE-111128-1])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 390/719 (54.24%), Postives = 515/719 (71.63%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM----VNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESE-ELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +L+  AR++G     G L KK+++  +W ++YF LY+N+LFY++ E+S RPSG+ LLEG  CE++    V+    + +++ Q Y F + +  +GQ+  +LR++ E +CN WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +S+          +E + +++KIK VQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + EK K  + RLGS       RKE  RQ FLFT H LI TR S G+LHL K  G ++L++CTLIE    EL   ++D +A G+                        N ++F+I++E  +    S+ LLA S QEKAAW SDISQCI+ +  + L+NS   + S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P
Sbjct:    1 MQKSVRYNEGHALYLSMVARKEG--IKRGHLSKKAAENNRWNEKYFALYQNVLFYFENEQSTRPSGIYLLEGSTCERIPAPKVSTVGKESSDKQQHY-FLVIFGHDGQKPLELRSEEEADCNEWVEVIQQASYSDLIIEREVLMQKYIHLVQIMETEKVAANQLRTQLEDQDTEIERLKAEIVVLNKSKERMLPFQSFQDEEDPDIKKIKMVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVLQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSKMMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVEKGKLSKVRLGSL----TLRKEAERQCFLFTKHFLICTRTSGGKLHLLKQGGTLSLIECTLIE----ELDTSDEDYNAAGQ----------------------GLNHLEFKIVVEPADGSSFSVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMNSVFEDNSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVMDKLADIYKKP 686          

HSP 2 Score: 365.54 bits (937), Expect = 3.350e-104
Identity = 167/344 (48.55%), Postives = 246/344 (71.51%), Query Frame = 1
Query: 4333 ANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            ++P G       ++K   +I  AAT RVLNV+RHW+SK  +DF+ + EL   +  LLE+++ + +L+P E K A  +L  L  ++    ++ ++ I+  +  P  + F++LSA+++AEQ+T LDH +FR+I   E L Q WMK DK E+ P+++  S  FN++S LV SEI++  D++ R   I+KW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  +++LQ +VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQ PYRIE  P+VT +LLD+T +++E+  Y+ SL+IEPR
Sbjct:  877 SSPQGFTNPEKSYDKEF-LIRRAATNRVLNVLRHWVSKHSQDFEMNAELTTAVMALLEEVLRDPDLLPQERKAAVNILSALSQEEQDDSQLKIEDIVQMVDCPRAECFESLSAMELAEQITLLDHIVFRNIPYEEFLGQGWMKMDKNERTPYIMKTSQHFNDMSNLVASEIMAHADVSSRAGSIDKWLAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDRLQKIVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQAPYRIELQPKVTQFLLDKTLVMDEDTLYELSLKIEPR 1219          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Zebrafish
Match: rasgrf2a (Ras protein-specific guanine nucleotide-releasing factor 2a [Source:ZFIN;Acc:ZDB-GENE-111128-1])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 390/719 (54.24%), Postives = 515/719 (71.63%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM----VNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESE-ELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +L+  AR++G     G L KK+++  +W ++YF LY+N+LFY++ E+S RPSG+ LLEG  CE++    V+    + +++ Q Y F + +  +GQ+  +LR++ E +CN WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +S+          +E + +++KIK VQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + EK K  + RLGS       RKE  RQ FLFT H LI TR S G+LHL K  G ++L++CTLIE    EL   ++D +A G+                        N ++F+I++E  +    S+ LLA S QEKAAW SDISQCI+ +  + L+NS   + S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P
Sbjct:    1 MQKSVRYNEGHALYLSMVARKEG--IKRGHLSKKAAENNRWNEKYFALYQNVLFYFENEQSTRPSGIYLLEGSTCERIPAPKVSTVGKESSDKQQHY-FLVIFGHDGQKPLELRSEEEADCNEWVEVIQQASYSDLIIEREVLMQKYIHLVQIMETEKVAANQLRTQLEDQDTEIERLKAEIVVLNKSKERMLPFQSFQDEEDPDIKKIKMVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVLQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSKMMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVEKGKLSKVRLGSLTL----RKEAERQCFLFTKHFLICTRTSGGKLHLLKQGGTLSLIECTLIE----ELDTSDEDYNAAGQ----------------------GLNHLEFKIVVEPADGSSFSVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMNSVFEDNSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVMDKLADIYKKP 686          

HSP 2 Score: 365.54 bits (937), Expect = 5.402e-104
Identity = 167/344 (48.55%), Postives = 246/344 (71.51%), Query Frame = 1
Query: 4333 ANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            ++P G       ++K   +I  AAT RVLNV+RHW+SK  +DF+ + EL   +  LLE+++ + +L+P E K A  +L  L  ++    ++ ++ I+  +  P  + F++LSA+++AEQ+T LDH +FR+I   E L Q WMK DK E+ P+++  S  FN++S LV SEI++  D++ R   I+KW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  +++LQ +VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQ PYRIE  P+VT +LLD+T +++E+  Y+ SL+IEPR
Sbjct:  896 SSPQGFTNPEKSYDKEF-LIRRAATNRVLNVLRHWVSKHSQDFEMNAELTTAVMALLEEVLRDPDLLPQERKAAVNILSALSQEEQDDSQLKIEDIVQMVDCPRAECFESLSAMELAEQITLLDHIVFRNIPYEEFLGQGWMKMDKNERTPYIMKTSQHFNDMSNLVASEIMAHADVSSRAGSIDKWLAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDRLQKIVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQAPYRIELQPKVTQFLLDKTLVMDEDTLYELSLKIEPR 1238          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Zebrafish
Match: RASGRF1 (si:ch211-234p18.3 [Source:ZFIN;Acc:ZDB-GENE-090311-28])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 390/718 (54.32%), Postives = 511/718 (71.17%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSN--DKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNS--SQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  + +L   A++DG  T  G L KKSSD  KW  ++F L +N+LFY++ E S RPSG+ LLEGC C++  + K +   K    + Y F + +  E Q+  +LRT+   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+   E+++LKSE+  + +   + ++S  +   ++  E++KIKKVQSF RGW+CRR+WK I+++YIRS HAESMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMIVEGC+ILLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G ++L+DCTLIE+      P   D+ +  E   G   +HL                 DF+I++E K+S   +  L+ASS QEK+AW SDISQCI+ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT+   +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVTYLGLLAKKDG--TRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSSRPSGLYLLEGCVCDRSPSPKPSLSAKECLEKQYYFTVSFNHENQKALELRTEDVKDCDEWVAAISHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAAMLKDNEKIQSSPTTAPSDDDSEIKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVVSLIDCTLIEE------PEGTDDESKSEKS-GQDMEHL-----------------DFKIVVEPKDSQSFTFILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTSADVVLDKLITIYKRP 687          

HSP 2 Score: 366.311 bits (939), Expect = 3.374e-104
Identity = 171/326 (52.45%), Postives = 235/326 (72.09%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+++ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I L+ +L        +SF+  SAL+IAEQLT LDH +F+ I   E   Q WMK DK EK P+++  +  FN++S L+ +EI+   D+N RVA +EKW A+ADICRC+HNYN VL+I ++   SS++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+  P+   YLLDR+ ++EEE  Y+ASLRIEP+
Sbjct:  928 VIRRAATNRVLNVLRHWVSKHSQDFETNTELKMKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQICLEEVLQMAEGGKSESFENHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMKTTKHFNDISDLIATEILRCEDVNVRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDYQPKAALYLLDRSAVMEEEGLYEASLRIEPK 1253          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Xenopus
Match: ctdsp1 (CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GENE-984307])

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 391/717 (54.53%), Postives = 513/717 (71.55%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVN--VKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQKT+R+NE    HLA  AR++G  +  G L KK+++T +W +++F LY+N+LFY++ E+S RPSGV LLEGC CE+++   V S  K+   + + F + +  E Q+  +LR + E + + WVE I QAS+S     +E L QK++HL+QI+E+E+ A     QQ E+   E+++LKSE+  L +++   +       +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ L++A+SKLEELS +MHDEVS+TENIRKNL+IERMIVEGCDILLD +Q FVRQG+LIQV + E+ K  + RLG        ++E  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE         E D   +   G G    HL                 DF+I+IE  +SP  ++ LLA S QEKAAW SDISQC+E +  + L+++   E S V++P  IRSD +L++DDVDI FSR LNSCKVPQIR+AS++RL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKTVRLNEGHTLHLALLARKEG--SKRGALSKKATETNRWHEKWFALYQNVLFYFESEQSGRPSGVYLLEGCSCERVIAPIVASGGKDTMEKQHYFTVTFGHEAQKPLELRCEEEPDRDEWVEAIHQASYSDVLIEREVLMQKYIHLVQIVETEKIAANQLRQQLEDQDTEIERLKSEIVALNKTKERMRPYQMNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAEAEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARINNWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYETNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLDFAQSKLEELSRVMHDEVSDTENIRKNLSIERMIVEGCDILLDTSQTFVRQGTLIQVPSVERGKLSKVRLGPLSL----KREGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIE---------EPDLGEDDTKGTGYVFGHL-----------------DFKIVIEPVDSPSFTVVLLAPSRQEKAAWTSDISQCVENIRCNGLMSNVFEENSKVTVPHMIRSDARLHKDDVDICFSRTLNSCKVPQIRYASVDRLLERLTDLRFLSIDFLNTFLHTYRIFTAAFVVLEKLADIYKRP 685          

HSP 2 Score: 367.851 bits (943), Expect = 1.018e-104
Identity = 179/363 (49.31%), Postives = 249/363 (68.60%), Query Frame = 1
Query: 4279 GC-INPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            GC ++PA             +P G      + +K   +I  AAT RVLNV+RHW+SK  +DF+ + E+K  +  LLED++ + +L+P E K A  +L  L  ++     + L+ I+     PS +  +TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK+E+ P+++  S  FN++S LV SEI+   D+  R + IEKW  +ADICRC+HNYNGVL+I +A   S+VYRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT +LL+++R+L+E+  Y+ SLRIEPR
Sbjct:  868 GCSVSPASAFAIATAGAGHGSPPGFNNMERICDKEF-IIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQERKAATNILSALSQEEQDDCHLVLEDIINMSESPSSECLETLSAMELAEQITLLDHIVFRSIPYQEFLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVPSRASSIEKWVVVADICRCMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQFLLNKSRILDEDNLYELSLRIEPR 1229          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Xenopus
Match: ctdsp1 (CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GENE-984307])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 391/717 (54.53%), Postives = 512/717 (71.41%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVN--VKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQKT+R+NE    HLA  AR++G     G L KK+++T +W +++F LY+N+LFY++ E+S RPSGV LLEGC CE+++   V S  K+   + + F + +  E Q+  +LR + E + + WVE I QAS+S     +E L QK++HL+QI+E+E+ A     QQ E+   E+++LKSE+  L +++   +       +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ L++A+SKLEELS +MHDEVS+TENIRKNL+IERMIVEGCDILLD +Q FVRQG+LIQV + E+ K  + RLG        ++E  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE         E D   +   G G    HL                 DF+I+IE  +SP  ++ LLA S QEKAAW SDISQC+E +  + L+++   E S V++P  IRSD +L++DDVDI FSR LNSCKVPQIR+AS++RL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKTVRLNEGHTLHLALLARKEGSK--RGALSKKATETNRWHEKWFALYQNVLFYFESEQSGRPSGVYLLEGCSCERVIAPIVASGGKDTMEKQHYFTVTFGHEAQKPLELRCEEEPDRDEWVEAIHQASYSDVLIEREVLMQKYIHLVQIVETEKIAANQLRQQLEDQDTEIERLKSEIVALNKTKERMRPYQMNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAEAEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARINNWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYETNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLDFAQSKLEELSRVMHDEVSDTENIRKNLSIERMIVEGCDILLDTSQTFVRQGTLIQVPSVERGKLSKVRLGPLSL----KREGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIE---------EPDLGEDDTKGTGYVFGHL-----------------DFKIVIEPVDSPSFTVVLLAPSRQEKAAWTSDISQCVENIRCNGLMSNVFEENSKVTVPHMIRSDARLHKDDVDICFSRTLNSCKVPQIRYASVDRLLERLTDLRFLSIDFLNTFLHTYRIFTAAFVVLEKLADIYKRP 685          

HSP 2 Score: 366.311 bits (939), Expect = 2.200e-104
Identity = 172/326 (52.76%), Postives = 237/326 (72.70%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + E+K  +  LLED++ + +L+P E K A  +L  L  ++     + L+ I+     PS +  +TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK+E+ P+++  S  FN++S LV SEI+   D+  R + IEKW  +ADICRC+HNYNGVL+I +A   S+VYRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT +LL+++R+L+E+  Y+ SLRIEPR
Sbjct:  888 IIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQERKAATNILSALSQEEQDDCHLVLEDIINMSESPSSECLETLSAMELAEQITLLDHIVFRSIPYQEFLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVPSRASSIEKWVVVADICRCMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQFLLNKSRILDEDNLYELSLRIEPR 1213          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Xenopus
Match: ctdsp1 (CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GENE-984307])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 391/717 (54.53%), Postives = 513/717 (71.55%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVN--VKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQKT+R+NE    HLA  AR++G  +  G L KK+++T +W +++F LY+N+LFY++ E+S RPSGV LLEGC CE+++   V S  K+   + + F + +  E Q+  +LR + E + + WVE I QAS+S     +E L QK++HL+QI+E+E+ A     QQ E+   E+++LKSE+  L +++   +       +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ L++A+SKLEELS +MHDEVS+TENIRKNL+IERMIVEGCDILLD +Q FVRQG+LIQV + E+ K  + RLG        ++E  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE         E D   +   G G    HL                 DF+I+IE  +SP  ++ LLA S QEKAAW SDISQC+E +  + L+++   E S V++P  IRSD +L++DDVDI FSR LNSCKVPQIR+AS++RL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKTVRLNEGHTLHLALLARKEG--SKRGALSKKATETNRWHEKWFALYQNVLFYFESEQSGRPSGVYLLEGCSCERVIAPIVASGGKDTMEKQHYFTVTFGHEAQKPLELRCEEEPDRDEWVEAIHQASYSDVLIEREVLMQKYIHLVQIVETEKIAANQLRQQLEDQDTEIERLKSEIVALNKTKERMRPYQMNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAEAEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARINNWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYETNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLDFAQSKLEELSRVMHDEVSDTENIRKNLSIERMIVEGCDILLDTSQTFVRQGTLIQVPSVERGKLSKVRLGPLS----LKREGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIE---------EPDLGEDDTKGTGYVFGHL-----------------DFKIVIEPVDSPSFTVVLLAPSRQEKAAWTSDISQCVENIRCNGLMSNVFEENSKVTVPHMIRSDARLHKDDVDICFSRTLNSCKVPQIRYASVDRLLERLTDLRFLSIDFLNTFLHTYRIFTAAFVVLEKLADIYKRP 685          

HSP 2 Score: 236.884 bits (603), Expect = 1.121e-62
Identity = 118/251 (47.01%), Postives = 168/251 (66.93%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRC-DPPCIPYLGMYL 5136
            +I  AAT RVLNV+RHW+SK  +DF+ + E+K  +  LLED++ + +L+P E K A  +L  L  ++     + L+ I+     PS +  +TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK+E+ P+++  S  FN++S LV SEI+   D+  R + IEKW  +ADICRC+HNYNGVL+I +A   S+VYRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L +    P   Y G+ L
Sbjct:  843 IIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQERKAATNILSALSQEEQDDCHLVLEDIINMSESPSSECLETLSAMELAEQITLLDHIVFRSIPYQEFLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVPSRASSIEKWVVVADICRCMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKKYRGTPGYDYTGLIL 1093          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Xenopus
Match: ctdsp1 (CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GENE-984307])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 391/717 (54.53%), Postives = 512/717 (71.41%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVN--VKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQKT+R+NE    HLA  AR++G     G L KK+++T +W +++F LY+N+LFY++ E+S RPSGV LLEGC CE+++   V S  K+   + + F + +  E Q+  +LR + E + + WVE I QAS+S     +E L QK++HL+QI+E+E+ A     QQ E+   E+++LKSE+  L +++   +       +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ L++A+SKLEELS +MHDEVS+TENIRKNL+IERMIVEGCDILLD +Q FVRQG+LIQV + E+ K  + RLG        ++E  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE         E D   +   G G    HL                 DF+I+IE  +SP  ++ LLA S QEKAAW SDISQC+E +  + L+++   E S V++P  IRSD +L++DDVDI FSR LNSCKVPQIR+AS++RL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKTVRLNEGHTLHLALLARKEGSK--RGALSKKATETNRWHEKWFALYQNVLFYFESEQSGRPSGVYLLEGCSCERVIAPIVASGGKDTMEKQHYFTVTFGHEAQKPLELRCEEEPDRDEWVEAIHQASYSDVLIEREVLMQKYIHLVQIVETEKIAANQLRQQLEDQDTEIERLKSEIVALNKTKERMRPYQMNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAEAEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARINNWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYETNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLDFAQSKLEELSRVMHDEVSDTENIRKNLSIERMIVEGCDILLDTSQTFVRQGTLIQVPSVERGKLSKVRLGPLSL----KREGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIE---------EPDLGEDDTKGTGYVFGHL-----------------DFKIVIEPVDSPSFTVVLLAPSRQEKAAWTSDISQCVENIRCNGLMSNVFEENSKVTVPHMIRSDARLHKDDVDICFSRTLNSCKVPQIRYASVDRLLERLTDLRFLSIDFLNTFLHTYRIFTAAFVVLEKLADIYKRP 685          

HSP 2 Score: 365.54 bits (937), Expect = 2.808e-104
Identity = 172/326 (52.76%), Postives = 237/326 (72.70%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + E+K  +  LLED++ + +L+P E K A  +L  L  ++     + L+ I+     PS +  +TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK+E+ P+++  S  FN++S LV SEI+   D+  R + IEKW  +ADICRC+HNYNGVL+I +A   S+VYRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT +LL+++R+L+E+  Y+ SLRIEPR
Sbjct:  859 IIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQERKAATNILSALSQEEQDDCHLVLEDIINMSESPSSECLETLSAMELAEQITLLDHIVFRSIPYQEFLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVPSRASSIEKWVVVADICRCMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQFLLNKSRILDEDNLYELSLRIEPR 1184          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Xenopus
Match: ctdsp1 (CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GENE-984307])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 391/717 (54.53%), Postives = 513/717 (71.55%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVN--VKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQKT+R+NE    HLA  AR++G  +  G L KK+++T +W +++F LY+N+LFY++ E+S RPSGV LLEGC CE+++   V S  K+   + + F + +  E Q+  +LR + E + + WVE I QAS+S     +E L QK++HL+QI+E+E+ A     QQ E+   E+++LKSE+  L +++   +       +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ L++A+SKLEELS +MHDEVS+TENIRKNL+IERMIVEGCDILLD +Q FVRQG+LIQV + E+ K  + RLG        ++E  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE         E D   +   G G    HL                 DF+I+IE  +SP  ++ LLA S QEKAAW SDISQC+E +  + L+++   E S V++P  IRSD +L++DDVDI FSR LNSCKVPQIR+AS++RL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKTVRLNEGHTLHLALLARKEG--SKRGALSKKATETNRWHEKWFALYQNVLFYFESEQSGRPSGVYLLEGCSCERVIAPIVASGGKDTMEKQHYFTVTFGHEAQKPLELRCEEEPDRDEWVEAIHQASYSDVLIEREVLMQKYIHLVQIVETEKIAANQLRQQLEDQDTEIERLKSEIVALNKTKERMRPYQMNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAEAEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARINNWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYETNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLDFAQSKLEELSRVMHDEVSDTENIRKNLSIERMIVEGCDILLDTSQTFVRQGTLIQVPSVERGKLSKVRLGPLSL----KREGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIE---------EPDLGEDDTKGTGYVFGHL-----------------DFKIVIEPVDSPSFTVVLLAPSRQEKAAWTSDISQCVENIRCNGLMSNVFEENSKVTVPHMIRSDARLHKDDVDICFSRTLNSCKVPQIRYASVDRLLERLTDLRFLSIDFLNTFLHTYRIFTAAFVVLEKLADIYKRP 685          

HSP 2 Score: 204.912 bits (520), Expect = 1.580e-52
Identity = 105/237 (44.30%), Postives = 154/237 (64.98%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSD------GRFKNM 5079
            +I  AAT RVLNV+RHW+SK  +DF+ + E+K  +  LLED++ + +L+P E K A  +L  L  ++     + L+ I+     PS +  +TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK+E+ P+++  S  FN++S LV SEI+   D+  R + IEKW  +ADICRC+HNYNGVL+I +A   S+VYRLK+TW KV KQ  V+ +   + + S+      GR++ M
Sbjct:  888 IIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQERKAATNILSALSQEEQDDCHLVLEDIINMSESPSSECLETLSAMELAEQITLLDHIVFRSIPYQEFLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVPSRASSIEKWVVVADICRCMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQ--VSTDTTGDAIDSNSFTKRRGRYRYM 1122          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Mouse
Match: Rasgrf1 (RAS protein-specific guanine nucleotide-releasing factor 1 [Source:MGI Symbol;Acc:MGI:99694])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 391/755 (51.79%), Postives = 526/755 (69.67%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVK---SNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXX-----XXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRA 2367
            MQK IR+N+  +  L   A++DG  T  G+L K+S+D  KWQ ++F L +NLLFY++ + S RPSG+ LLEG  C++  + K   S+ ++ + Q + F + +  + Q+  +LRT+   +C+ WV  I +AS+       E L QK+LHLLQ++E+E+       QQ E+   E+++LK+E+      +          +  A +E  +++KIKKVQSF RGWLCRR+WK I+++YIRS HA+SMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMI EGC+ILLD +Q FVRQGSL+Q+ ++EKSKS R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G I+L+DCTL+++      P   D+ A    G G   +HL                 +F+I +E K+S P ++ L+AS+ QEKAAW SDI QC++ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFTN + +++ L  I   P    + AR     F+S  +  +   +A  S RA
Sbjct:    1 MQKAIRLNDGHVVTLGLLAQKDG--TRKGYLSKRSADNPKWQTKWFALLQNLLFYFESDSSPRPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDSQKTLELRTEDAKDCDEWVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKTEVTITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLMQMSLSEKSKSSRGRLGSLST----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVISLIDCTLLDE------PENLDDEAK---GAGPEIEHL-----------------EFKIGVEPKDSLPFTVILVASTRQEKAAWTSDIIQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTNAMVVLDKLINIYRKPMSA-IPARSLELLFSSSHNAKLLYGDAPKSPRA 721          

HSP 2 Score: 356.295 bits (913), Expect = 8.535e-101
Identity = 163/326 (50.00%), Postives = 230/326 (70.55%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW++K  +DFD+D  LK  + C LE+++ + +L+  E K A  ++R L  ++   +   L+ ++        + F+   AL+IAEQLT LDH +F+SI   E   Q WMKA+K E+ P+++  +  FN +S  + SEI+   DI+ R + IEKW A+ADICRC+HNYN VL+I ++   S+++RLK+TW KV KQ++  ++KLQ LVSSDGRFKN+RE+L  CDPPC+PYLGMYLTDL FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+  P+V  YLLD + +L+EE  Y++SL IEP+
Sbjct:  934 VIRRAATNRVLNVLRHWVTKHTQDFDTDDTLKYRVICFLEEVMHDPDLLTQERKAAANIIRTLTLEETTEQHSMLEEVILMTEGVKTEPFENHPALEIAEQLTLLDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKTTKHFNHVSNFIASEIIRNEDISARASAIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLLDKLQKLVSSDGRFKNLRESLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTTYKIDPQPKVIQYLLDESFMLDEESLYESSLLIEPK 1259          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Mouse
Match: Rasgrf2 (RAS protein-specific guanine nucleotide-releasing factor 2 [Source:MGI Symbol;Acc:MGI:109137])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 352/723 (48.69%), Postives = 481/723 (66.53%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM-----VNV-KSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQG--SLIQVINEK-SKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+       N   +  ++  ++ Y F + +  +GQ+  +LR + E     W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +        E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I H+DV+S FLN+ET++FLH+IF QGL++++ NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q F+RQG   L   ++   S +PR      G SS+   +   QV + +   L  TR S    H  K     +++ C   E+                        +H  IE  ++ + ++ +   D+  + E  N P  +  L+  S QEK++W  +I QC++ +  + L+     E S V++P  I+SD +L++DD DI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKSVRYNEGHALYLAMLARKEG--TKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSGRPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHDGQKPLELRCEEEQAGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIATNQLRHQLEDQDTEIERLKSEIVALNKTKERMRPYHVHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKKPPINHDDVSSIFLNSETIMFLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGKTGLSSSVDRTFSTAPRRT----GRSSQLEGQC--QVMMISRQRLTITRHSGSCQHYLKLLLFPSIICCLNFEE------------------------RHNNIETPKQCDDMVSH---DYHPVAEPVNGPVFTQILVKGSTQEKSSWKENILQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVLAKLSDIYKRP 688          

HSP 2 Score: 362.073 bits (928), Expect = 3.136e-103
Identity = 169/326 (51.84%), Postives = 233/326 (71.47%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I   AT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K    +LR L  D      + L+ I+     P  + F+TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK E+ P+++  S  FNE+S LV S+I++  DI+ R   IEKW A+ADICRC+HNYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQT YRI++ P+V  YLLD+  +++E+  Y+ SL+IEPR
Sbjct:  860 IIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPKAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNEMSNLVASQIMNYADISSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTAYRIDQQPKVIQYLLDKALVIDEDSLYELSLKIEPR 1185          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Mouse
Match: Rasgrf2 (RAS protein-specific guanine nucleotide-releasing factor 2 [Source:MGI Symbol;Acc:MGI:109137])

HSP 1 Score: 507.294 bits (1305), Expect = 4.247e-162
Identity = 264/468 (56.41%), Postives = 351/468 (75.00%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM-----VNV-KSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSL 1512
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+       N   +  ++  ++ Y F + +  +GQ+  +LR + E     W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +        E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I H+DV+S FLN+ET++FLH+IF QGL++++ NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q F+RQG++
Sbjct:    1 MQKSVRYNEGHALYLAMLARKEG--TKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSGRPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHDGQKPLELRCEEEQAGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIATNQLRHQLEDQDTEIERLKSEIVALNKTKERMRPYHVHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKKPPINHDDVSSIFLNSETIMFLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGAM 466          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Mouse
Match: Rasgrf2 (RAS protein-specific guanine nucleotide-releasing factor 2 [Source:MGI Symbol;Acc:MGI:109137])

HSP 1 Score: 366.311 bits (939), Expect = 3.818e-113
Identity = 198/389 (50.90%), Postives = 275/389 (70.69%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVK------SNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQ 1275
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+           +  ++  ++ Y F + +  +GQ+  +LR + E     W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +        E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I H+DV+S FLN+ET++FLH+IF QGL++++ NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM Q
Sbjct:    1 MQKSVRYNEGHALYLAMLARKEG--TKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSGRPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHDGQKPLELRCEEEQAGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIATNQLRHQLEDQDTEIERLKSEIVALNKTKERMRPYHVHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKKPPINHDDVSSIFLNSETIMFLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQ 387          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Mouse
Match: Rasgrf2 (RAS protein-specific guanine nucleotide-releasing factor 2 [Source:MGI Symbol;Acc:MGI:109137])

HSP 1 Score: 364.385 bits (934), Expect = 9.861e-110
Identity = 169/326 (51.84%), Postives = 233/326 (71.47%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I   AT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K    +LR L  D      + L+ I+     P  + F+TLSA+++AEQ+T LDH +FRSI   E L Q WMK DK E+ P+++  S  FNE+S LV S+I++  DI+ R   IEKW A+ADICRC+HNYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQT YRI++ P+V  YLLD+  +++E+  Y+ SL+IEPR
Sbjct:  260 IIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPKAECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNEMSNLVASQIMNYADISSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTAYRIDQQPKVIQYLLDKALVIDEDSLYELSLKIEPR 585          

HSP 2 Score: 115.546 bits (288), Expect = 1.169e-25
Identity = 53/86 (61.63%), Postives = 67/86 (77.91%), Query Frame = 1
Query: 2011 SSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            S V++P  I+SD +L++DD DI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    3 SKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVLAKLSDIYKRP 88          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. UniProt/SwissProt
Match: sp|A2CEA7|RGRF2_DANRE (Ras-specific guanine nucleotide-releasing factor 2 OS=Danio rerio OX=7955 GN=rasgrf2 PE=3 SV=1)

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 390/718 (54.32%), Postives = 517/718 (72.01%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKM--VNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEE--LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE     L+  AR++G  T  G+L KK+++  KW +++F LY+N+LFY+D ++S RPSG+ LLEGC CE++  + V +  K+  ++   F + +  +GQ+  +LRT+ E +C+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +++           E E+  ++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE+             AN E            +N+ +V     +  +DF+I++E  ++P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKSVRYNEGHALFLSVIARKEG--TKRGYLSKKTTENSKWHEKFFALYQNVLFYFDTDQSARPSGIYLLEGCTCERVPALKVSTVGKDALDKLQYFLVVFGHDGQKPLELRTEEESDCDEWVEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIALNKTKERM-RPYHVFQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPD-----------ANDEDA----------KNSGQV-----FGHLDFKIVVEPSDAPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMEKLADIYKKP 685          

HSP 2 Score: 377.481 bits (968), Expect = 3.727e-107
Identity = 173/326 (53.07%), Postives = 236/326 (72.39%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  + CLLE+++ + +L+P E K    +L  L  D     ++ ++ IL     P  + F++LSA++IAEQ+T LDH +FRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I+S  D+  R   IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT YLLD+T +++E+  Y  SL+IEPR
Sbjct:  916 IIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMGVICLLEEVLRDPDLLPQERKATANILSALSQDDQDDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLLDHIVFRSIPYEEFLGQGWMKTDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRAGSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQYLLDKTLIMDEDTLYDLSLKIEPR 1241          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. UniProt/SwissProt
Match: sp|P28818|RGRF1_RAT (Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus OX=10116 GN=Rasgrf1 PE=1 SV=1)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 391/751 (52.06%), Postives = 525/751 (69.91%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVK--SNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEE--LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRA 2367
            MQK IR+N+  +  L   A++DG  T  G+L K+SSD  KWQ ++F L +NLLFY++ + S RPSG+ LLEG  C++M + K  ++ K +  Q + F + +  + Q+  +LRTD   +C+ WV  I +AS+       E L QK+LHLLQ++E+E+       QQ E+   E+++LK+E+  L +     +++     E E+  ++KIKKVQSF RGWLCRR+WK I+++YIRS HA+SMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS +MHDEVSETENIRKNLAIERMI EGC+ILLD +Q FVRQGSLIQV ++EK K  + RLGS       +KE  RQ FLF+ HL+I TR S  +LHL KN G I+L+DCTL++D      P   D+   G+                      + + +DF+I +E K+SPP ++ L+ASS QEKAAW SDI QC++ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT+ + +++ L  I   P    + AR     F+S  +  +   +A  S RA
Sbjct:    1 MQKAIRLNDGHVVSLGLLAQRDG--TRKGYLSKRSSDNPKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGSICKRMPSPKRGTSSKESDKQHHYFTVNFSNDSQKSLELRTDDSKDCDEWVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKAEIANLIKDNERIQSNQLVAPEDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRVMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLIQVPMSEKGKINKGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGSKLHLTKN-GVISLIDCTLLDD------PENMDDDGKGQ----------------------EVDHLDFKIWVEPKDSPPFTVILVASSRQEKAAWTSDIIQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTDAVVVLDKLISIYKKPITA-IPARSLELLFSSSHNTKLLYGDAPKSPRA 715          

HSP 2 Score: 367.081 bits (941), Expect = 1.213e-103
Identity = 176/361 (48.75%), Postives = 248/361 (68.70%), Query Frame = 1
Query: 4288 NPAICNKATNRYYSTANP--SGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            N +  NK   R  S AN   S D + +     +  VI  AAT RVLNV+RHW++K  +DF++D  LK ++ C LE+++ + +L+P E K A  ++R L  +++      LD +L        + F+  SA++IAEQLT LDH +F+SI   E   Q WMKADK E+ P+++  +  FN +S L+ SEI+   +++ R + IEKW A+ADICRC+HNYN VL+I ++   S+++RLK+TW KV KQ++   +KLQ LVSSDGRFKN+RE L  CDPPC+PYLGMYLTDL+F+EEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+IE  P+VT YL+D T +L++E  Y+ASLRIEP+
Sbjct:  885 NESPANKEIYRRMSLANTGYSSDQRNID----KEFVIRRAATNRVLNVLRHWVTKHSQDFETDDLLKYKVICFLEEVMHDPDLLPQERKAAANIMRTLTQEEITENHSMLDELLLMTEGVKTEPFENHSAMEIAEQLTLLDHLVFKSIPYEEFFGQGWMKADKNERTPYIMKTTRHFNHISNLIASEILRNEEVSARASTIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLFDKLQKLVSSDGRFKNLRETLRNCDPPCVPYLGMYLTDLAFLEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTTYKIEPQPKVTQYLVDETFVLDDESLYEASLRIEPK 1241          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. UniProt/SwissProt
Match: sp|P27671|RGRF1_MOUSE (Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus OX=10090 GN=Rasgrf1 PE=1 SV=2)

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 391/755 (51.79%), Postives = 526/755 (69.67%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVK---SNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXX-----XXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRA 2367
            MQK IR+N+  +  L   A++DG  T  G+L K+S+D  KWQ ++F L +NLLFY++ + S RPSG+ LLEG  C++  + K   S+ ++ + Q + F + +  + Q+  +LRT+   +C+ WV  I +AS+       E L QK+LHLLQ++E+E+       QQ E+   E+++LK+E+      +          +  A +E  +++KIKKVQSF RGWLCRR+WK I+++YIRS HA+SMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMI EGC+ILLD +Q FVRQGSL+Q+ ++EKSKS R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G I+L+DCTL+++      P   D+ A    G G   +HL                 +F+I +E K+S P ++ L+AS+ QEKAAW SDI QC++ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFTN + +++ L  I   P    + AR     F+S  +  +   +A  S RA
Sbjct:    1 MQKAIRLNDGHVVTLGLLAQKDG--TRKGYLSKRSADNPKWQTKWFALLQNLLFYFESDSSPRPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDSQKTLELRTEDAKDCDEWVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKTEVTITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLMQMSLSEKSKSSRGRLGSLST----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVISLIDCTLLDE------PENLDDEAK---GAGPEIEHL-----------------EFKIGVEPKDSLPFTVILVASTRQEKAAWTSDIIQCVDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTNAMVVLDKLINIYRKPMSA-IPARSLELLFSSSHNAKLLYGDAPKSPRA 721          

HSP 2 Score: 356.295 bits (913), Expect = 5.970e-100
Identity = 163/326 (50.00%), Postives = 230/326 (70.55%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW++K  +DFD+D  LK  + C LE+++ + +L+  E K A  ++R L  ++   +   L+ ++        + F+   AL+IAEQLT LDH +F+SI   E   Q WMKA+K E+ P+++  +  FN +S  + SEI+   DI+ R + IEKW A+ADICRC+HNYN VL+I ++   S+++RLK+TW KV KQ++  ++KLQ LVSSDGRFKN+RE+L  CDPPC+PYLGMYLTDL FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+  P+V  YLLD + +L+EE  Y++SL IEP+
Sbjct:  934 VIRRAATNRVLNVLRHWVTKHTQDFDTDDTLKYRVICFLEEVMHDPDLLTQERKAAANIIRTLTLEETTEQHSMLEEVILMTEGVKTEPFENHPALEIAEQLTLLDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKTTKHFNHVSNFIASEIIRNEDISARASAIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSKQTKSLLDKLQKLVSSDGRFKNLRESLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTTYKIDPQPKVIQYLLDESFMLDEESLYESSLLIEPK 1259          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. UniProt/SwissProt
Match: sp|O14827|RGRF2_HUMAN (Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens OX=9606 GN=RASGRF2 PE=1 SV=2)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 385/724 (53.18%), Postives = 508/724 (70.17%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQG---------YCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +LA  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++GE+S RP+G+ LLEGC CE+     +  +    QG         Y F + +  EGQ+  +LR + E +   W+E I QAS++     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +   S   +E  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QL I+V+ FLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE  PACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q F+RQGSLIQV + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L+DCTLIE+      P   D+ + G   V                    +  +DF+I++E  ++   ++ LLA S QEKAAW SDISQC++ +  + L+     E S V++P  I+SD +L++DD DI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    ++  L  I   P
Sbjct:    1 MQKSVRYNEGHALYLAFLARKEG--TKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEGCSCER---TPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLS----LKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEE------PDASDDDSKGSGQV--------------------FGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRP 689          

HSP 2 Score: 357.836 bits (917), Expect = 1.258e-100
Identity = 167/326 (51.23%), Postives = 232/326 (71.17%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I   AT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K A  +LR L  D      + L+ I+        + F++LSA+++AEQ+T LDH IFRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I++  D++ R   IEKW A+ADICRC+HNYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQT YRI+  P+V  YLLD+  +++E+  Y+ SL+IEPR
Sbjct:  909 IIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAAANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPR 1234          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. UniProt/SwissProt
Match: sp|Q13972|RGRF1_HUMAN (Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 390/736 (52.99%), Postives = 505/736 (68.61%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKS--NDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEE-------LAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSI-------------RSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  +  L   AR+DG  T  G+L K+SSD  KWQ ++F L +NLLFY++ + S RPSG+ LLEGC C++  + K   + K    + + F + +  E Q+  +LRT+   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+       L AE+  L  +   ++ ++    N     +E  +++KIKKVQSF RGWLCRR+WK I+++YIRS HA+SMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMI+EGC+ILLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G I+L+DCTL+E+ +      +         G G    HL                 DF+I +E K+SPP ++ L+ASS QEKAAW SDISQC++ +  + L+ ++  E S V++PQ I             RSD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT  I +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVASLGLLARKDG--TRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPN-----DEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVISLIDCTLLEEPESTEEEAK---------GSGQDIDHL-----------------DFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKP 698          

HSP 2 Score: 362.073 bits (928), Expect = 8.483e-102
Identity = 168/326 (51.53%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+++ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I L+ I         + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK +K E+ P+++  +  FN++S L+ SEI+   DIN RV+ IEKW A+ADICRC+HNYN VL+I ++   S+++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+IE   +VT YLLD++ +++EE  Y++SLRIEP+
Sbjct:  945 VIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPK 1270          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. TrEMBL
Match: A0A267F940 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001879g12 PE=4 SV=1)

HSP 1 Score: 1060.44 bits (2741), Expect = 0.000e+0
Identity = 544/784 (69.39%), Postives = 638/784 (81.38%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNN----QNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQA-LNESEELRKIKK---VQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGS--SKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKV--ERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNNLLIKPQLEKTRRISTGMMKME 2442
            MQK IR+N++QL  L+ KAR+ G +TLSG LYK+S DTGKWQ RYFVLY+NLLFYYD ++ DRPSGVALLEG YC+K   +K  ++ +    Q   + F I+YKK+GQR YDLR +T+ +C  WVE I+ +S+SR Q +KEELEQK+LHLLQI+ESER +KWHYV+QTEEL AEV +L+ E+RELKE + +    S+    E+EELRKIKK   VQSFFRGWLCRRRWK IVEEYIRSEHAE MRKRNNIVFGLVECEEEYVQQ++I+VSCFLRP +MAAS+KKPIITHEDVNS FLNAETLLFLHQIFLQGL SK++NWPTLQLGDLFDMLLPML IYQEYVRNHHYSLQVLAEYKQK EF  LLKRYEEK  CEGRS+E+FLTYPMHQIPRYI+TLHELLAHTPHDHVDR++LE+AKSKLE+LS+ MHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQG L Q+ I EK ++ R R+GSF  +     RKE VRQVFLFTNHL++TTRASNGRLHL KNYGKI+L DCTL ED   + F  E D+              LT+E  Q+   +R  DY+G+DFR++++ K+ PP++ITL+A+S QEKAAWCSDI+QCIEQ+HYSDLLNSSLAETS VSMP +IRSDPKL+RDDVDI+FSR LNSCKVPQIRHA++ERL+DRLTDLRFLSIDFLNTFLLTYRVFT   T+++AL+RIL NPE GNL+ RPS    +SLESE                 L +KP+L+K RRISTGMM++E
Sbjct:    1 MQKAIRVNDSQLLLLSGKAREPGCATLSGNLYKRSLDTGKWQLRYFVLYQNLLFYYDSDRCDRPSGVALLEGSYCDKQTALKLPERGDAARQQQWTHAFNIFYKKDGQRHYDLRAETDADCTAWVEAIKNSSYSRLQGIKEELEQKNLHLLQIMESERLSKWHYVKQTEELMAEVAQLRKEVRELKELQHKETALSRTNSEETEELRKIKKISQVQSFFRGWLCRRRWKNIVEEYIRSEHAEHMRKRNNIVFGLVECEEEYVQQITILVSCFLRPCRMAASAKKPIITHEDVNSIFLNAETLLFLHQIFLQGLNSKMDNWPTLQLGDLFDMLLPMLSIYQEYVRNHHYSLQVLAEYKQKAEFTGLLKRYEEKSLCEGRSMETFLTYPMHQIPRYIVTLHELLAHTPHDHVDRQQLEFAKSKLEDLSHAMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGCLTQLPIGEKGRNTRPRIGSFSSTFNKDSRKEAVRQVFLFTNHLILTTRASNGRLHLVKNYGKISLADCTLAEDPSSDFFYYEDDDQT-------APLNQLTVEAGQQRLEQRAADYSGLDFRLIVDFKSGPPVTITLVANSAQEKAAWCSDINQCIEQIHYSDLLNSSLAETSLVSMPHTIRSDPKLFRDDVDIKFSRTLNSCKVPQIRHATVERLLDRLTDLRFLSIDFLNTFLLTYRVFTEPKTVISALKRILTNPEYGNLDPRPSICLQSSLESE----TGGGGGGSGGGGFLHVKPELDKLRRISTGMMRLE 773          

HSP 2 Score: 475.707 bits (1223), Expect = 3.765e-136
Identity = 277/476 (58.19%), Postives = 337/476 (70.80%), Query Frame = 1
Query: 3991 HRQSSPKLIEAPNRTRSSVVSWSGTVNTRKH-KRPSAISCPDHDLMISPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNXXXXXXXXXXX-------XGCINPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPH-VLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSISRQGQP 5391
            H  SSP + ++P   R SV S SG    R      S +         S RPS+   +  D SPP +A+ GAVVTSSR SKRRSSNTAAA AFAAAT          +  A+  + +             ++ S+  KRLS+I TAATMRVLNVVRHW+ KF ED +SDP L+ +M  LLEDLVCNQNL P +HK A Q+L +L ++ L     DL+ ILTP   PS +SF+TLSALDIAEQ+T +DH++FR+++S+EL+ Q WMK +  ++A   VL +S RFN  S LVVSEI+S  DI+ RVACIEKWAAIADICRC+HNYNGVLQICAA VNSSV+RLK+TWE++ K +R  I++LQ LVSSDGRFKNMR ALH CDPPCIPYLGMYLTDLSFIEEG  NV+E  LINFCKMRMIAH IREIQQ+QQTPYRIE + RV DYLLD +RL+E+E+ Y ASL +EPR SI  +  P
Sbjct: 1074 HSASSPTVNQSP--FRGSVASGSGGPMKRTSCAADSTVGDLSAGAPSSGRPSLARSSDVD-SPPCRAKAGAVVTSSRASKRRSSNTAAALAFAAATAGASTLPKSSVRIAVQEQESEVQMPQLMQHRPSESSSIMVKRLSIICTAATMRVLNVVRHWVYKFGEDIESDPTLRADMIDLLEDLVCNQNLFPPDHKAALQILLKLREEPLAEADNDLERILTPAWQPSFESFETLSALDIAEQITLIDHKLFRALKSAELITQAWMKKNPEDRASSTVLQISKRFNATSCLVVSEIISCSDIDRRVACIEKWAAIADICRCLHNYNGVLQICAALVNSSVFRLKKTWERLSKSTRQMIDRLQLLVSSDGRFKNMRSALHNCDPPCIPYLGMYLTDLSFIEEGTSNVTEEGLINFCKMRMIAHIIREIQQFQQTPYRIEHNQRVCDYLLDTSRLIEDERAYAASLLLEPRVSICPESSP 1546          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. TrEMBL
Match: A0A267FCT3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000455g1 PE=4 SV=1)

HSP 1 Score: 1058.13 bits (2735), Expect = 0.000e+0
Identity = 544/827 (65.78%), Postives = 655/827 (79.20%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQ-GYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVI-NEKSKSPRARLGSFGGS---SKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIED------TQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSI--------------RSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNN-----------------------LLIKPQLEKTRRISTGMMKMEVTGTESDG 2466
            MQK IR+N++QL HL+ KAR  G +  +G+L+K+S DTGKWQ RYFVLY+NLLFYYD +KS++PSGVALLEG YC+K +++K  D+  + Q  +CF+I+YKK+GQR YDLR ++E ECN WVE IR AS+SR  E  E+LEQKHLHLLQI+ESERQ+KW+YV+Q E+++ ++++L+ E+RELKE R E+ +  +   E+EEL+KIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAE MRKRN IVFGLVECEEEYVQQ+S++VSCFLRP +MAAS+KKPIITHEDVNS FLNAETLLFLHQIFLQGL SK+ENWPTLQLGDLFDMLLPML IYQEYVRNHHYSLQVLAEYKQKPEF  LLKRYEEKP CEGRSLE+FLTYPMHQIPRYI+TLHELLAHTPHDHVDR++LE+AKSKLE+LS++MHDEVSETENIRKNLAIER+IVEGC+ILLDVNQIFVRQGSL+Q++ ++K K+ R RLGSF  +      +KE VRQVFLFTNHL++TTRASNGRLHL KNYGK++L DCTL ED         +  P  Q N  + E      S+     NAQ      D+NG+DFR+++ TK+ PP++ITL+A+S+QEKAAWCSDI+QCIEQ+HYSDLLNS+LAETSSVSMP +I              +SDPKL+RDDVDI+FSR LNSCKVPQIRHA+++RL+DRLTDLRFLSIDFLNTFLLTYR+FT   T++ AL+RILNNPE GNL+ RPS S  +S ES+     NA+                                L +KPQL+K RRISTGMM++EV    + G
Sbjct:    1 MQKAIRVNDSQLLHLSLKAR-SGSANQAGWLHKRSLDTGKWQLRYFVLYQNLLFYYDSDKSEKPSGVALLEGSYCDKYLSLKQVDRTERQQYAHCFSIFYKKDGQRHYDLRAESEAECNTWVEAIRNASYSRLAEQHEQLEQKHLHLLQIMESERQSKWNYVKQAEDMSNQLRRLRLEVRELKELRKEQTSGKEPTEETEELKKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAEHMRKRNGIVFGLVECEEEYVQQISVLVSCFLRPCRMAASAKKPIITHEDVNSVFLNAETLLFLHQIFLQGLNSKMENWPTLQLGDLFDMLLPMLCIYQEYVRNHHYSLQVLAEYKQKPEFAALLKRYEEKPVCEGRSLETFLTYPMHQIPRYIVTLHELLAHTPHDHVDRQQLEFAKSKLEDLSHVMHDEVSETENIRKNLAIERLIVEGCEILLDVNQIFVRQGSLVQIMGSDKPKNSRVRLGSFSSTFSNKDSKKEAVRQVFLFTNHLILTTRASNGRLHLVKNYGKLSLADCTLSEDGSSDYYYVDDDDPNIQTNLLSIEPQQPKDSR-----NAQP-----DFNGLDFRLILHTKSGPPVTITLVANSVQEKAAWCSDINQCIEQIHYSDLLNSTLAETSSVSMPHTISSHGLVVCYNSKLLKSDPKLFRDDVDIKFSRTLNSCKVPQIRHATVDRLLDRLTDLRFLSIDFLNTFLLTYRIFTTPKTVITALKRILNNPESGNLDPRPSISIQSSTESD----QNAISGGGDGGGKTAGGGSGGGSGGGGGGGGGGGGFLHVKPQLDKARRISTGMMRLEVATEAAAG 812          

HSP 2 Score: 508.834 bits (1309), Expect = 6.889e-147
Identity = 288/466 (61.80%), Postives = 343/466 (73.61%), Query Frame = 1
Query: 4036 RSSVVSWSGTVNTRKHKRPSAISCPDHDLMISPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNXXXXXXXXXXXXGCIN-PAI-CNKATNRYYSTANPS------------------GDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSI 5373
            R SVVSWSG       KRPS  S          R S+   +  D SPP +AR GAVVTSSR SKRRSSNTAAA AFAAATAG  N P I  ++   R    +  +                  G I    + +KRLS+I TAATMRVLNVVRHW+ KF ED +SD  L+++M  LLE+LVCNQ+L P +HK A Q+L +L D+ L   K DL+ +LTP  +PS + FDTLSALDIAEQ+TY+DHQIFR+I+S+E L Q WMK D+ +KA HV LVS RFNE+S LV+SEIVSR D++DRVAC+EKWAAIADICRC+HNYNGVLQICAAFVNS+V+RLK+TWE++ K +R  IEKLQ LVSSDG+FKNMR ALH CDPPCIPYLGMYLTDLSFIEEG  NV+++ LINFCKMRMIAH IREIQQYQQTPYRIE +P+  DYLLD +R +++E  YQASLR+EPR SI
Sbjct: 1198 RGSVVSWSGI------KRPSYASESGDLPGQHSRSSIATRSDVD-SPPCRARAGAVVTSSRASKRRSSNTAAALAFAAATAGASNSPKISASERQGRATVASTSAAATAAAAAAAAAAAAANCGPISG-GILDKRLSIICTAATMRVLNVVRHWVYKFGEDIESDASLRSDMIDLLEELVCNQSLFPPDHKAALQILLRLRDNSLSEPKPDLEALLTPKSVPSAECFDTLSALDIAEQITYIDHQIFRAIQSTEFLMQAWMKRDRNDKATHVHLVSKRFNEVSSLVISEIVSRTDMSDRVACMEKWAAIADICRCLHNYNGVLQICAAFVNSAVFRLKKTWERLSKSTRQMIEKLQTLVSSDGKFKNMRSALHTCDPPCIPYLGMYLTDLSFIEEGTSNVTDDGLINFCKMRMIAHVIREIQQYQQTPYRIEYNPKACDYLLDPSRQMDDETAYQASLRLEPRVSI 1655          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. TrEMBL
Match: A0A267FAR5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001879g2 PE=4 SV=1)

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 544/793 (68.60%), Postives = 639/793 (80.58%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNN----QNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQA-LNESEELRKIKK---VQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGS--SKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKV--ERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIR---------SDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNNLLIKPQLEKTRRISTGMMKME 2442
            MQK IR+N++QL  L+ KAR+ G +TLSG LYK+S DTGKWQ RYFVLY+NLLFYYD ++ DRPSGVALLEG YC+K   +K  ++ +    Q   + F I+YKK+GQR YDLR +T+ +C  WVE I+ +S+SR Q +KEELEQK+LHLLQI+ESER +KWHYV+QTEEL AEV +L+ E+RELKE + +    S+    E+EELRKIKK   VQSFFRGWLCRRRWK IVEEYIRSEHAE MRKRNNIVFGLVECEEEYVQQ++I+VSCFLRP +MAAS+KKPIITHEDVNS FLNAETLLFLHQIFLQGL SK++NWPTLQLGDLFDMLLPML IYQEYVRNHHYSLQVLAEYKQK EF  LLKRYEEK  CEGRS+E+FLTYPMHQIPRYI+TLHELLAHTPHDHVDR++LE+AKSKLE+LS+ MHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQG L Q+ I EK ++ R R+GSF  +     RKE VRQVFLFTNHL++TTRASNGRLHL KNYGKI+L DCTL ED   + F  E D+              LT+E  Q+   +R  DY+G+DFR++++ K+ PP++ITL+A+S QEKAAWCSDI+QCIEQ+HYSDLLNSSLAETS VSMP +IR         SDPKL+RDDVDI+FSR LNSCKVPQIRHA++ERL+DRLTDLRFLSIDFLNTFLLTYRVFT   T+++AL+RIL NPE GNL+ RPS    +SLESE   +             L +KP+L+K RRISTGMM++E
Sbjct:    1 MQKAIRVNDSQLLLLSGKAREPGCATLSGNLYKRSLDTGKWQLRYFVLYQNLLFYYDSDRCDRPSGVALLEGSYCDKQTALKLPERGDAARQQQWTHAFNIFYKKDGQRHYDLRAETDADCTAWVEAIKNSSYSRLQGIKEELEQKNLHLLQIMESERLSKWHYVKQTEELMAEVAQLRKEVRELKELQHKETALSRTNSEETEELRKIKKISQVQSFFRGWLCRRRWKNIVEEYIRSEHAEHMRKRNNIVFGLVECEEEYVQQITILVSCFLRPCRMAASAKKPIITHEDVNSIFLNAETLLFLHQIFLQGLNSKMDNWPTLQLGDLFDMLLPMLSIYQEYVRNHHYSLQVLAEYKQKAEFTGLLKRYEEKSLCEGRSMETFLTYPMHQIPRYIVTLHELLAHTPHDHVDRQQLEFAKSKLEDLSHAMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGCLTQLPIGEKGRNTRPRIGSFSSTFNKDSRKEAVRQVFLFTNHLILTTRASNGRLHLVKNYGKISLADCTLAEDPSSDFFYYEDDDQT-------APLNQLTVEAGQQRLEQRAADYSGLDFRLIVDFKSGPPVTITLVANSAQEKAAWCSDINQCIEQIHYSDLLNSSLAETSLVSMPHTIRHRKTFGRVKSDPKLFRDDVDIKFSRTLNSCKVPQIRHATVERLLDRLTDLRFLSIDFLNTFLLTYRVFTEPKTVISALKRILTNPEYGNLDPRPSICLQSSLESE---TGGGGGGGGGGGGFLHVKPELDKLRRISTGMMRLE 783          

HSP 2 Score: 477.248 bits (1227), Expect = 1.675e-136
Identity = 279/479 (58.25%), Postives = 338/479 (70.56%), Query Frame = 1
Query: 3991 HRQSSPKLIEAPNRTRSSVVSWSGTVNTRKHKRPSAISCPDHDLMI----SPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNXXXXXXXXXXX-------XGCINPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPH-VLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSISRQGQP 5391
            H  SSP + ++P   R SV S SG    R      A      DL      S RPS+   +  D SPP +A+ GAVVTSSR SKRRSSNTAAA AFAAAT          +  A+  + +             ++ S+  KRLS+I TAATMRVLNVVRHW+ KF ED +SDP L+ +M  LLEDLVCNQNL P +HK A Q+L +L ++ L     DL+ ILTP   PS +SF+TLSALDIAEQ+T +DH++FR+++S+EL+ Q WMK +  ++A   VL +S RFN  S LVVSEI+S  DI+ RVACIEKWAAIADICRC+HNYNGVLQICAA VNSSV+RLK+TWE++ K +R  I++LQ LVSSDGRFKNMR ALH CDPPCIPYLGMYLTDLSFIEEG  NV+E  LINFCKMRMIAH IREIQQ+QQTPYRIE + RV DYLLD +RL+E+E+ Y ASL +EPR SI  +  P
Sbjct: 1084 HSASSPTVNQSP--FRGSVASGSGGPMKRT---SCAADSTAGDLSAGAPSSGRPSLARSSDVD-SPPCRAKAGAVVTSSRASKRRSSNTAAALAFAAATAGASTLPKSSVRIAVQEQESEVQMPQLMQHRPSESSSIMVKRLSIICTAATMRVLNVVRHWVYKFGEDIESDPTLRADMIDLLEDLVCNQNLFPPDHKAALQILLKLREEPLAEADNDLERILTPAWQPSFESFETLSALDIAEQITLIDHKLFRALKSAELITQAWMKKNPEDRASSTVLQISKRFNATSCLVVSEIISCSDIDRRVACIEKWAAIADICRCLHNYNGVLQICAALVNSSVFRLKKTWERLSKSTRQMIDRLQLLVSSDGRFKNMRSALHNCDPPCIPYLGMYLTDLSFIEEGTSNVTEEGLINFCKMRMIAHIIREIQQFQQTPYRIEHNQRVCDYLLDTSRLIEDERAYAASLLLEPRVSICPESSP 1556          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. TrEMBL
Match: R7TQP0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_169570 PE=4 SV=1)

HSP 1 Score: 1028.47 bits (2658), Expect = 0.000e+0
Identity = 517/744 (69.49%), Postives = 615/744 (82.66%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNV----KSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXX-----XXXXXXNSSQALN--ESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVINEKSKSPRARLG-SFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLES 2325
            MQK IR+NE+QL +LA KARQD  S L G+L+KKS+DTGKWQQR+FVLY+NLLFY++ +   RPSGVALLEGCYCE++V       +    ++ Q YCFA+YY+KEG RQYDLR +TE ECN W+ TI+QASFS+  E KE+LEQKHLHLLQILE+ERQAKWHYVQQTEELAAEVKKLK+E           ++ ER NS+  ++  ESEEL+KIKKVQSFFRGWLCRRRWKQIVEEYIRS+HAESMRKRN+I+FG+VECEEEYV+QLS +VS FLRP +MAASSKKP ITHEDVNS FLN+ETLLFLHQIFL+GL +++ENWPTL LGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFN L++RYEEK  CEGRSLE+FLTYPMHQIPRYIIT+HELLAHTPHDHV+R+ LEYA+SKLEELS IM DEVSETENIRKNLAIERMIVEGCDILLDVNQ FVRQG+L+QVIN+K KS R RLG       + +K+ +RQVFLFTNH+L+TTR SNGRLHL K+YGK+ L+DCTL+ED+  ++F  E DN    +T                     +YNG+DFR++I+TK+ PPI+I LLAS++QEKAAWCSDISQCIE LHY+DLL+SS+++TSSV+MPQS+RSDPKL+RDD+DI+FSR LNSC+VPQIRHAS +RL+DRLTDLRFLSIDFLNTFLLTYRVFT G T++ AL+R+  NP+   +  +P  +   S E+
Sbjct:    1 MQKGIRLNESQLLYLAGKARQD--SLLRGYLHKKSADTGKWQQRFFVLYQNLLFYFESDGCVRPSGVALLEGCYCERLVTATPTSAAKSTKDEKQQYCFAVYYRKEGHRQYDLRAETEAECNQWINTIKQASFSKVLEQKEQLEQKHLHLLQILEAERQAKWHYVQQTEELAAEVKKLKNENSHCGRFFQLWNKRERSNSNDQIDAEESEELKKIKKVQSFFRGWLCRRRWKQIVEEYIRSDHAESMRKRNSIIFGMVECEEEYVKQLSALVSVFLRPLRMAASSKKPPITHEDVNSIFLNSETLLFLHQIFLKGLSARMENWPTLVLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNSLVRRYEEKSVCEGRSLETFLTYPMHQIPRYIITIHELLAHTPHDHVERKSLEYAQSKLEELSQIMQDEVSETENIRKNLAIERMIVEGCDILLDVNQTFVRQGTLVQVINDKPKSGRGRLGSFSSSFKESKKDSIRQVFLFTNHVLLTTRTSNGRLHLVKHYGKLPLIDCTLVEDSSSDIFHFE-DNSEKKDT---------------------NYNGLDFRLIIDTKSGPPITIILLASTLQEKAAWCSDISQCIENLHYTDLLHSSMSDTSSVTMPQSVRSDPKLFRDDIDIKFSRTLNSCRVPQIRHASTDRLLDRLTDLRFLSIDFLNTFLLTYRVFTTGQTVLEALKRVYRNPDLL-IPPKPKLAPIASCET 719          

HSP 2 Score: 506.523 bits (1303), Expect = 3.756e-148
Identity = 281/459 (61.22%), Postives = 343/459 (74.73%), Query Frame = 1
Query: 4000 SSPKLIEAPNRTRSSVVSWSGTVNTRKHKRPSAIS-CPDHDLMISPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNXXXXXXXXXXXXGCINPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLK-KIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQS 5370
            SSP +I    + R+      G +++   KR SA S         SPR S       + SPP  A+ G VVTSSR SKRRSS+TAA  AFAAATAG  NP    K           +G++K  +++ KR SVI TAATMRVLNV+RHW+SK  +DF+S+PELK  +K LLE++ CN +L+P EH+ A  +L  L  ++  +K K+DL  +L P  +PSRD+FDTLSALD+AEQLTYLDHQIF +IRS ELL Q WMK DK++KA  VLLVS RFNE+SRLVVSEIV+R + +DRVACIEKWAAIADICRC+HNYNGVLQICAAFVNSSVYRLK+TWEK+ KQ++  IEKLQ LVSSD RFKNMR+ALHRCDPPCIPYLGMYL+DLSFIEEG  N+++  L+NF KMRMIAH IRE+Q YQQTPY+I+   +VT YLLD +RLL+EE+TY+ASL IEPRQ+
Sbjct:  945 SSPNIISNLTKART------GQLDSYLGKRGSAESEAAASTSNFSPRGS---FAASEGSPP-AAKAGTVVTSSRASKRRSSSTAATAAFAAATAGSTNPKDHPKGIR--------AGELKPYNVNKKRESVISTAATMRVLNVLRHWVSKHSQDFESNPELKVGVKALLEEMSCNSSLLPAEHRAASSILHVLTKEEETVKNKVDLQALLLPPTLPSRDTFDTLSALDVAEQLTYLDHQIFMAIRSEELLGQAWMKPDKSQKATQVLLVSKRFNEVSRLVVSEIVTRQNCSDRVACIEKWAAIADICRCLHNYNGVLQICAAFVNSSVYRLKKTWEKISKQTKQMIEKLQTLVSSDCRFKNMRDALHRCDPPCIPYLGMYLSDLSFIEEGTPNITDETLVNFSKMRMIAHVIREVQHYQQTPYKIDHQNKVTTYLLDTSRLLDEEETYKASLEIEPRQA 1385          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. TrEMBL
Match: A0A1S3IZJ0 (ras-specific guanine nucleotide-releasing factor 1 OS=Lingula unguis OX=7574 GN=LOC106168494 PE=4 SV=1)

HSP 1 Score: 1014.99 bits (2623), Expect = 0.000e+0
Identity = 527/814 (64.74%), Postives = 638/814 (78.38%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALN---ESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVINEKSKSPRARLG-SFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVER--IIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIR--------SDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESE----------------GVFSNNAV------VSQRAETNNL--LIKPQLEKTRRISTGMMKMEVTGTE 2457
            MQK IR+NENQL +LA KAR +  +++SG+L KKS ++ KWQ R+F LY+NLLFYY+ + + RPSG+A LEGCYCE+++    N    + Q Y FAI + KEGQRQYDL  ++EVECN W++ I+ ASFSR  E KE+LEQKHLHLLQIL+SER+A+W YVQQTEEL  EVKKLK+ELRE K  + +  +   A +   ES+E++KIKKVQSFFRGWLCRRRWKQIVEEYIRS HAE MRKRN+IVFG+VE EEEYV+QLS +VSCFLRP KMAASSKKP ITHEDVNS FLN+ET+LFLHQIF++GL +++ENWPTL LGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQK EF+ LLKRYEEKP CEGRSLE+FLTYPMHQIPRYI+TLH+LLAHTPHDHV+R+ LEYAK KLEELS +MHDEVSETENIRKNLAIERMI+EGCDILLDVNQ FVRQG L+QV+ EK K  R RLG       + +KE VRQVFLFTNHLLIT+RASNGRLHLAKNYGKI L+DCTL+ED+  ++F  + +  +         S  L+  N    ++   IDY G+DF+I++++K+ PP++ITL+ASS+Q+KAAWCSDISQCIE LHYSDLLNSS+++TSSV+MPQS+R        SDPKL+RDD+DI+FSR LNSCKVPQIRHAS+++L++RLTDLRFLSIDF+NTFLLTYRVFTNG  ++ AL+++  NPECG +E   S  +  SL+++                 VF  N         S R  T +    I+PQ EK RRISTG MK+EVTG E
Sbjct:    1 MQKAIRVNENQLLYLANKARIE--NSISGYLNKKSGESAKWQLRWFSLYQNLLFYYENDSTTRPSGIAFLEGCYCERILT--PNSVKGEKQLYSFAINFTKEGQRQYDLAAESEVECNAWIDAIKMASFSRVIEQKEQLEQKHLHLLQILDSERKARWQYVQQTEELTEEVKKLKTELREFKTGKKDPNHVKAATSTEEESDEIKKIKKVQSFFRGWLCRRRWKQIVEEYIRSPHAEMMRKRNSIVFGMVEGEEEYVKQLSTLVSCFLRPMKMAASSKKPPITHEDVNSIFLNSETVLFLHQIFMKGLCARMENWPTLVLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKLEFSTLLKRYEEKPPCEGRSLETFLTYPMHQIPRYIVTLHDLLAHTPHDHVERKSLEYAKGKLEELSRVMHDEVSETENIRKNLAIERMIIEGCDILLDVNQTFVRQGCLLQVMTEKVKPNRGRLGSFSSSFKESKKETVRQVFLFTNHLLITSRASNGRLHLAKNYGKIPLIDCTLVEDSNSDIFFFDDEASSMESLNNLPGSNTLSTPNESYSDKKLSIDYKGLDFKIIVDSKSGPPMTITLVASSLQDKAAWCSDISQCIENLHYSDLLNSSMSDTSSVTMPQSVRYIHSTQIWSDPKLFRDDIDIKFSRTLNSCKVPQIRHASVDKLLERLTDLRFLSIDFVNTFLLTYRVFTNGDAVLEALKKVYKNPECGGIEG--SGMAPASLQAQRRHIKIREADSWSMDSDVFQPNPADTPPVSTSSRNSTPDAKQFIRPQPEKPRRISTGSMKIEVTGAE 808          

HSP 2 Score: 517.694 bits (1332), Expect = 9.112e-151
Identity = 245/363 (67.49%), Postives = 297/363 (81.82%), Query Frame = 1
Query: 4285 INPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLV-LKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQS 5370
            ++PA   +  NRY+S    +GD+K  +++ KR SVI TAATMRVLNV+RHW+SK  +DF++DP+LK E+K LLE++VCN NL+P EHK A  +LR +  ++     ++DL  +L+P   PS+D+FDTLSALDIAEQLTYLDH IF +IRS ELL Q WMK DKAEKAPHVL+VS RFNE+SRLVVSEIV R +  +R+ACIEKWAAIADICRC+HNYNGVLQICAAFVNSSVYRLK+TW+K+ KQ++  IEKLQ LVSSDGRFKNMR+ALHRCDPPCIPYLGMYLTDLSFIEEG  NV+E  L+NF KMRM+AH IREIQ +QQT Y+I+   +VT YLLD TRLL+EE+TY+ASL IEPR S
Sbjct: 1183 MSPAHPTRRMNRYHSFTG-AGDLKPYNVNKKRESVISTAATMRVLNVLRHWVSKHSQDFETDPKLKAEVKDLLEEMVCNTNLLPAEHKAAASILRTMAKEESANTYRVDLVAVLSPPLKPSKDTFDTLSALDIAEQLTYLDHHIFMAIRSEELLCQAWMKPDKAEKAPHVLMVSKRFNEVSRLVVSEIVRRPNFQERIACIEKWAAIADICRCLHNYNGVLQICAAFVNSSVYRLKKTWDKLSKQTKQMIEKLQQLVSSDGRFKNMRDALHRCDPPCIPYLGMYLTDLSFIEEGTPNVTEEGLVNFSKMRMVAHVIREIQVFQQTSYKIDLQTKVTAYLLDPTRLLDEEETYKASLEIEPRTS 1544          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Cavefish
Match: rasgrf2b (Ras protein specific guanine nucleotide releasing factor 2 [Source:NCBI gene;Acc:103038226])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 395/735 (53.74%), Postives = 524/735 (71.29%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMV--NVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEE--LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSL 2319
            MQK++R NE    +L+  AR++G  T  GFL KK+++  +W  +YF LY+N+LFY+D E+S RPSG+ LLEGC CE++    V +  K   ++ + F I +  + Q+  +LRT+ E EC+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +++       Q   E E+  ++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE+        ++D+  +G+                       +  +DF+I++E  ++P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P   ++  R  + SF+ L
Sbjct:    1 MQKSVRYNEGHALYLSAVARKEG--TKRGFLSKKTTENSRWHDKYFALYQNVLFYFDTEQSARPSGIYLLEGCTCERVPAPKVSTGGKETLDKLHYFLIVFGHDAQKPLELRTEEEAECDEWVEVIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIALNKTKERM-RPYQVYQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPDAS----DEDSKTSGQV----------------------FGHLDFKIVVEPADTPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMDKLADIYKKP-FTSIPVRVQYHSFDRL 701          

HSP 2 Score: 370.163 bits (949), Expect = 1.757e-105
Identity = 170/326 (52.15%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K    +L  L  D     ++ ++ IL     P  + F++LSA++IAEQ+T LDH IFRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I+S  D+  R + IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW K+ KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT YLLD+  +++E+  Y  SL+IEPR
Sbjct:  948 IIRRAATNRVLNVLRHWVSKHSQDFELNTELKMGVMGLLEEVLRDPDLLPQERKATANILNALSQDDQEDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLLDHIIFRSIPYEEFLGQGWMKMDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKISKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQYLLDKALIMDEDTLYDLSLKIEPR 1273          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Cavefish
Match: rasgrf2b (Ras protein specific guanine nucleotide releasing factor 2 [Source:NCBI gene;Acc:103038226])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 395/735 (53.74%), Postives = 524/735 (71.29%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMV--NVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEE--LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSL 2319
            MQK++R NE    +L+  AR++G  T  GFL KK+++  +W  +YF LY+N+LFY+D E+S RPSG+ LLEGC CE++    V +  K   ++ + F I +  + Q+  +LRT+ E EC+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +++       Q   E E+  ++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE+        ++D+  +G+                       +  +DF+I++E  ++P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P   ++  R  + SF+ L
Sbjct:    1 MQKSVRYNEGHALYLSAVARKEG--TKRGFLSKKTTENSRWHDKYFALYQNVLFYFDTEQSARPSGIYLLEGCTCERVPAPKVSTGGKETLDKLHYFLIVFGHDAQKPLELRTEEEAECDEWVEVIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIALNKTKERM-RPYQVYQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPDAS----DEDSKTSGQV----------------------FGHLDFKIVVEPADTPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMDKLADIYKKP-FTSIPVRVQYHSFDRL 701          

HSP 2 Score: 369.777 bits (948), Expect = 1.225e-105
Identity = 170/326 (52.15%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K    +L  L  D     ++ ++ IL     P  + F++LSA++IAEQ+T LDH IFRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I+S  D+  R + IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW K+ KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT YLLD+  +++E+  Y  SL+IEPR
Sbjct:  906 IIRRAATNRVLNVLRHWVSKHSQDFELNTELKMGVMGLLEEVLRDPDLLPQERKATANILNALSQDDQEDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLLDHIIFRSIPYEEFLGQGWMKMDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKISKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQYLLDKALIMDEDTLYDLSLKIEPR 1231          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Cavefish
Match: rasgrf2b (Ras protein specific guanine nucleotide releasing factor 2 [Source:NCBI gene;Acc:103038226])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 391/718 (54.46%), Postives = 516/718 (71.87%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMV--NVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEE--LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE    +L+  AR++G  T  GFL KK+++  +W  +YF LY+N+LFY+D E+S RPSG+ LLEGC CE++    V +  K   ++ + F I +  + Q+  +LRT+ E EC+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LK+E+  L +++       Q   E E+  ++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L++CTLIE+        ++D+  +G+                       +  +DF+I++E  ++P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P
Sbjct:    1 MQKSVRYNEGHALYLSAVARKEG--TKRGFLSKKTTENSRWHDKYFALYQNVLFYFDTEQSARPSGIYLLEGCTCERVPAPKVSTGGKETLDKLHYFLIVFGHDAQKPLELRTEEEAECDEWVEVIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIALNKTKERM-RPYQVYQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPDAS----DEDSKTSGQV----------------------FGHLDFKIVVEPADTPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMDKLADIYKKP 685          

HSP 2 Score: 370.163 bits (949), Expect = 1.142e-105
Identity = 170/326 (52.15%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  +  LLE+++ + +L+P E K    +L  L  D     ++ ++ IL     P  + F++LSA++IAEQ+T LDH IFRSI   E L Q WMK DK E+ P+++  S  FN++S LV S+I+S  D+  R + IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW K+ KQ++  ++KLQ  VSS+GRFKN+RE L  C+PP +PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE  P+VT YLLD+  +++E+  Y  SL+IEPR
Sbjct:  917 IIRRAATNRVLNVLRHWVSKHSQDFELNTELKMGVMGLLEEVLRDPDLLPQERKATANILNALSQDDQEDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLLDHIIFRSIPYEEFLGQGWMKMDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKISKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQPKVTQYLLDKALIMDEDTLYDLSLKIEPR 1242          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Cavefish
Match: si:ch211-234p18.3 (Ras protein specific guanine nucleotide releasing factor 1 [Source:NCBI gene;Acc:103044871])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 395/718 (55.01%), Postives = 513/718 (71.45%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSN--DKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXX-XXXXXXXXXXNSSQALNESE-ELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  + +L   A++DG  T  G L KKSSD  KW  ++F L +N+LFY++ E S RPSG+ LLEGC C++  + K +   K    + Y F + +  E Q+  +LRT+   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+   E+++LKSE+   LK++   + N + A +E + E++KIKKVQSF RGW+CRR+WK I+++YIRS HAESMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  LEYAKSKLEELS IMHDEVSETENIRKNLAIERMIVEGC+ILLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G ++L+DCTLIED      P   D+ +  +   G   +HL                 DF+I++E K+S   ++ L+ASS QEK+AW SDISQCI+ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT    +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVTYLGLLAKKDG--TRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSSRPSGLYLLEGCVCDRSPSPKPSLSAKECLEKQYYFTVSFNHENQKALELRTEDVKDCDEWVAAITHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAGLLKDNEKIQTNPTAAPSEDDSEIKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLEYAKSKLEELSRIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVVSLIDCTLIED------PESTDDESKSDKS-GQDMEHL-----------------DFKIVVEPKDSQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTADVVLDKLIAIYKRP 687          

HSP 2 Score: 366.311 bits (939), Expect = 2.445e-104
Identity = 170/326 (52.15%), Postives = 233/326 (71.47%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+++ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I L+ +L        + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK DK EK P+++  +  FN++S L+ SEI+   D+N RVA +EKW A+ADICRC+HNYN VL+I ++   SS++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+  P+   YLLD + +L+EE  Y+ASLRIEP+
Sbjct:  928 VIRRAATNRVLNVLRHWVSKHSQDFETNVELKMKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEVLQMAESGKAEPFENHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMKTTKHFNDISNLIASEILRCDDVNTRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDHQPKAAQYLLDSSNVLDEESMYEASLRIEPK 1253          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Cavefish
Match: si:ch211-234p18.3 (Ras protein specific guanine nucleotide releasing factor 1 [Source:NCBI gene;Acc:103044871])

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 387/718 (53.90%), Postives = 500/718 (69.64%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSN--DKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXX-XXXXXXXXXXNSSQALNESE-ELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  + +L   A++DG  T  G L KKSSD  KW  ++F L +N+LFY++ E S RPSG+ LLEGC C++  + K +   K    + Y F + +  E Q+  +LRT+   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+   E+++LKSE+   LK++   + N + A +E + E++KIKKVQSF RGW+CRR+WK I+++YIRS HAESMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  LEYAKSKLEELS IMHDEVSETENIRKNLAIERMIVEGC+ILLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G ++L+DCTLIED +            + E   G   +HL                 DF+I++E K+S   ++ L+ASS QEK+AW SDISQ ++ +            + + S     RSD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT    +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVTYLGLLAKKDG--TRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSSRPSGLYLLEGCVCDRSPSPKPSLSAKECLEKQYYFTVSFNHENQKALELRTEDVKDCDEWVAAITHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAGLLKDNEKIQTNPTAAPSEDDSEIKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLEYAKSKLEELSRIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVVSLIDCTLIEDPE----------STDDEYKSGQDMEHL-----------------DFKIVVEPKDSQSFTVILVASSRQEKSAWTSDISQVVDNVQ-------CCITSDNPSFCFMFRSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTADVVLDKLIAIYKRP 677          

HSP 2 Score: 367.851 bits (943), Expect = 3.247e-105
Identity = 171/326 (52.45%), Postives = 235/326 (72.09%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+++ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I L+ +L        + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK DK EK P+++  +  FN++S L+ SEI+   D+N RVA +EKW A+ADICRC+HNYN VL+I ++   SS++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+  P+V+ YLLD + +L+EE  Y+ASLRIEP+
Sbjct:  861 VIRRAATNRVLNVLRHWVSKHSQDFETNVELKMKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEVLQMAESGKAEPFENHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMKTTKHFNDISNLIASEILRCDDVNTRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDHQPKVSQYLLDSSNVLDEESMYEASLRIEPK 1186          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Sea Lamprey
Match: si:ch211-234p18.3 (Ras protein specific guanine nucleotide releasing factor 1 [Source:HGNC Symbol;Acc:HGNC:9875])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 298/498 (59.84%), Postives = 373/498 (74.90%), Query Frame = 1
Query:  730 LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMH-QIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVF 2217
            +RKIKKVQSF RGWLCRR+WK IV++YIRS  AES RKRN +VF ++E E EYV QL ++V+ FLRP +MAASSK+P I H+DV++ FLN+ET++FLHQIF QGL+++I +WPT+ L DLFDMLLPML IYQE+VRNH +SLQVLA  KQ  EF++LLK+YE +  CE R+LE+FLT+PM+ QIPRYI+TLHELLAHTP +HV+R  LE+AKSKLEELS I+HDEVSETENIRKNLAIERMIVEGC ILLD +Q FVRQGSL+QV   EK +  R RLGS       +KE  RQ FLFT HL+I TRAS G+LHL KN G + L++CTL+ED +        D+ A       TSS    +++            ++FR+ IE  ++PP  I L+A+S Q+KAAW SDISQCI+ L  + L+ +   + S +S+PQ +RSD  LY D  DI+FSR L+SCKVP IR AS+ RL++RLTD RFLSIDFLNTFL +YRVF
Sbjct:   27 IRKIKKVQSFLRGWLCRRKWKAIVQDYIRSPQAESRRKRNQLVFSMLEAEGEYVAQLRVLVTGFLRPLRMAASSKRPPICHDDVSAVFLNSETIMFLHQIFHQGLKARIASWPTIVLADLFDMLLPMLNIYQEFVRNHQFSLQVLANCKQNREFDKLLKQYESRAECEERTLETFLTFPMYQQIPRYIVTLHELLAHTPQEHVERRSLEFAKSKLEELSRIIHDEVSETENIRKNLAIERMIVEGCGILLDTSQTFVRQGSLLQVSTAEKGRMSRGRLGSL----TSKKEGERQCFLFTKHLIICTRASGGKLHLNKNGGVLPLLNCTLLEDLE------PADDEAP------TSSARSAVQD------------LEFRLAIEAGDTPP-CIVLVAASRQQKAAWTSDISQCIDNLRCNGLMMNVFEDNSKISVPQMVRSDRSLYCDGADIRFSRTLDSCKVPVIRAASVSRLLERLTDPRFLSIDFLNTFLYSYRVF 495          

HSP 2 Score: 59.6918 bits (143), Expect = 6.249e-9
Identity = 29/61 (47.54%), Postives = 41/61 (67.21%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLR 4569
            +I  A T RVLNV+RHW+SK  +DF+SD +LK+ +  LLE++  +  LI  E K A  +LR
Sbjct:  759 IIRRAVTNRVLNVLRHWVSKHSQDFESDSDLKSAVVRLLEEISRDTELIGQERKAAANILR 819          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Sea Lamprey
Match: rasgrf2b (Ras protein-specific guanine nucleotide-releasing factor 2b [Source:NCBI gene;Acc:553520])

HSP 1 Score: 487.263 bits (1253), Expect = 8.410e-157
Identity = 232/338 (68.64%), Postives = 280/338 (82.84%), Query Frame = 1
Query:  715 NESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQ 1725
            +E  +++KIKKVQSF RGWLCRR+WK IV++YIRS HAESMRKRN IVF ++E E EYV QL  +V+ FLRP +MAASSKKP I H+DV+S FLN+ET++FLHQIFLQGL++++ +WPTL L DLFD+LLPML IYQE+VRNHHYSLQVLA  KQ  +F++LLK+YE K  CEGR+LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVSETENIRK+LAIERMIVEGCDILLD +Q FVRQGSLIQV + E+ +  R RL S       +KE  RQ FLFT HLLI TR+S G+LHL K  G ++L++CTLIED +
Sbjct:   82 DEDPDIKKIKKVQSFLRGWLCRRKWKTIVQDYIRSPHAESMRKRNRIVFSMLEAETEYVTQLHTLVNIFLRPLRMAASSKKPTILHDDVSSIFLNSETIMFLHQIFLQGLKARLASWPTLVLADLFDILLPMLNIYQEFVRNHHYSLQVLANCKQNRDFDKLLKQYESKADCEGRTLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSETENIRKSLAIERMIVEGCDILLDSSQTFVRQGSLIQVPSVERGRISRGRLVSLTL----KKEGERQCFLFTKHLLICTRSSGGKLHLVKTGGVLSLIECTLIEDNE 415          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008557.1 (pep scaffold:Pmarinus_7.0:GL480921:622:11983:1 gene:ENSPMAG00000007749.1 transcript:ENSPMAT00000008557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 3.217e-26
Identity = 53/88 (60.23%), Postives = 68/88 (77.27%), Query Frame = 1
Query: 2005 ETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            ++S V++P  I+SD  LY DDVDI+FS+ LNSCKVP IR++S+E+L++RLTDLRFLSIDFLNTFL TYRVFT    ++  L  I   P
Sbjct:    7 DSSKVTVPPVIKSDTTLYLDDVDIRFSKTLNSCKVPHIRYSSVEKLLERLTDLRFLSIDFLNTFLHTYRVFTTAQAVLEKLMDIYRWP 94          

HSP 2 Score: 96.6709 bits (239), Expect = 1.106e-20
Identity = 55/140 (39.29%), Postives = 82/140 (58.57%), Query Frame = 1
Query: 4420 NVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLM-----DDQLVLKKIDL-DVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNEL 4821
             ++ H+ S   EDF+ D +LK  +   LED++ +  L+  E K A  +LR LM     D QL L+K+ L +  + P      + F+ LS L++AEQLT LD  +FRSI   E L++ WMK+DK E+AP ++  S  FNE+
Sbjct:  360 GIIAHYSSFTAEDFELDSKLKATVIGFLEDIMRDPELLLQERKAANNILRALMTEEADDGQLTLEKVSLTNEEMKP------EQFEYLSVLELAEQLTLLDFLVFRSIPYQEFLDRGWMKSDKNERAPKIMRTSKHFNEV 493          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Sea Lamprey
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 93.9745 bits (232), Expect = 1.952e-19
Identity = 66/217 (30.41%), Postives = 102/217 (47.00%), Query Frame = 1
Query: 4642 SRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALH--RCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQY---QQTPYRIERH 5277
            S+ S   LS L++A Q++  D QIFRSI  +E +   + +   A    H+       N  +  V SE++    +  RV  I+ +  IA  CR   N+N +  I +   +SSV RL+  W+K+P +       LQ+L          R  L      PP IP   +   DL+F+ +G  +  E  L+NF K+RMIA  +R + +     Q P  + RH
Sbjct:  660 SQISLLQLSTLEVATQISIRDFQIFRSIEPTEYVANLF-RLGGAAACEHLQAFEETLNRETFWVPSEVLRETGLLKRVKLIKHYLKIALNCRDSRNFNSMFAIISGLSHSSVMRLRSAWDKLPSKYEKLFSDLQDLFDPSRNMAKYRNLLSSPSLQPPIIPLFPVVKKDLTFLHDGNDSRVEG-LVNFEKLRMIAKEVRHVGRLASANQDPAVMFRH 874          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010890.1 (pep scaffold:Pmarinus_7.0:GL478025:43589:54725:1 gene:ENSPMAG00000009867.1 transcript:ENSPMAT00000010890.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 5.243e-18
Identity = 54/184 (29.35%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  832 SMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQ-LGDLFDMLLPMLGIYQEYVRNHHYSLQVL-------AEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYA 1359
            +MRK   ++ G++  EE Y+ QL  ++   L+P + AA++ +P++T+  +++ FL    +L +H+ F +GLR +++     Q +GDLF  L   L  Y+++V N+  ++++        A++ +  E  ++      K      SLE+ L  P+ ++ R  + LH+LL HTP  H D   LE A
Sbjct:   10 TMRKL--VLSGILASEETYLNQLEGLM-LPLKPLRAAATTSQPLLTNVQIDAIFLCLPEILAVHREFYEGLRPRVQQDDASQGVGDLFLKLANHLDYYKKFVDNYKTAVEMADKCSSADAQFAKISERLKVKSSSGSKEQASASSLEALLYKPVDKVMRSTLVLHDLLKHTPRSHDDYPALEEA 190          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Yeast
Match: CDC25 (Membrane bound guanine nucleotide exchange factor; also known as a GEF or GDP-release factor; indirectly regulates adenylate cyclase through activation of Ras1p and Ras2p by stimulating the exchange of GDP for GTP; required for progression through G1; thermosensitivity of the cdc25-5 mutant is functionally complemented by human RASGRF1 or by a fragment of human SOS1 comprising the CDC25-related catalytic domain [Source:SGD;Acc:S000004301])

HSP 1 Score: 117.857 bits (294), Expect = 1.042e-26
Identity = 78/256 (30.47%), Postives = 129/256 (50.39%), Query Frame = 1
Query: 4663 LSALDI-----AEQLTYLDHQIFRSIRSSELLNQTW-MKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHR-CDPPCIPYLGMYLTDLSFIEEGALNVSEN--KLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEE--------EKTYQASLRIEPRQSISR 5379
            L  LDI     A QLT L+H ++  I   E L++ W  K      +P++       N L+  V   IV + D+  R    + +  +A  C+ ++N++ +  I +A  +S +YRLK+TW+ V  +S+  ++ L NL+ S   F   RE L    D  C+P+ G+YL+DL+F   G  +   N   +INF K   IA+ + EI  +++  Y+++R       L D   ++E         EK YQ SL++EPR   ++
Sbjct: 1299 LKLLDIDPYTYATQLTVLEHDLYLRITMFECLDRAWGTKYCNMGGSPNITKFIANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIYRLKKTWDLVSTESKDLLKNLNNLMDSKRNFVKYRELLRSVTDVACVPFFGVYLSDLTFTFVGNPDFLHNSTNIINFSKRTKIANIVEEIISFKRFHYKLKR-------LDDIQTVIEASLENVPHIEKQYQLSLQVEPRSGNTK 1547          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Yeast
Match: LTE1 (Protein similar to GDP/GTP exchange factors; without detectable GEF activity; required for asymmetric localization of Bfa1p at daughter-directed spindle pole bodies and for mitotic exit at low temperatures [Source:SGD;Acc:S000000022])

HSP 1 Score: 77.7962 bits (190), Expect = 1.540e-14
Identity = 56/224 (25.00%), Postives = 111/224 (49.55%), Query Frame = 1
Query: 4633 HIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQ----------TWMKA-DKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDP--PCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIRE-IQQYQQTPY 5262
            H+P    +D+LS   +A+Q+T ++ +I   I   +LL+           +W++   + E    + L  +RFN     ++SEI+       +   I+++  +AD CR   N+N +++I  A  +S V +    W  +     +T E+L+ + S D  +  +R  L+  +P   C+P++ +YL+DLS   E    + E+K++N+ K       ++  IQ+ Q + +
Sbjct: 1186 HVPFILMYDSLS---VAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKF 1406          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Nematostella
Match: EDO41248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S505])

HSP 1 Score: 147.517 bits (371), Expect = 3.250e-38
Identity = 105/346 (30.35%), Postives = 181/346 (52.31%), Query Frame = 1
Query: 4411 RVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMD--DQLVLKKIDLDV-ILTPIHIPSRD-------------SFD--TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKAD-KAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSEN---KLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYL--LD----RTRLLEEEKTYQASLRIEPR 5364
            RVLN +RHW+     DF+ D +L  +++  LE+             V G+ +R+ ++  ++++ +K   D   + P     RD              FD  TL  ++IA QLT L+ +++R++R SEL+   W K D K   +P++L +    N+++      IV   ++ +RVA + +   I  + + ++N+NG+L++ +A  ++ ++RL+ T+ ++  +    +E+ + L SSD  +K   E L   +PPC+P+ GMYLT++   EEG  +   N    +INF K R +A    EIQQYQ  PY +     + +YL  LD    R     E+  Y++SL IEPR
Sbjct:    1 RVLNGIRHWVDNHFYDFERDAQLLKKLQVFLEE-------------VNGKAMRRWVESINKVIERKTSWDTGSMAPEITFERDPPQVEWHLAKDIEKFDILTLHPIEIARQLTLLESELYRAVRPSELVGSVWTKEDIKHLTSPNLLKMIHHTNKITVWFEKSIVEMSNLEERVAVLTRIIDILTVFQELNNFNGILEVVSALNSAPIFRLQHTFAELTGRRAQVLEEAKEL-SSD-HYKKYIEKLRSINPPCVPFFGMYLTNILKTEEGNPDFLPNCPEGIINFSKRRKVAEITGEIQQYQNQPYCLRVEDSIREYLENLDPFNGRDDKEMEDYLYRSSLEIEPR 331          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Nematostella
Match: EDO32740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU64])

HSP 1 Score: 137.117 bits (344), Expect = 4.516e-33
Identity = 80/244 (32.79%), Postives = 139/244 (56.97%), Query Frame = 1
Query: 4675 DIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYR-IERHPRVTDYL-----LDRTRLLEEEKTYQASLRIEPRQSISRQGQ 5388
            + A QLTY+D  +F+SI+  E  +  W K +K+ ++P+V+ ++ RFN +S  VV EI++   +  RVA +  +  IA     ++N + +  + A   ++ VYRL +TWE++ ++     EKL++L+S D   K +R+ L+    PCIP+LGMYLTDL +I+    N      ++  + R +   IR I ++QQ+ Y  +E  P +  YL     ++  +   E+  Y+ SL+IEP+ S+   G+
Sbjct:   67 NFARQLTYMDLAVFKSIQPEEFSSCGWTKKNKSVQSPNVVALTKRFNHVSFWVVREILNAKKLKTRVAVMSHFIRIAKRLYEMNNLHSLKAVIAGLQSAPVYRLNQTWEQLSRRDHTIFEKLEDLLSEDQNRKRLRDHLNSTRLPCIPHLGMYLTDLMYIDTIHPNTGG---LDNERTRKMNDIIRIIAEFQQSHYDCLETQPHIQKYLDSMNYIEELQKFLEDNNYRLSLQIEPK-SVKSSGE 306          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Nematostella
Match: EDO49269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH05])

HSP 1 Score: 109.768 bits (273), Expect = 1.071e-23
Identity = 73/253 (28.85%), Postives = 122/253 (48.22%), Query Frame = 1
Query: 4675 DIAEQLTYLDHQIFRSIRSSELLNQTWMKADK---AEKAPHVLL--VSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQIC-AAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSD------------------GRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEP 5361
            ++A Q+T LDH+ F ++ S ++  +  M   +    +  P +L   V+ RFN+LS  VV+ I++   +  R      +   A  C  + N+N V+ I  AA  +SS+ RL RT + VPK+      K++ L+ +                     +K  R  L     P +PY G+Y+ DL+FI EG  +  +  L+N  K R +   I EI+Q+Q+  Y  +    V +YLL +  L+ E   +  S ++EP
Sbjct: 1988 ELARQITLLDHEFFCAVTSDDIQKKIAMGTGRRKNLDSQPRLLCERVADRFNQLSTWVVASILTEESVEKRAQMFINFIETAKQCLKLRNFNAVMAIVVAALGSSSIRRLARTKQLVPKEFLEQCAKIEMLMDTKVPALFGLVVGEYLVDVYANNYKKYRTTLRASPTPAVPYFGIYMKDLTFIAEGNPDFLKGGLVNISKRRQVYIVINEIRQFQKKSYHFQEVAEVREYLLSQ-ELVSEGDLHLVSCQLEP 2239          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Nematostella
Match: EDO39513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA05])

HSP 1 Score: 101.679 bits (252), Expect = 2.958e-22
Identity = 84/304 (27.63%), Postives = 138/304 (45.39%), Query Frame = 1
Query: 4492 KCLLEDLVCN-QNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDV-----ILTPIHIPSRDSFD-----TLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQS 5370
            +C+LE L+     L+ N     G++LR  M     L K D        I +P+   +  SF+        A  +AEQLT +D Q F +I   E+L   W K      +P++ + +  FN++S    S I+S     DR     K+  I    R  +N+N  L I +A   S+V RL   W   PK     + +   L+ S   F+  R AL    PPCIPYLG+ L D++F+  G  +   +  +NF K   + + +  +++++   Y  E +  +  +       L E+  ++ SL ++PR  
Sbjct:  143 RCILEQLMKEVYRLLCNGDLYVGKILRGKM-----LPKCDNYYKRDRSISSPMPPQTPTSFNPAVIFNFHAHHLAEQLTLIDAQNFAAIEIPEIL--AWGKEQSEGNSPNLTVFTENFNKVSYWSRSYILSFEKPQDREKAYLKFLKIMKHLRRFNNFNSFLAILSAMDCSAVRRLD--W---PKHYLDQLAEYTELIDSSSSFRAYRAALAEAQPPCIPYLGLILQDVTFVCLGNADELADGKVNFVKRWQLFNILDTVRRFKLVQYEFEANEEIRQFFGGFNNYLNEDDLFEKSLILKPRSG 434          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Nematostella
Match: EDO26519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBT6])

HSP 1 Score: 87.8113 bits (216), Expect = 4.866e-21
Identity = 37/61 (60.66%), Postives = 48/61 (78.69%), Query Frame = 1
Query: 5104 PPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRV 5286
            PPC+PYLG YLTDL+FIE+G  + +E+ L+NF KMRMIA  I+EI+ YQQTPY I+   +V
Sbjct:    2 PPCVPYLGFYLTDLAFIEDGTPDCNEDGLVNFSKMRMIAQVIQEIRHYQQTPYAIQGDRKV 62          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Medaka
Match: rasgrf2b (Ras protein specific guanine nucleotide releasing factor 2 [Source:NCBI gene;Acc:101156500])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 390/717 (54.39%), Postives = 515/717 (71.83%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVK--SNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE     L+  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++ E+S RP+G+ LLEGC CE++   K  +  K    + + F I +  +GQ+  +LRTD E EC+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +       NE  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L+DCTLIE+        ++++ A G+                       +  +DF++++E  + P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P
Sbjct:    1 MQKSVRYNEGHALFLSAVARKEG--TKRGFLSKKTTENSRWHEKFFALYQNILFYFENEQSARPAGIYLLEGCTCERVPAPKMSTTGKEALEKQHYFLIVFGHDGQKPLELRTDEESECDEWVEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKSEIVALNKTKERMRPYHVYHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIDCTLIEEPDAN----DEESKAGGQV----------------------FGQLDFKLVVEPSDLPSFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMDKLADIYKKP 685          

HSP 2 Score: 365.925 bits (938), Expect = 2.195e-104
Identity = 168/326 (51.53%), Postives = 234/326 (71.78%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  + CLLE+++ + +L+P E K    +L  L  D+    ++ ++ IL        + F++LSA+++AEQ+T LDH +FRSI     L Q WMK DK ++ P+++  S  FN++S LV S+I+S  D+  R + IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE   +VT YLLD+T  ++E+  Y  SL+IEPR
Sbjct:  894 IIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMSVICLLEEVLRDPDLLPQERKATANILSALSQDEQEDAQLRIEDILQMADCLKAECFESLSAMELAEQITLLDHIVFRSIPYESFLGQGWMKVDKTDRTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQVKVTQYLLDKTLTMDEDTLYDLSLKIEPR 1219          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Medaka
Match: rasgrf2b (Ras protein specific guanine nucleotide releasing factor 2 [Source:NCBI gene;Acc:101156500])

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 390/717 (54.39%), Postives = 515/717 (71.83%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVK--SNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXN-SSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVIN-EKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK++R NE     L+  AR++G  T  GFL KK+++  +W +++F LY+N+LFY++ E+S RP+G+ LLEGC CE++   K  +  K    + + F I +  +GQ+  +LRTD E EC+ WVE I+QAS+S     +E L QK++HL+QI+E+E+ A      Q E+   E+++LKSE+  L +++   +       NE  +++KIKKVQSF RGWLCRR+WK IV++YI S HAESMRKRN IVF +VE E EYV QLSI+V+CFLRP +MAASSKKP I+H+DV+S FLN+ET++FLH+IF QGL+++I NWPTL L DLFD+LLPML IYQE+VRNH YSLQVLA  KQ  +F++LLK+YE   ACEGR LE+FLTYPM QIPRYIITLHELLAHTPH+HV+R+ LE+AKSKLEELS +MHDEVS+TENIRKNLAIERMIVEGCDILLD +Q FVRQGSLIQ+ + E+ K  + RLGS       +KE  RQ FLFT H LI TR+S G+LHL K  G ++L+DCTLIE+        ++++ A G+                       +  +DF++++E  + P  ++ LLA S QEKAAW SDISQCI+ +  + L+ S   E S V++P  I+SD +L++DDVDI FS+ LNSCKVPQIR+AS+ERL++RLTDLRFLSIDFLNTFL TYR+FT    +++ L  I   P
Sbjct:    1 MQKSVRYNEGHALFLSAVARKEG--TKRGFLSKKTTENSRWHEKFFALYQNILFYFENEQSARPAGIYLLEGCTCERVPAPKMSTTGKEALEKQHYFLIVFGHDGQKPLELRTDEESECDEWVEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKSEIVALNKTKERMRPYHVYHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL----KKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIDCTLIEEPDAN----DEESKAGGQV----------------------FGQLDFKLVVEPSDLPSFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVTVPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVMDKLADIYKKP 685          

HSP 2 Score: 368.237 bits (944), Expect = 6.986e-105
Identity = 169/326 (51.84%), Postives = 235/326 (72.09%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            +I  AAT RVLNV+RHW+SK  +DF+ + ELK  + CLLE+++ + +L+P E K    +L  L  D+    ++ ++ IL        + F++LSA+++AEQ+T LDH +FRSI   E L Q WMK DK ++ P+++  S  FN++S LV S+I+S  D+  R + IEKW A+ADICRC++NYNGVL+I +A   S++YRLK+TW KV KQ++  ++KLQ  VSS+GRFKN+RE L  C+PPC+PYLGMYLTDL+FIEEG  N +E  L+NF KMRMI+H IREI+Q+QQTPYRIE   +VT YLLD+T  ++E+  Y  SL+IEPR
Sbjct:  941 IIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMSVICLLEEVLRDPDLLPQERKATANILSALSQDEQEDAQLRIEDILQMADCLKAECFESLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKVDKTDRTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQVKVTQYLLDKTLTMDEDTLYDLSLKIEPR 1266          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Medaka
Match: RASGRF1 (ras-specific guanine nucleotide-releasing factor 1 [Source:NCBI gene;Acc:101154767])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 387/718 (53.90%), Postives = 515/718 (71.73%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSN--DKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQAL--NESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  + +LA  A++DG  T  G L KKSSD  KW  ++F L +N+LFY++ + S RPSG+ LLEGC C++  + K +   K    + Y F + +  + Q+  +LRT+   +C+ WV  I QAS+       E L QK+LHLLQI+E+E+       QQ E+   E+++LKSE+  L +  ++ +++ +     +  E++KIKKVQSF RGW+CRR+WK I+++YIRS HAESMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMIVEGC++LLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLFT HL+I TR S G+LH+ KN G ++L+DCTL+E+      P   D+ +   +G  T  +HL                 DF++++E K+  P ++ L+ASS QEK+AW SDISQCI+ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT+   +++ L  I   P
Sbjct:    1 MQKGIRLNDGHITYLALLAKKDG--TRRGCLSKKSSDNTKWHSKWFALLQNMLFYFENDSSSRPSGLYLLEGCACDRAPSPKPSLSAKECLEKQYYFTVTFNHDNQKALELRTEDVKDCDEWVAAITQASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAALLKDNIKIQSNPEVPPSEDDTEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIVEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFTKHLIICTRGSGGKLHITKN-GVVSLIDCTLMEE------PEGTDDESKERSGQDT--EHL-----------------DFKVMVEPKDVQPFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEENSKVTVPQMIKSDTSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTSAAVVLDKLITIYKKP 686          

HSP 2 Score: 353.599 bits (906), Expect = 4.029e-100
Identity = 170/333 (51.05%), Postives = 231/333 (69.37%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLM-----DDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQS 5370
            VI  AAT RVLNV+RHW+SK  +DF+ + ELK  +   LE+++ +  L+  E K A  ++R L      D Q  +++I        +     + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK DK E+ P+++  +  FN++S  + SEI+   D+N RVA IEKW A+ADICRC+HNYN VL+I ++   SS++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+   +V  YLLD + +L+EE  Y+ASLRIEP+ S
Sbjct:  923 VIRRAATNRVLNVLRHWVSKHSQDFELNSELKMRVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDSQATIEEI----TKMAMEESKTEPFENHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNERTPYIIKTTKHFNDISNRIASEILQWDDVNMRVAVIEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDSQTKVAKYLLDNSTVLDEESLYEASLRIEPKTS 1251          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Medaka
Match: RASGRF1 (ras-specific guanine nucleotide-releasing factor 1 [Source:NCBI gene;Acc:101154767])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 387/718 (53.90%), Postives = 515/718 (71.73%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSN--DKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQAL--NESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  + +LA  A++DG  T  G L KKSSD  KW  ++F L +N+LFY++ + S RPSG+ LLEGC C++  + K +   K    + Y F + +  + Q+  +LRT+   +C+ WV  I QAS+       E L QK+LHLLQI+E+E+       QQ E+   E+++LKSE+  L +  ++ +++ +     +  E++KIKKVQSF RGW+CRR+WK I+++YIRS HAESMRKRN +VF ++E E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+HV+R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMIVEGC++LLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLFT HL+I TR S G+LH+ KN G ++L+DCTL+E+      P   D+ +   +G  T  +HL                 DF++++E K+  P ++ L+ASS QEK+AW SDISQCI+ +  + L+ ++  E S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT+   +++ L  I   P
Sbjct:    1 MQKGIRLNDGHITYLALLAKKDG--TRRGCLSKKSSDNTKWHSKWFALLQNMLFYFENDSSSRPSGLYLLEGCACDRAPSPKPSLSAKECLEKQYYFTVTFNHDNQKALELRTEDVKDCDEWVAAITQASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAALLKDNIKIQSNPEVPPSEDDTEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIVEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFTKHLIICTRGSGGKLHITKN-GVVSLIDCTLMEE------PEGTDDESKERSGQDT--EHL-----------------DFKVMVEPKDVQPFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEENSKVTVPQMIKSDTSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTSAAVVLDKLITIYKKP 686          

HSP 2 Score: 352.829 bits (904), Expect = 3.069e-100
Identity = 175/360 (48.61%), Postives = 240/360 (66.67%), Query Frame = 1
Query: 4306 KATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLM-----DDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQS 5370
            K+ N  + T   +GD         +  VI  AAT RVLNV+RHW+SK  +DF+ + ELK  +   LE+++ +  L+  E K A  ++R L      D Q  +++I        +     + F+  SAL+IAEQLT LDH +F+ I   E   Q WMK DK E+ P+++  +  FN++S  + SEI+   D+N RVA IEKW A+ADICRC+HNYN VL+I ++   SS++RLK+TW KV KQ++  I+KLQ LVSS+GRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+   +V  YLLD + +L+EE  Y+ASLRIEP+ S
Sbjct:  850 KSKNSGFPTDQRNGD---------KEFVIRRAATNRVLNVLRHWVSKHSQDFELNSELKMRVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDSQATIEEI----TKMAMEESKTEPFENHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNERTPYIIKTTKHFNDISNRIASEILQWDDVNMRVAVIEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDSQTKVAKYLLDNSTVLDEESLYEASLRIEPKTS 1196          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Medaka
Match: si:ch211-234p18.3 (ras-specific guanine nucleotide-releasing factor 1 [Source:NCBI gene;Acc:101158694])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 383/720 (53.19%), Postives = 511/720 (70.97%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSN--DKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQA----LNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQV-INEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNP 2268
            MQK IR+N+  + +L   A++DG  T  G L KKSSD  KW  ++F L +N+LFY++ E S RPSG+ LLEGC C++  + K +   K    + Y F + +  E Q+  +LR++   +C+ WV  I  AS+       E L QK+LHLLQI+E+E+       QQ E+   E+++LKSE+  L +   +   S  A     ++  E++KIKKVQSF RGW+CRR+WK I+++YIRS HAESMRKRN +VF +++ E EYVQQL I+V+ FLRP +MAASSKKP ITH+DV+S FLN+ET++FLHQIF QGL+++I +WPTL L DLFD+LLPML IYQE+VRNH YSLQ+LA  KQ  +F++LLK+YE KP CE R+LE+FLTYPM QIPRYI+TLHELLAHTPH+H++R  L+YAKSKLEELS IMHDEVSETENIRKNLAIERMI+EGC++LLD +Q FVRQGSLIQV ++EK K  R RLGS       +KE  RQ FLF+ HL+I TR S G+LHL KN G ++L+DCTL+E+ +                  GT  +  + ++ Q +E +      DF+I++E K+S   ++ L+ASS QEK+AW SDISQCI+ +  + L+ ++  + S V++PQ I+SD  LY DDVDI+FS+ +NSCKV QIR+AS+ERL++RLTDLRFLSIDFLNTFL +YRVFT    +++ L  I   P
Sbjct:    1 MQKGIRLNDGHVTYLGLLAKKDG--TRRGCLSKKSSDNTKWHTKWFALLQNMLFYFENESSSRPSGLYLLEGCMCDRAPSPKPSLSAKECLEKQYYFTVSFTHENQKALELRSEDVKDCDEWVAAISHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAGLLKDNEKINASPAAAPNDDDDDSEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRKRNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHIERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSL----KKEGERQCFLFSKHLIICTRGSGGKLHLTKN-GVVSLIDCTLMEEPE------------------GTDDESKSDKSGQDMEHL------DFKIIVEPKDSQSFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEDNSKVTVPQMIKSDSSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTADVVLDKLITIYKKP 689          

HSP 2 Score: 362.844 bits (930), Expect = 4.214e-103
Identity = 170/326 (52.15%), Postives = 233/326 (71.47%), Query Frame = 1
Query: 4387 VIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPR 5364
            VI  AAT RVLNV+RHW+SK  +DF+S+ ELK ++   LE+++ +  L+  E K A  ++R L  +     +I  + +   +     + F++ SAL+IAEQLT LDH +F+ I   E   Q WMK DK EK P+++  +  FN++S L+ +EI+   D+  RV+ IEKW A+ADICRC+HNYN VL+I ++   SSV+RLK+TW KV KQ++  I+KLQ LVSSDGRFKN+REAL  CDPPC+PYLGMYLTDL+FIEEG  N +E+ L+NF KMRMI+H IREI+Q+QQT Y+I+  P+V  YLLD++  L+EE  Y+ASLRIEP+
Sbjct:  930 VIRRAATNRVLNVLRHWVSKHAQDFESNIELKTKVIVFLEEVMHDPELLTQERKAAANIIRTLTQEDHGDNQITTEDVTQLVGGSKAEPFESHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMRTTKHFNDISNLIATEILRCEDVVTRVSVIEKWVAVADICRCLHNYNAVLEITSSLNRSSVFRLKKTWLKVSKQTKALIDKLQKLVSSDGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDLQPKVAQYLLDKSSALDEESMYKASLRIEPK 1255          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Planmine SMEST
Match: SMESG000056262.1 (SMESG000056262.1)

HSP 1 Score: 3359.7 bits (8710), Expect = 0.000e+0
Identity = 1756/1758 (99.89%), Postives = 1757/1758 (99.94%), Query Frame = 1
Query:  130 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTXXXXXXXXXXXXXXXXXXXSERQAKWHYVQQTEELAAEVXXXXXXXXXXXXXXXXXXNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVINEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNNLLIKPQLEKTRRISTGMMKMEVTGTESDGTDERILHKLNTEISLHDSYDKRLISSAEAPDSVVISKSAPSSRRTGSLEYPNISARHAKFPIMKEEYNQ-SQSVQISVPNLSNLSQGIHENLYNSTVKEESEPSDSLTVNTENFANIKIESEKIEVTLSAEGNIPNENSKEFTESKFSDKLHDYIKFDSMSLAPGFGSCHTPSSSKMKLNLLAPPSSSSFTHADXXXXXXXXXXXXXXXXXXXXXXXXXAPIASCEILXXXXXXXXXXXXVTFRSILKPNEKETGFEEFSVIEQRQKMYNSQKXXXXXPDKIDKTITIESSSIVGKLSEHFKQISCPSYINSPPISKAHLQLYEGQETTPQSLYSAISLPSSPNKQLNKSGVNPIKYKVEPIVIPEANLLDHKCTGSSSTPSQSKNPMTPNRIISPANSPKLPVKGLSITPKRSVLTISSRTSSMPTPTQSNLIAVSPSSNNQFPGSSNLTITTSRSNTSFGDANKXXXXXXXXXXXXXTFQELLPSSTLHPLASAALNLSPSTTVIYHHRQSSPKLIEAPNRTRSSVVSWSGTVNTRKHKRPSAISCPDHDLMISPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNXXXXXXXXXXXXGCINPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSISRQGQPILQ 5400
            MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTQELKEELEQKHLHLLQILESERQAKWHYVQQTEELAAEVKKLKSELRELKESRLERKNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVINEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNNLLIKPQLEKTRRISTGMMKMEVTGTESDGTDERILHKLNTEISLHDSYDKRLISSAEAPDSVVISKSAPSSRRTGSLEYPNISARHAKFPIMKEEYNQ SQSVQISVPNLSNLSQGIHENLYNSTVKEESEPSDSLTVNTENFANIKIESEKIEVTLSAEGNIPNENSKEFTESKFSDKLHDYIKFDSMSLAPGFGSCHTPSSSKMKLNLLAPPSSSSFTHADLSLDSYSNWSSSTLSMNNNNNNNKLAPIASCEILSEDRSYSSDDDDVTFRSILKPNEKETGFEEFSVIEQRQKMYNSQKSSSSSPDKIDKT+TIESSSIVGKLSEHFKQISCPSYINSPPISKAHLQLYEGQETTPQSLYSAISLPSSPNKQLNKSGVNPIKYKVEPIVIPEANLLDHKCTGSSSTPSQSKNPMTPNRIISPANSPKLPVKGLSITPKRSVLTISSRTSSMPTPTQSNLIAVSPSSNNQFPGSSNLTITTSRSNTSFGDANKSRGPSVSESSPSPTFQELLPSSTLHPLASAALNLSPSTTVIYHHRQSSPKLIEAPNRTRSSVVSWSGTVNTRKHKRPSAISCPDHDLMISPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNTAAAQAFAAATAGCINPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSISRQGQPILQ
Sbjct:    1 MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYENLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQGYCFAIYYKKEGQRQYDLRTDTEVECNNWVETIRQASFSRTQELKEELEQKHLHLLQILESERQAKWHYVQQTEELAAEVKKLKSELRELKESRLERKNSSQALNESEELRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECEEEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQIFLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQKPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHDHVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLDVNQIFVRQGSLIQVINEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHLLITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGVGTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEKAAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQFSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGITLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNNLLIKPQLEKTRRISTGMMKMEVTGTESDGTDERILHKLNTEISLHDSYDKRLISSAEAPDSVVISKSAPSSRRTGSLEYPNISARHAKFPIMKEEYNQQSQSVQISVPNLSNLSQGIHENLYNSTVKEESEPSDSLTVNTENFANIKIESEKIEVTLSAEGNIPNENSKEFTESKFSDKLHDYIKFDSMSLAPGFGSCHTPSSSKMKLNLLAPPSSSSFTHADLSLDSYSNWSSSTLSMNNNNNNNKLAPIASCEILSEDRSYSSDDDDVTFRSILKPNEKETGFEEFSVIEQRQKMYNSQKSSSSSPDKIDKTMTIESSSIVGKLSEHFKQISCPSYINSPPISKAHLQLYEGQETTPQSLYSAISLPSSPNKQLNKSGVNPIKYKVEPIVIPEANLLDHKCTGSSSTPSQSKNPMTPNRIISPANSPKLPVKGLSITPKRSVLTISSRTSSMPTPTQSNLIAVSPSSNNQFPGSSNLTITTSRSNTSFGDANKSRGPSVSESSPSPTFQELLPSSTLHPLASAALNLSPSTTVIYHHRQSSPKLIEAPNRTRSSVVSWSGTVNTRKHKRPSAISCPDHDLMISPRPSVQLMTTGDTSPPIKARVGAVVTSSRCSKRRSSNTAAAQAFAAATAGCINPAICNKATNRYYSTANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPELKNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTPIHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSISRQGQPILQ 1758          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Planmine SMEST
Match: SMESG000077783.1 (SMESG000077783.1)

HSP 1 Score: 114.39 bits (285), Expect = 4.874e-25
Identity = 69/240 (28.75%), Postives = 126/240 (52.50%), Query Frame = 1
Query: 4678 IAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGV---LQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINF---CKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLE------EEKTYQASLRIEP 5361
            IA Q+T+++   F++I++ E L+  W    K   AP ++  +  FN+L+      I+   D+N R   +     I  I + + +YN +   + + +A     ++RLK+TW  +  + + T  +++ L S +  ++ +RE ++    PCIPYLG+YLTDL++I     NV+ +KL  F    K   I + +R + ++QQ+ Y I ++  +  Y  D  R +E      EE  Y+ S+ +EP
Sbjct:  280 IAGQITFIELSYFKAIKAEEFLSFKWTGLSKHIHAPAIVASTRWFNQLNFWAQRIILECFDLNKRAEMLSYLIRI--IKKLVDHYNNLSSGMALMSALQVECIHRLKQTWNSLSGKDKTTFRRMEELFSGENNYEKLREHINFLKLPCIPYLGLYLTDLTYI-----NVAHSKLSEFESQTKTDQINNILRTVSEFQQSEYEILQNSTLFRY-FDNQRYIEELQKIIEENNYRTSVSLEP 511          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Planmine SMEST
Match: SMESG000077783.1 (SMESG000077783.1)

HSP 1 Score: 114.39 bits (285), Expect = 5.009e-25
Identity = 69/240 (28.75%), Postives = 126/240 (52.50%), Query Frame = 1
Query: 4678 IAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGV---LQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINF---CKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLE------EEKTYQASLRIEP 5361
            IA Q+T+++   F++I++ E L+  W    K   AP ++  +  FN+L+      I+   D+N R   +     I  I + + +YN +   + + +A     ++RLK+TW  +  + + T  +++ L S +  ++ +RE ++    PCIPYLG+YLTDL++I     NV+ +KL  F    K   I + +R + ++QQ+ Y I ++  +  Y  D  R +E      EE  Y+ S+ +EP
Sbjct:  273 IAGQITFIELSYFKAIKAEEFLSFKWTGLSKHIHAPAIVASTRWFNQLNFWAQRIILECFDLNKRAEMLSYLIRI--IKKLVDHYNNLSSGMALMSALQVECIHRLKQTWNSLSGKDKTTFRRMEELFSGENNYEKLREHINFLKLPCIPYLGLYLTDLTYI-----NVAHSKLSEFESQTKTDQINNILRTVSEFQQSEYEILQNSTLFRY-FDNQRYIEELQKIIEENNYRTSVSLEP 504          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Planmine SMEST
Match: SMESG000077783.1 (SMESG000077783.1)

HSP 1 Score: 114.39 bits (285), Expect = 5.598e-25
Identity = 69/240 (28.75%), Postives = 126/240 (52.50%), Query Frame = 1
Query: 4678 IAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGV---LQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINF---CKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLE------EEKTYQASLRIEP 5361
            IA Q+T+++   F++I++ E L+  W    K   AP ++  +  FN+L+      I+   D+N R   +     I  I + + +YN +   + + +A     ++RLK+TW  +  + + T  +++ L S +  ++ +RE ++    PCIPYLG+YLTDL++I     NV+ +KL  F    K   I + +R + ++QQ+ Y I ++  +  Y  D  R +E      EE  Y+ S+ +EP
Sbjct:  321 IAGQITFIELSYFKAIKAEEFLSFKWTGLSKHIHAPAIVASTRWFNQLNFWAQRIILECFDLNKRAEMLSYLIRI--IKKLVDHYNNLSSGMALMSALQVECIHRLKQTWNSLSGKDKTTFRRMEELFSGENNYEKLREHINFLKLPCIPYLGLYLTDLTYI-----NVAHSKLSEFESQTKTDQINNILRTVSEFQQSEYEILQNSTLFRY-FDNQRYIEELQKIIEENNYRTSVSLEP 552          
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Planmine SMEST
Match: SMESG000077783.1 (SMESG000077783.1)

HSP 1 Score: 114.005 bits (284), Expect = 5.976e-25
Identity = 69/240 (28.75%), Postives = 126/240 (52.50%), Query Frame = 1
Query: 4678 IAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEKAPHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHNYNGV---LQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNMREALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINF---CKMRMIAHTIREIQQYQQTPYRIERHPRVTDYLLDRTRLLE------EEKTYQASLRIEP 5361
            IA Q+T+++   F++I++ E L+  W    K   AP ++  +  FN+L+      I+   D+N R   +     I  I + + +YN +   + + +A     ++RLK+TW  +  + + T  +++ L S +  ++ +RE ++    PCIPYLG+YLTDL++I     NV+ +KL  F    K   I + +R + ++QQ+ Y I ++  +  Y  D  R +E      EE  Y+ S+ +EP
Sbjct:  328 IAGQITFIELSYFKAIKAEEFLSFKWTGLSKHIHAPAIVASTRWFNQLNFWAQRIILECFDLNKRAEMLSYLIRI--IKKLVDHYNNLSSGMALMSALQVECIHRLKQTWNSLSGKDKTTFRRMEELFSGENNYEKLREHINFLKLPCIPYLGLYLTDLTYI-----NVAHSKLSEFESQTKTDQINNILRTVSEFQQSEYEILQNSTLFRY-FDNQRYIEELQKIIEENNYRTSVSLEP 559          
The following BLAST results are available for this feature:
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASGRF11.251e-10253.80Ras protein specific guanine nucleotide releasing ... [more]
RASGRF26.925e-6253.18Ras protein specific guanine nucleotide releasing ... [more]
RASGRF22.620e-10153.18Ras protein specific guanine nucleotide releasing ... [more]
RASGRF11.766e-10252.99Ras protein specific guanine nucleotide releasing ... [more]
RASGRF26.723e-16356.90Ras protein specific guanine nucleotide releasing ... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sos-14.145e-2525.90Son of sevenless homolog [Source:UniProtKB/Swiss-... [more]
pxf-11.002e-2029.76Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-11.002e-2029.76Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-11.033e-2029.76Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-11.033e-2029.76Rap guanine nucleotide exchange factor [Source:Un... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sos1.075e-4132.85gene:FBgn0001965 transcript:FBtr0080541[more]
CG55223.332e-2629.85gene:FBgn0034158 transcript:FBtr0087031[more]
CG55223.332e-2629.85gene:FBgn0034158 transcript:FBtr0087028[more]
CG55223.332e-2629.85gene:FBgn0034158 transcript:FBtr0087027[more]
CG55224.834e-2629.85gene:FBgn0034158 transcript:FBtr0087030[more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasgrf2b4.938e-10854.32Ras protein-specific guanine nucleotide-releasing ... [more]
rasgrf2a3.075e-10454.24Ras protein-specific guanine nucleotide-releasing ... [more]
rasgrf2a3.350e-10454.24Ras protein-specific guanine nucleotide-releasing ... [more]
rasgrf2a5.402e-10454.24Ras protein-specific guanine nucleotide-releasing ... [more]
RASGRF13.374e-10454.32si:ch211-234p18.3 [Source:ZFIN;Acc:ZDB-GENE-090311... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdsp11.018e-10454.53CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GEN... [more]
ctdsp12.200e-10454.53CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GEN... [more]
ctdsp11.121e-6254.53CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GEN... [more]
ctdsp12.808e-10454.53CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GEN... [more]
ctdsp11.580e-5254.53CTD small phosphatase 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rasgrf18.535e-10151.79RAS protein-specific guanine nucleotide-releasing ... [more]
Rasgrf23.136e-10348.69RAS protein-specific guanine nucleotide-releasing ... [more]
Rasgrf24.247e-16256.41RAS protein-specific guanine nucleotide-releasing ... [more]
Rasgrf23.818e-11350.90RAS protein-specific guanine nucleotide-releasing ... [more]
Rasgrf29.861e-11051.84RAS protein-specific guanine nucleotide-releasing ... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2CEA7|RGRF2_DANRE3.727e-10754.32Ras-specific guanine nucleotide-releasing factor 2... [more]
sp|P28818|RGRF1_RAT1.213e-10352.06Ras-specific guanine nucleotide-releasing factor 1... [more]
sp|P27671|RGRF1_MOUSE5.970e-10051.79Ras-specific guanine nucleotide-releasing factor 1... [more]
sp|O14827|RGRF2_HUMAN1.258e-10053.18Ras-specific guanine nucleotide-releasing factor 2... [more]
sp|Q13972|RGRF1_HUMAN8.483e-10252.99Ras-specific guanine nucleotide-releasing factor 1... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F9403.765e-13669.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FCT36.889e-14765.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FAR51.675e-13668.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7TQP03.756e-14869.49Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3IZJ09.112e-15164.74ras-specific guanine nucleotide-releasing factor 1... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasgrf2b1.757e-10553.74Ras protein specific guanine nucleotide releasing ... [more]
rasgrf2b1.225e-10553.74Ras protein specific guanine nucleotide releasing ... [more]
rasgrf2b1.142e-10554.46Ras protein specific guanine nucleotide releasing ... [more]
si:ch211-234p18.32.445e-10455.01Ras protein specific guanine nucleotide releasing ... [more]
si:ch211-234p18.33.247e-10553.90Ras protein specific guanine nucleotide releasing ... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-234p18.36.249e-959.84Ras protein specific guanine nucleotide releasing ... [more]
rasgrf2b8.410e-15768.64Ras protein-specific guanine nucleotide-releasing ... [more]
ENSPMAT00000008557.13.217e-2660.23pep scaffold:Pmarinus_7.0:GL480921:622:11983:1 gen... [more]
rapgef21.952e-1930.41Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
ENSPMAT00000010890.15.243e-1829.35pep scaffold:Pmarinus_7.0:GL478025:43589:54725:1 g... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CDC251.042e-2630.47Membrane bound guanine nucleotide exchange factor;... [more]
LTE11.540e-1425.00Protein similar to GDP/GTP exchange factors; witho... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412483.250e-3830.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327404.516e-3332.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492691.071e-2328.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395132.958e-2227.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265194.866e-2160.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasgrf2b2.195e-10454.39Ras protein specific guanine nucleotide releasing ... [more]
rasgrf2b6.986e-10554.39Ras protein specific guanine nucleotide releasing ... [more]
RASGRF14.029e-10053.90ras-specific guanine nucleotide-releasing factor 1... [more]
RASGRF13.069e-10053.90ras-specific guanine nucleotide-releasing factor 1... [more]
si:ch211-234p18.34.214e-10353.19ras-specific guanine nucleotide-releasing factor 1... [more]
back to top
BLAST of ras-specific guanine nucleotide-releasing factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056262.10.000e+099.89SMESG000056262.1[more]
SMESG000077783.14.874e-2528.75SMESG000077783.1[more]
SMESG000077783.15.009e-2528.75SMESG000077783.1[more]
SMESG000077783.15.598e-2528.75SMESG000077783.1[more]
SMESG000077783.15.976e-2528.75SMESG000077783.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019001 ID=SMED30019001|Name=ras-specific guanine nucleotide-releasing factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5784bp
GGAATATATTATAATCAAATAAAGTGTAACAATTTGGCCTGTGTGAATTC
ATAATTGGTGAGGACAAGGACTCTAAATACAATCCCACATTGGATGACCC
GATGTCTTGATAGACAGAATTAGATTCCTATGCAAAAGACAATTAGAATC
AACGAGAATCAACTCTTCCATTTAGCGCAAAAAGCTCGTCAAGATGGTCG
AAGTACCTTATCGGGTTTCCTTTACAAGAAAAGCTCCGATACCGGTAAAT
GGCAGCAAAGATATTTTGTTCTTTATGAAAATCTTCTATTCTACTATGAC
GGAGAGAAATCGGATCGGCCTTCAGGAGTTGCTTTATTGGAAGGTTGTTA
TTGTGAGAAAATGGTTAATGTTAAAAGCAATGACAAAAATAATCAAAATC
AAGGATATTGCTTCGCAATTTATTACAAGAAAGAAGGTCAGCGTCAATAC
GACTTGAGAACAGACACGGAAGTTGAGTGTAACAATTGGGTCGAGACCAT
TAGGCAAGCCAGTTTTAGTCGAACTCAGGAATTAAAAGAGGAATTGGAAC
AGAAACATTTGCATTTGCTTCAGATTTTAGAAAGTGAGAGACAAGCCAAA
TGGCATTACGTGCAACAGACCGAAGAATTAGCTGCTGAAGTAAAGAAACT
GAAATCAGAATTACGTGAACTAAAAGAGTCGAGATTAGAAAGAAAAAACT
CTTCTCAGGCTTTGAATGAAAGTGAAGAATTGAGAAAAATTAAAAAAGTT
CAAAGTTTCTTTCGTGGTTGGCTTTGCCGACGGCGATGGAAACAAATAGT
TGAAGAATACATTCGATCAGAACATGCGGAATCAATGCGGAAGCGGAACA
ATATCGTTTTTGGACTGGTCGAATGTGAAGAAGAATATGTTCAGCAACTG
TCAATTATGGTCAGTTGTTTCCTTCGTCCTTTCAAAATGGCCGCAAGCTC
TAAAAAACCTATAATAACTCATGAAGATGTCAATTCTACATTTTTAAATG
CAGAAACTTTGTTGTTTTTGCATCAGATATTTTTACAGGGCCTTCGAAGC
AAAATAGAAAATTGGCCAACTTTACAATTAGGTGACTTGTTTGACATGCT
GTTGCCGATGTTGGGAATATATCAGGAATATGTTCGCAATCATCACTATT
CTCTACAAGTTCTCGCAGAATATAAACAGAAACCAGAATTTAATCAATTA
CTAAAAAGATACGAAGAAAAACCCGCGTGTGAAGGAAGATCTTTAGAATC
TTTTCTCACGTATCCTATGCATCAGATTCCTCGTTACATAATTACTTTGC
ATGAATTACTTGCTCATACTCCTCATGATCATGTAGATCGAGAAAAGCTG
GAATATGCCAAGAGCAAACTAGAAGAACTGTCAAATATAATGCACGATGA
AGTGAGCGAAACAGAAAATATCAGAAAGAATTTGGCCATAGAAAGGATGA
TCGTAGAAGGCTGCGACATATTGTTGGACGTTAATCAGATATTTGTCCGG
CAAGGATCTTTAATACAAGTAATTAATGAAAAATCCAAAAGTCCAAGAGC
TCGACTCGGAAGTTTCGGAGGATCGTCTAAAGAACGTAAAGAAATCGTGC
GTCAAGTTTTTCTCTTCACAAATCACCTATTGATTACTACTCGCGCCTCA
AATGGTAGATTGCATTTAGCTAAAAATTATGGAAAGATCAATCTAGTCGA
CTGCACTCTCATTGAAGATACACAAATGGAATTATTTCCGGTTGAACAAG
ACAACCATGCAAACGGCGAGACCGGAGTCGGTACTTCTAGTCAACATTTG
ACAATTGAGAATGCGCAAAAAGTTGAGCGAATTATCGATTATAATGGAGT
TGATTTTAGAATACTAATTGAAACAAAAAATTCTCCTCCAATAAGCATTA
CACTGCTGGCGTCCAGTATTCAAGAAAAGGCGGCTTGGTGTTCAGATATA
AGTCAGTGTATCGAGCAGCTGCATTACAGCGACCTGTTAAATTCTTCACT
CGCAGAGACATCGTCAGTTTCAATGCCGCAATCGATCAGATCTGATCCGA
AACTTTATCGAGATGACGTTGATATCCAGTTTAGTCGGCGTTTGAATTCT
TGTAAAGTTCCGCAGATTCGTCATGCTTCATTGGAGAGACTTATGGATAG
ACTAACAGATTTGAGATTTCTAAGCATAGATTTCCTCAATACATTTCTAT
TAACATATCGCGTTTTTACTAATGGTATCACTCTGGTAAATGCTCTGAGA
AGAATTCTCAATAATCCCGAATGTGGAAATTTGGAAGCTAGACCAAGTTT
TTCATCATTCAATTCTCTCGAATCTGAAGGAGTATTTTCAAATAATGCAG
TAGTTTCTCAAAGAGCTGAAACTAACAATCTTTTAATAAAACCACAATTA
GAAAAAACCCGTAGAATAAGTACTGGGATGATGAAAATGGAAGTGACAGG
AACTGAATCTGACGGCACTGATGAGCGTATCTTACACAAATTGAATACAG
AAATATCTTTGCATGATTCTTATGATAAAAGATTAATTTCATCAGCTGAA
GCTCCAGATTCTGTTGTTATTTCCAAATCTGCTCCTTCGTCCAGGAGAAC
TGGAAGCCTCGAATATCCTAATATCTCTGCCAGGCATGCAAAATTTCCAA
TAATGAAAGAAGAATATAACCAATCACAATCAGTTCAAATATCCGTTCCA
AATTTATCGAATTTATCTCAAGGAATTCATGAGAATCTTTACAATTCTAC
AGTTAAAGAGGAATCTGAGCCGTCAGATTCATTGACAGTTAACACTGAAA
ATTTCGCAAATATTAAGATTGAATCAGAAAAAATAGAAGTAACATTATCA
GCTGAAGGAAATATTCCAAATGAAAATTCGAAAGAATTCACAGAATCCAA
ATTTTCCGACAAATTACATGATTACATTAAATTTGATTCCATGTCTTTGG
CACCTGGGTTTGGTTCTTGTCATACTCCATCTTCTTCGAAAATGAAGCTC
AATTTATTGGCTCCACCTTCTTCATCAAGTTTCACCCATGCCGATTTATC
ATTAGATTCATATTCAAATTGGTCTTCATCAACATTATCAATGAATAATA
ATAACAATAATAATAAGTTGGCTCCTATAGCAAGTTGTGAAATACTTTCT
GAAGATCGTTCGTATTCGTCTGATGATGACGATGTGACATTCCGATCAAT
TTTGAAACCGAATGAGAAAGAAACTGGATTTGAAGAGTTTTCCGTGATTG
AACAACGTCAAAAAATGTACAATTCTCAGAAATCGTCCTCGTCGAGTCCC
GACAAAATTGACAAAACAATTACCATAGAATCTTCAAGCATTGTTGGAAA
ATTGAGTGAACATTTCAAACAAATAAGTTGTCCGAGTTACATTAATTCTC
CGCCCATTTCTAAAGCACATTTGCAATTATATGAAGGCCAAGAAACTACA
CCTCAAAGTCTGTACTCTGCTATTTCGTTACCATCTAGTCCTAACAAGCA
GTTAAACAAATCAGGTGTTAATCCTATTAAATATAAAGTGGAGCCTATTG
TGATACCTGAAGCTAATTTGTTAGATCACAAATGCACTGGATCAAGTTCT
ACGCCGTCCCAGTCTAAGAATCCAATGACTCCAAACCGAATAATATCTCC
CGCAAATAGTCCAAAGTTACCAGTGAAAGGATTATCAATCACTCCAAAAA
GATCTGTTCTCACTATATCATCAAGAACTTCATCAATGCCAACTCCAACT
CAAAGTAACCTGATTGCCGTTTCACCAAGCAGCAATAATCAGTTTCCAGG
ATCAAGTAATTTAACAATAACAACTAGTAGATCAAATACTTCGTTTGGAG
ATGCTAACAAATCTCGAGGGCCTTCAGTTTCAGAGAGTTCTCCTTCCCCA
ACCTTTCAAGAATTACTTCCATCTAGCACATTGCATCCTCTTGCCTCAGC
AGCTTTGAATTTGTCTCCCAGTACTACAGTTATTTATCATCACAGGCAGT
CCTCTCCTAAACTAATTGAAGCTCCAAACAGAACGCGATCTTCCGTTGTT
TCTTGGTCAGGTACAGTCAACACTCGTAAACATAAAAGACCATCAGCTAT
TTCTTGTCCTGATCATGATCTCATGATATCTCCAAGACCCAGTGTTCAAT
TAATGACAACAGGTGATACATCTCCTCCCATAAAAGCTCGTGTAGGGGCT
GTAGTGACTTCTTCTCGTTGCTCAAAAAGAAGATCAAGCAATACTGCCGC
TGCTCAAGCATTTGCAGCTGCAACAGCAGGCTGCATCAATCCTGCAATAT
GTAATAAAGCAACTAATAGGTATTATAGTACTGCTAATCCTTCTGGGGAT
ATAAAAGCTCTTTCCTTACACAACAAGCGGTTGTCAGTGATATATACAGC
AGCCACCATGAGAGTACTCAATGTTGTAAGACATTGGATATCAAAGTTTC
CCGAGGACTTTGATTCAGATCCTGAGTTAAAAAATGAGATGAAGTGTCTT
TTAGAAGATTTAGTATGCAATCAAAATCTTATTCCAAACGAACATAAGGT
TGCTGGTCAACTTCTGAGGCAATTGATGGACGATCAATTGGTCCTTAAGA
AAATCGATTTGGATGTCATTTTAACACCGATTCATATACCATCCAGGGAC
TCTTTTGACACCTTATCCGCATTAGATATAGCTGAACAGTTAACTTATTT
AGATCATCAGATTTTTCGATCTATTCGCAGCTCTGAATTACTCAACCAAA
CATGGATGAAGGCTGATAAAGCTGAAAAAGCCCCCCATGTGCTATTAGTA
AGCACGAGATTTAATGAGCTTAGTCGACTAGTTGTATCCGAAATTGTTAG
TCGTATAGATATCAATGATAGAGTTGCTTGCATTGAAAAATGGGCAGCTA
TTGCTGATATATGTCGCTGTATTCATAATTACAACGGAGTGTTACAAATA
TGTGCCGCATTTGTGAATAGTTCGGTATACCGGCTCAAGAGAACATGGGA
AAAGGTGCCAAAGCAAAGTAGAGTTACAATCGAAAAACTTCAAAATCTTG
TATCATCAGATGGCAGATTCAAAAATATGAGAGAAGCCCTTCACAGATGT
GATCCTCCTTGCATTCCATATCTAGGAATGTATTTGACAGATTTATCATT
TATCGAAGAAGGAGCGTTGAACGTCAGTGAAAATAAGCTAATTAACTTCT
GCAAAATGAGAATGATTGCCCATACGATTCGAGAAATTCAGCAATATCAA
CAAACACCATATCGAATTGAAAGGCACCCCAGGGTAACAGATTATTTATT
GGATCGCACAAGACTTTTAGAAGAAGAGAAAACTTATCAAGCTTCTTTGA
GAATTGAACCCCGTCAGTCAATTTCTAGACAAGGCCAACCGATTTTACAA
TAGACTTTTATCACTTTGTATTTATTAAAGACAATAAAGATGTATTTAAA
CATTAATGAGTGATGGCAACTCCAGGGTATCTCCTTCATCATCTATTTGC
ATTTCATCACATATCTTTTTTTATTCCTCTTTTCCGTTTATATGTAAAAA
TATTATTCTGCATTATCCTTTCTGTCTGATTATCTTTTGCAAAAATTAAA
ATTCCATTTATTAATTCATTGAAAAAGATAAATATTTTTTCTCATTTTGT
TGTGTTCTCTATGATATCGTGCATGGATTTAATGCATGGATTTATTTGTT
ATTTTGTCAAGTCTATTGAATATTTTTTGTAATTTTACAGCTGTCTGTTC
AATTATGTTTCTTCTAGTGTAATAAAATTAGATC
back to top

protein sequence of SMED30019001-orf-1

>SMED30019001-orf-1 ID=SMED30019001-orf-1|Name=SMED30019001-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1758bp
MQKTIRINENQLFHLAQKARQDGRSTLSGFLYKKSSDTGKWQQRYFVLYE
NLLFYYDGEKSDRPSGVALLEGCYCEKMVNVKSNDKNNQNQGYCFAIYYK
KEGQRQYDLRTDTEVECNNWVETIRQASFSRTQELKEELEQKHLHLLQIL
ESERQAKWHYVQQTEELAAEVKKLKSELRELKESRLERKNSSQALNESEE
LRKIKKVQSFFRGWLCRRRWKQIVEEYIRSEHAESMRKRNNIVFGLVECE
EEYVQQLSIMVSCFLRPFKMAASSKKPIITHEDVNSTFLNAETLLFLHQI
FLQGLRSKIENWPTLQLGDLFDMLLPMLGIYQEYVRNHHYSLQVLAEYKQ
KPEFNQLLKRYEEKPACEGRSLESFLTYPMHQIPRYIITLHELLAHTPHD
HVDREKLEYAKSKLEELSNIMHDEVSETENIRKNLAIERMIVEGCDILLD
VNQIFVRQGSLIQVINEKSKSPRARLGSFGGSSKERKEIVRQVFLFTNHL
LITTRASNGRLHLAKNYGKINLVDCTLIEDTQMELFPVEQDNHANGETGV
GTSSQHLTIENAQKVERIIDYNGVDFRILIETKNSPPISITLLASSIQEK
AAWCSDISQCIEQLHYSDLLNSSLAETSSVSMPQSIRSDPKLYRDDVDIQ
FSRRLNSCKVPQIRHASLERLMDRLTDLRFLSIDFLNTFLLTYRVFTNGI
TLVNALRRILNNPECGNLEARPSFSSFNSLESEGVFSNNAVVSQRAETNN
LLIKPQLEKTRRISTGMMKMEVTGTESDGTDERILHKLNTEISLHDSYDK
RLISSAEAPDSVVISKSAPSSRRTGSLEYPNISARHAKFPIMKEEYNQSQ
SVQISVPNLSNLSQGIHENLYNSTVKEESEPSDSLTVNTENFANIKIESE
KIEVTLSAEGNIPNENSKEFTESKFSDKLHDYIKFDSMSLAPGFGSCHTP
SSSKMKLNLLAPPSSSSFTHADLSLDSYSNWSSSTLSMNNNNNNNKLAPI
ASCEILSEDRSYSSDDDDVTFRSILKPNEKETGFEEFSVIEQRQKMYNSQ
KSSSSSPDKIDKTITIESSSIVGKLSEHFKQISCPSYINSPPISKAHLQL
YEGQETTPQSLYSAISLPSSPNKQLNKSGVNPIKYKVEPIVIPEANLLDH
KCTGSSSTPSQSKNPMTPNRIISPANSPKLPVKGLSITPKRSVLTISSRT
SSMPTPTQSNLIAVSPSSNNQFPGSSNLTITTSRSNTSFGDANKSRGPSV
SESSPSPTFQELLPSSTLHPLASAALNLSPSTTVIYHHRQSSPKLIEAPN
RTRSSVVSWSGTVNTRKHKRPSAISCPDHDLMISPRPSVQLMTTGDTSPP
IKARVGAVVTSSRCSKRRSSNTAAAQAFAAATAGCINPAICNKATNRYYS
TANPSGDIKALSLHNKRLSVIYTAATMRVLNVVRHWISKFPEDFDSDPEL
KNEMKCLLEDLVCNQNLIPNEHKVAGQLLRQLMDDQLVLKKIDLDVILTP
IHIPSRDSFDTLSALDIAEQLTYLDHQIFRSIRSSELLNQTWMKADKAEK
APHVLLVSTRFNELSRLVVSEIVSRIDINDRVACIEKWAAIADICRCIHN
YNGVLQICAAFVNSSVYRLKRTWEKVPKQSRVTIEKLQNLVSSDGRFKNM
REALHRCDPPCIPYLGMYLTDLSFIEEGALNVSENKLINFCKMRMIAHTI
REIQQYQQTPYRIERHPRVTDYLLDRTRLLEEEKTYQASLRIEPRQSISR
QGQPILQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036964RASGEF_cat_dom_sf
IPR035899DBL_dom_sf
IPR008937Ras-like_GEF
IPR030745RasGRF1
IPR000219DH-domain
IPR001895RASGEF_cat_dom
IPR000048IQ_motif_EF-hand-BS
IPR001849PH_domain
IPR000651Ras-like_Gua-exchang_fac_N
IPR011993PH-like_dom_sf
IPR019804Ras_G-nucl-exch_fac_CS
IPR023578Ras_GEF_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0007264small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity
GO:0046578regulation of Ras protein signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 161..201
NoneNo IPR availableGENE3DG3DSA:1.20.870.10coord: 1392..1479
e-value: 4.9E-6
score: 28.4
NoneNo IPR availableGENE3DG3DSA:1.20.870.10coord: 641..750
e-value: 5.1E-9
score: 38.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1152..1186
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1229..1261
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1152..1174
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 20..128
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 433..613
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 199..221
e-value: 0.0023
score: 27.2
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 200..227
score: 8.444
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 242..423
e-value: 1.0E-48
score: 177.8
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 243..419
e-value: 2.3E-35
score: 122.5
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 238..424
score: 30.057
IPR000219Dbl homology (DH) domainCDDcd00160RhoGEFcoord: 239..422
e-value: 3.68952E-39
score: 142.437
IPR001895Ras guanine-nucleotide exchange factors catalytic domainSMARTSM00147RasGEF_3coord: 1509..1746
e-value: 1.8E-83
score: 293.3
IPR001895Ras guanine-nucleotide exchange factors catalytic domainPFAMPF00617RasGEFcoord: 1516..1694
e-value: 3.8E-55
score: 186.8
IPR001895Ras guanine-nucleotide exchange factors catalytic domainPROSITEPS50009RASGEF_CATcoord: 1513..1745
score: 66.638
IPR001895Ras guanine-nucleotide exchange factors catalytic domainCDDcd00155RasGEFcoord: 1509..1741
e-value: 2.1486E-67
score: 225.595
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 25..131
e-value: 8.1E-21
score: 85.2
coord: 455..614
e-value: 1.1E-4
score: 31.5
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 28..128
e-value: 6.8E-19
score: 68.3
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 24..129
score: 16.661
IPR000651Ras-like guanine nucleotide exchange factor, N-terminalSMARTSM00229rasgefn_5coord: 1346..1483
e-value: 0.15
score: 4.0
coord: 658..789
e-value: 0.015
score: 16.8
IPR000651Ras-like guanine nucleotide exchange factor, N-terminalPFAMPF00618RasGEF_Ncoord: 662..724
e-value: 1.6E-12
score: 47.5
IPR000651Ras-like guanine nucleotide exchange factor, N-terminalPROSITEPS50212RASGEF_NTERcoord: 659..772
score: 9.642
IPR036964Ras guanine-nucleotide exchange factor catalytic domain superfamilyGENE3DG3DSA:1.10.840.10coord: 1510..1748
e-value: 1.8E-86
score: 291.5
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 434..638
e-value: 5.8E-24
score: 86.6
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 20..131
e-value: 5.9E-23
score: 83.2
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 225..433
e-value: 1.1E-43
score: 151.3
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 219..442
IPR008937Ras-like guanine nucleotide exchange factorPANTHERPTHR23113GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 1324..1746
coord: 84..762
IPR030745Ras-specific guanine nucleotide-releasing factor 1PANTHERPTHR23113:SF193RAS-SPECIFIC GUANINE NUCLEOTIDE-RELEASING FACTOR 1coord: 1324..1746
coord: 84..762
IPR019804Ras guanine-nucleotide exchange factor, conserved sitePROSITEPS00720RASGEFcoord: 1662..1692
IPR023578Ras guanine nucleotide exchange factor domain superfamilySUPERFAMILYSSF48366Ras GEFcoord: 651..1746