ATP-dependent DNA helicase

Overview
NameATP-dependent DNA helicase
Smed IDSMED30018991
Length (bp)2149
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent DNA helicase (SMED30018991) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent DNA helicase (SMED30018991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent DNA helicase (SMED30018991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent DNA helicase (SMED30018991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018991h1SMcG0010205 dd_Smed_v4_7318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018991h1SMcG0010205 dd_Smed_v4_7318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30018991h1SMcG0010205 dd_Smed_v4_7318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018991h1SMcG0010205 dd_Smed_v4_7318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018991h1SMcG0010205 dd_Smed_v4_4882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018991h1SMcG0010205 dd_Smed_v4_4882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018991h1SMcG0010205 Contig29612uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018991h1SMcG0010205 Contig29612newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018991h1SMcG0010205 Contig33715uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018991h1SMcG0010205 Contig33715newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018991h1SMcG0010205 Contig50813uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018991h1SMcG0010205 Contig50813newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30018991h1SMcG0010205 dd_Smed_v4_7318_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: RECQL (RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:9948])

HSP 1 Score: 408.683 bits (1049), Expect = 4.787e-133
Identity = 246/609 (40.39%), Postives = 353/609 (57.96%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQ--------LSISTKGHS---ITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNV 1884
            I   + A++ +I+ LT  +++LI+KKK         L  S  G S    +S   + KE+FPWS  +K +LQ+ FK++ F+ LQL+TIN T+   +   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY  +R  R+ +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D +  L +   C     ++NR N++YEV+   SN +   E+I KLI  R+ GQSGI++CF+QKD E +T  L N GI A +Y+  L  + K  +H KW     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  ++DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +    C  MC  C   +S     +I +  +  + I+K  E+  N K+T  K+I     + +  L  A  +A   P  D    L+K   H ++  YLK DYSF +++  +Y+  G K  L +NE   I +++ KS       QN  + ESS  
Sbjct:   14 ITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEK-CFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCK-DSAFERKNITEYCRDLIKILKQAEEL-NEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRED----LEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKS------TQNSFRAESSQT 605          
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: RECQL (RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:9948])

HSP 1 Score: 408.683 bits (1049), Expect = 4.787e-133
Identity = 246/609 (40.39%), Postives = 353/609 (57.96%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQ--------LSISTKGHS---ITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNV 1884
            I   + A++ +I+ LT  +++LI+KKK         L  S  G S    +S   + KE+FPWS  +K +LQ+ FK++ F+ LQL+TIN T+   +   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY  +R  R+ +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D +  L +   C     ++NR N++YEV+   SN +   E+I KLI  R+ GQSGI++CF+QKD E +T  L N GI A +Y+  L  + K  +H KW     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  ++DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +    C  MC  C   +S     +I +  +  + I+K  E+  N K+T  K+I     + +  L  A  +A   P  D    L+K   H ++  YLK DYSF +++  +Y+  G K  L +NE   I +++ KS       QN  + ESS  
Sbjct:   14 ITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEK-CFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCK-DSAFERKNITEYCRDLIKILKQAEEL-NEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRED----LEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKS------TQNSFRAESSQT 605          
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: BLM (BLM RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:1058])

HSP 1 Score: 287.345 bits (734), Expect = 1.366e-82
Identity = 167/449 (37.19%), Postives = 247/449 (55.01%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEK 1563
            +FP +  + K+   KF + NF++ QL+ INA L   DC  +   G GKSLCYQL + +S G T+VI+PL SLI DQ+       I    L  + +      I+  + + DP+     KL+Y TP+KI  S +L   +E  Y  K L R VIDE HC S+  HDFRQDYK ++ L+  +P++PV+ LTATAN  V  DI T L +     V   ++NR N+ Y V      KK   +  + I+      SGI++C ++++C+ + + L  +G+ A +Y+  L    + ++  KW+N++ C+VI AT AFGMGIDKP+VRFVIH S+ KS+E YYQESGRAGRDG+ S C+LF+   +  ++   I  EK G          NL  M  Y  +   C+R+ L +   E  F  + CK    V  D   +       DV     +I++ +++
Sbjct:  648 SFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPI----IKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP-QVFSMSFNRHNLKYYV-LPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQE 1090          
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: BLM (BLM RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:1058])

HSP 1 Score: 287.73 bits (735), Expect = 1.733e-82
Identity = 167/449 (37.19%), Postives = 247/449 (55.01%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEK 1563
            +FP +  + K+   KF + NF++ QL+ INA L   DC  +   G GKSLCYQL + +S G T+VI+PL SLI DQ+       I    L  + +      I+  + + DP+     KL+Y TP+KI  S +L   +E  Y  K L R VIDE HC S+  HDFRQDYK ++ L+  +P++PV+ LTATAN  V  DI T L +     V   ++NR N+ Y V      KK   +  + I+      SGI++C ++++C+ + + L  +G+ A +Y+  L    + ++  KW+N++ C+VI AT AFGMGIDKP+VRFVIH S+ KS+E YYQESGRAGRDG+ S C+LF+   +  ++   I  EK G          NL  M  Y  +   C+R+ L +   E  F  + CK    V  D   +       DV     +I++ +++
Sbjct:  648 SFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPI----IKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP-QVFSMSFNRHNLKYYV-LPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQE 1090          
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Match: BLM (BLM RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:1058])

HSP 1 Score: 287.345 bits (734), Expect = 1.822e-82
Identity = 169/449 (37.64%), Postives = 249/449 (55.46%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKNM----CSVCADTESEMSSIDIADVYKSALTIIK 1551
            +FP +  + K+   KF + NF++ QL+ INA L   DC  +   G GKSLCYQL + +S G T+VI+PL SLI DQ+       I    L  + +      I+  + + DP+     KL+Y TP+KI  S +L   +E  Y  K L R VIDE HC S+  HDFRQDYK ++ L+  +P++PV+ LTATAN  V  DI T L +     V   ++NR N+ Y V      KK   +  + I+      SGI++C ++++C+ + + L  +G+ A +Y+  L    + ++  KW+N++ C+VI AT AFGMGIDKP+VRFVIH S+ KS+E YYQESGRAGRDG+ S C+LF+   +  ++   I  EK G          NL  M  Y  +   C+R+ L +   E  F  + CK      C  C  T+ +  + D+ D  KS +  ++
Sbjct:  648 SFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPI----IKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP-QVFSMSFNRHNLKYYV-LPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTK-DYKTRDVTDDVKSIVRFVQ 1089          
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Match: K02F3.12 (Putative ATP-dependent DNA helicase Q1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ8])

HSP 1 Score: 402.519 bits (1033), Expect = 1.676e-131
Identity = 230/610 (37.70%), Postives = 357/610 (58.52%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKK----KQLSISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDN--VTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEV-KFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCAD-----TESEMSSIDIADVYKSALTIIK---NIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKK 1890
            ++D  I  ID +I  L  +K +L +K+    +++ + T   S      + ++ FPWS    K+L+++F ++ F+ LQ   INA + K D + I S G GKSLCYQL ++++ G  LV++PL SL++DQ++     GI   SL++N+S     E  K +E D + N    ++L+Y TP+K++ SKK+   +EK+     L  + IDE+HCCS+  HDFR DY  L+ LK  +  +P+LGLTATA ++V++D+K  L + +  L  +  +NRSN+ Y+V +   +E +  EEI K IK  F GQ+GI++C ++ DCE +   L ++GI A  Y+  +    +   H  W++   +VIVAT AFGMGIDKPNVRFVIH S+ KS+ENYYQESGRAGRDG+ + CIL+++LA+ FK  S +  E++GI NL  M RY  D  TC+RV L+   +E +  + C+  C  C +       S   S D+++  K+ + II+   N  K  + +ITG K++ EL          L  +  G   + F +K   +L+L GYL+ D+ +  +S  +YV+ GSK    N K  I +R  +  K R      K+  SS+V++
Sbjct:   15 DLDGEIGQIDQQISQLRRKKSELTQKRQAIERKIELKTNEDSDVVTDRWDRDGFPWSDEATKILKEQFHLEKFRPLQRAAINAVMSKEDAVVILSTGGGKSLCYQLPALLANGLALVVSPLISLVEDQILQLRSLGIDSSSLNANTS----KEEAKRVE-DAITNKDSKFRLLYVTPEKLAKSKKMMNKLEKSLSVGFLKLIAIDEVHCCSQWGHDFRTDYSFLNVLKRQFKGVPILGLTATATSNVLDDVKDMLGIQA-ALTFRAGFNRSNLKYKVVQKPGSEDECTEEIAKTIKRDFAGQTGIIYCLSRNDCEKVAKALKSHGIKAKHYHAYMEPVDRSGAHQGWISGKIQVIVATVAFGMGIDKPNVRFVIHHSLPKSIENYYQESGRAGRDGQPATCILYYRLADIFKQSSMVQQERTGIQNLYNMVRYAADSSTCRRVKLAEHFEEAWEPSWCQKQCDTCENGNGFVGTSSKESTDVSEAAKTTVRIIEEHLNSAKDGSGRITGNKLV-EL----------LTKKLKGSRNREFCEKLIVNLLLEGYLQEDFHYTVYSVISYVVIGSKWRVYNGKDAIKMRHVEESKSR------KRKASSSVEE 601          
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Match: K02F3.12 (Putative ATP-dependent DNA helicase Q1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ8])

HSP 1 Score: 402.519 bits (1033), Expect = 1.676e-131
Identity = 230/610 (37.70%), Postives = 357/610 (58.52%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKK----KQLSISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDN--VTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEV-KFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCAD-----TESEMSSIDIADVYKSALTIIK---NIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKK 1890
            ++D  I  ID +I  L  +K +L +K+    +++ + T   S      + ++ FPWS    K+L+++F ++ F+ LQ   INA + K D + I S G GKSLCYQL ++++ G  LV++PL SL++DQ++     GI   SL++N+S     E  K +E D + N    ++L+Y TP+K++ SKK+   +EK+     L  + IDE+HCCS+  HDFR DY  L+ LK  +  +P+LGLTATA ++V++D+K  L + +  L  +  +NRSN+ Y+V +   +E +  EEI K IK  F GQ+GI++C ++ DCE +   L ++GI A  Y+  +    +   H  W++   +VIVAT AFGMGIDKPNVRFVIH S+ KS+ENYYQESGRAGRDG+ + CIL+++LA+ FK  S +  E++GI NL  M RY  D  TC+RV L+   +E +  + C+  C  C +       S   S D+++  K+ + II+   N  K  + +ITG K++ EL          L  +  G   + F +K   +L+L GYL+ D+ +  +S  +YV+ GSK    N K  I +R  +  K R      K+  SS+V++
Sbjct:   15 DLDGEIGQIDQQISQLRRKKSELTQKRQAIERKIELKTNEDSDVVTDRWDRDGFPWSDEATKILKEQFHLEKFRPLQRAAINAVMSKEDAVVILSTGGGKSLCYQLPALLANGLALVVSPLISLVEDQILQLRSLGIDSSSLNANTS----KEEAKRVE-DAITNKDSKFRLLYVTPEKLAKSKKMMNKLEKSLSVGFLKLIAIDEVHCCSQWGHDFRTDYSFLNVLKRQFKGVPILGLTATATSNVLDDVKDMLGIQA-ALTFRAGFNRSNLKYKVVQKPGSEDECTEEIAKTIKRDFAGQTGIIYCLSRNDCEKVAKALKSHGIKAKHYHAYMEPVDRSGAHQGWISGKIQVIVATVAFGMGIDKPNVRFVIHHSLPKSIENYYQESGRAGRDGQPATCILYYRLADIFKQSSMVQQERTGIQNLYNMVRYAADSSTCRRVKLAEHFEEAWEPSWCQKQCDTCENGNGFVGTSSKESTDVSEAAKTTVRIIEEHLNSAKDGSGRITGNKLV-EL----------LTKKLKGSRNREFCEKLIVNLLLEGYLQEDFHYTVYSVISYVVIGSKWRVYNGKDAIKMRHVEESKSR------KRKASSSVEE 601          
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Match: K02F3.12 (Putative ATP-dependent DNA helicase Q1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ8])

HSP 1 Score: 402.134 bits (1032), Expect = 4.620e-131
Identity = 230/610 (37.70%), Postives = 357/610 (58.52%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKK----KQLSISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDN--VTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEV-KFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCAD-----TESEMSSIDIADVYKSALTIIK---NIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKK 1890
            ++D  I  ID +I  L  +K +L +K+    +++ + T   S      + ++ FPWS    K+L+++F ++ F+ LQ   INA + K D + I S G GKSLCYQL ++++ G  LV++PL SL++DQ++     GI   SL++N+S     E  K +E D + N    ++L+Y TP+K++ SKK+   +EK+     L  + IDE+HCCS+  HDFR DY  L+ LK  +  +P+LGLTATA ++V++D+K  L + +  L  +  +NRSN+ Y+V +   +E +  EEI K IK  F GQ+GI++C ++ DCE +   L ++GI A  Y+  +    +   H  W++   +VIVAT AFGMGIDKPNVRFVIH S+ KS+ENYYQESGRAGRDG+ + CIL+++LA+ FK  S +  E++GI NL  M RY  D  TC+RV L+   +E +  + C+  C  C +       S   S D+++  K+ + II+   N  K  + +ITG K++ EL          L  +  G   + F +K   +L+L GYL+ D+ +  +S  +YV+ GSK    N K  I +R  +  K R      K+  SS+V++
Sbjct:   38 DLDGEIGQIDQQISQLRRKKSELTQKRQAIERKIELKTNEDSDVVTDRWDRDGFPWSDEATKILKEQFHLEKFRPLQRAAINAVMSKEDAVVILSTGGGKSLCYQLPALLANGLALVVSPLISLVEDQILQLRSLGIDSSSLNANTS----KEEAKRVE-DAITNKDSKFRLLYVTPEKLAKSKKMMNKLEKSLSVGFLKLIAIDEVHCCSQWGHDFRTDYSFLNVLKRQFKGVPILGLTATATSNVLDDVKDMLGIQA-ALTFRAGFNRSNLKYKVVQKPGSEDECTEEIAKTIKRDFAGQTGIIYCLSRNDCEKVAKALKSHGIKAKHYHAYMEPVDRSGAHQGWISGKIQVIVATVAFGMGIDKPNVRFVIHHSLPKSIENYYQESGRAGRDGQPATCILYYRLADIFKQSSMVQQERTGIQNLYNMVRYAADSSTCRRVKLAEHFEEAWEPSWCQKQCDTCENGNGFVGTSSKESTDVSEAAKTTVRIIEEHLNSAKDGSGRITGNKLV-EL----------LTKKLKGSRNREFCEKLIVNLLLEGYLQEDFHYTVYSVISYVVIGSKWRVYNGKDAIKMRHVEESKSR------KRKASSSVEE 624          
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Match: him-6 (Bloom syndrome protein homolog [Source:UniProtKB/Swiss-Prot;Acc:O18017])

HSP 1 Score: 263.077 bits (671), Expect = 1.633e-75
Identity = 154/455 (33.85%), Postives = 244/455 (53.63%), Query Frame = 1
Query:  286 LQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMI-SGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLY--PNLPVLGLTATANNSVINDIKTTLNL-NSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNI--FTEKSGIPNLNIMN-----RYILDDCTCKRVSLSSILDEKFTVNDCKN---MCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISEL 1608
            L+ KF    F+  Q + I +TL   D   +   G+GKSLCYQL ++I  G T+V++PL SLI+DQ +  ++ GI C +L ++     Q +I+  + +    N + KL+Y TP+KIS S +L       +    L R VIDE HC S+  HDFR DY  L  L+  Y  P +P++ LTATA   ++ D +  L + NS   +   ++ R N+ Y++  +    +    + + +K  + G+SGIV+C ++K+CE +   L   G+ A  Y+  L  +++  +   W+     VI AT AFGMGIDKP+VRFVIH S+ KS+E YYQE+GRAGRDG  S C++ +   +  ++   I      +G+ ++++ N      Y  +   C+R  L     E +    C+N    C +C        +I + DV   AL+I+K + + +   +   K ISEL
Sbjct:  239 LKSKFGFNQFRHRQKQCILSTLMGHDTFVLMPTGAGKSLCYQLPAVILPGVTVVVSPLRSLIEDQKMKMKELGIGCEALTADLGAPAQEKIYAELGSG---NPSIKLLYVTPEKISASGRLNSVFFDLHRRGLLARFVIDEAHCVSQWGHDFRPDYTKLSSLREKYANPPVPIIALTATATPKIVTDARDHLKMQNSKLFI--SSFVRDNLKYDL--IPKAARSLINVVEKMKQLYPGKSGIVYCLSRKECETVQMMLTKAGLSAEVYHAGLNDNLRVSVQRSWIANKFDVICATIAFGMGIDKPDVRFVIHYSLPKSIEGYYQETGRAGRDGMPSYCLMLYSYHDSIRLRRMIEEGNTTTGVRSMHLNNVLQVVAYCENVSVCRRKMLVEHFGEVYDEQSCRNSKTPCDICERQRKNAEAIRLFDVSTDALSILKCLPRMQKATL---KYISEL 683          
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Match: rcq-5 (ATP-dependent DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q19046])

HSP 1 Score: 212.616 bits (540), Expect = 1.673e-58
Identity = 148/464 (31.90%), Postives = 235/464 (50.65%), Query Frame = 1
Query:  280 KLLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQLASMI-SGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVR-LVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-----LSNEKKEGEEICKLI----------------------KSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFW-----------------KLAEYFKIGSNIFTEKS--GIPNLNIMNRYILDDC---TCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSID 1512
            K+  + F  K ++S LQ++ IN  L +   +++S P G+GKSLCYQL +++  G T+VI+PL +L++DQ+   ++ GI C +L+S  +   ++ I   +  +     T +++Y T + ++     TK +     ++ ++R +V+DE HC ++  HDFR DY  L  L+ + P +P + LTATAN    +DI   L L +        Y R N+FY+V        + E      I K +                      K  F G S IV+C ++ +C  +   L   GI A +Y+  LG   + ++  KW+N    V+ AT AFGMGIDKP+VR VIH S S++L  YYQE+GRAGRDGKRS C +++                 KL E  K  +N   EK+   I ++      +L+ C    C+ VS++S  D+      CK  C  C D    + +++
Sbjct:  167 KVFLELFCHKKYRSRLQMQAINCILKRKCDVYVSLPTGAGKSLCYQLPAVVHGGITVVISPLIALMKDQISSLKRKGIPCETLNSTLTTVERSRIMGELAKE---KPTIRMLYLTAEGVATDG--TKKLLNGLANRDVLRYIVVDEAHCVTQWGHDFRPDYLTLGSLRDVCPGVPWVALTATANAKAQDDIAFQLKLRNPESFKSGTY-RDNLFYDVAMRDHLATAPENHMASFITKCLTVDAKTSSSNLTKHEKAERSQNKKTFTG-SAIVYCRSRNECGQVAKMLEIAGIPAMAYHAGLGKKDRNEVQEKWMNNEIPVVAATVAFGMGIDKPDVRAVIHWSPSQNLAGYYQEAGRAGRDGKRSYCRIYYSKQDKNALNFLVSGELAKLREKAK-KNNAEGEKAEMQIKSIQTGLAKMLEYCESARCRHVSIASFFDDT-ECRPCKTNCDYCRDPTKTIRNVE 621          
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Match: Blm (gene:FBgn0002906 transcript:FBtr0082434)

HSP 1 Score: 271.166 bits (692), Expect = 4.041e-77
Identity = 161/457 (35.23%), Postives = 251/457 (54.92%), Query Frame = 1
Query:  238 DYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG----EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKS---GIPNLNIMNRY-ILDDCT----CKRVSLSSILDEKFTVNDC----KNMCSVCADTESEMSSIDIADVYKSALTIIKNI 1557
            ++  + F  S+ +   L   F +K+F+  QL+ INATL   DC  +   G GKSLCYQL ++++ G T+VI+PL SLI DQ+       I   SL     +     I++ +E+ P      KL+Y TP+KIS+S +    ++    +  + R VIDE HC S+  HDFR DYK L  LK  +PN+P + LTATA   V  DI   LNL  +C     ++NRSN+ Y V       K+G    ++I + I+S+    SGI++C ++K+C+  + ++  +G+ A SY+  L    ++     WL    +VI AT AFGMGIDKP+VRFV+H S+ KS+E YYQE+GRAGRDG  +DCIL++  ++  +I   + ++K+    +  +++ N Y I+  C     C+R        E FT   C    +  C  C +  +   ++D  +  + A   +K++
Sbjct:  713 EFDGQKFEHSTRLMHGLSYSFGLKSFRPNQLQVINATLLGNDCFVLMPTGGGKSLCYQLPAILTEGVTIVISPLKSLIFDQINKLASLDICAKSLSGEQKMADVMAIYRDLESQPP---MVKLLYVTPEKISSSARFQDTLDTLNSNNYISRFVIDEAHCVSQWGHDFRPDYKKLGVLKKRFPNVPTIALTATATPRVRLDILAQLNLK-NCKWFLSSFNRSNLRYRVL-----PKKGVSTLDDISRYIRSKPQHFSGIIYCLSRKECDETSKKMCKDGVRAVSYHAGLTDTDRESRQKDWLTGKMRVICATVAFGMGIDKPDVRFVLHYSLPKSIEGYYQEAGRAGRDGDVADCILYYNYSDMLRIKKMLDSDKALQYNVKKIHVDNLYRIVGYCENLTDCRRAQQLDYFGEHFTSEQCLENRETACDNCINKRA-YKAVDALEHARKAARAVKDL 1159          
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Match: RecQ5 (gene:FBgn0027375 transcript:FBtr0100362)

HSP 1 Score: 190.66 bits (483), Expect = 6.942e-53
Identity = 133/465 (28.60%), Postives = 221/465 (47.53%), Query Frame = 1
Query:  268 SNIKKLLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQLASMIS--GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEI---FKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIK------------SRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKI--------------GSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDI------ADVYKSALTI 1545
            S + + L+  F    FKS LQ K +   + K   +++S P GSGKSLC+QL  ++S    T+V +PL +LI+DQ+    K  +   SL+S  S K ++ +    KA+ T+       K +Y TP++ + +K     ++  +   +L    +DE HC S+  HDFR DY  L  L+S Y ++  L LTATA+  V  DI   L L+           R N+FY++ + ++ + + + +    +             +     GIV+C  +   E +   +   GI A +Y+  L    + ++   W+  +  +I ATN+FGMG+DKP+VRFVIH  + +++  YYQESGRAGRDG +S C L++   +   I              G      +  I     +  +  +  TC+    S    +     DC   C VC   +    +++I       D +KS +++
Sbjct:    5 SAVHEALKKHFGHSKFKSDLQEKAVKCAVKKKQDVYVSMPTGSGKSLCFQLPGLMSENQITIVFSPLLALIKDQIDHLTKLKVPADSLNSKMSTKERDRVIMDLKAVRTN------LKFLYITPEQAA-TKFFQDLLQTLHKHNKLAYFAVDEAHCVSQWGHDFRPDYLKLGELRSKYSDVIWLALTATASREVKEDIYKQLRLHQPVAQFSTPSFRKNLFYDIVYKNSIEDDFQHLADFARHCLGNPKEFKDTPKPQRGCGIVYCRTRDQVERMAIGVTKQGIGAVAYHAGLKTGERTEVQEAWMRGDQPIICATNSFGMGVDKPSVRFVIHWDVPQNVAAYYQESGRAGRDGLQSYCRLYYGREDVRSIRFLLQNDAHRARGRGDKELLTERAIKQFEKITEFC-ERTTCRHKLFSDFFGD--PTPDCSGQCDVCKRPKKAEKALEIFHRLCMDDAFKSHISL 459          
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Match: RecQ5 (gene:FBgn0027375 transcript:FBtr0075714)

HSP 1 Score: 190.274 bits (482), Expect = 8.011e-53
Identity = 133/465 (28.60%), Postives = 221/465 (47.53%), Query Frame = 1
Query:  268 SNIKKLLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQLASMIS--GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEI---FKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIK------------SRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKI--------------GSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDI------ADVYKSALTI 1545
            S + + L+  F    FKS LQ K +   + K   +++S P GSGKSLC+QL  ++S    T+V +PL +LI+DQ+    K  +   SL+S  S K ++ +    KA+ T+       K +Y TP++ + +K     ++  +   +L    +DE HC S+  HDFR DY  L  L+S Y ++  L LTATA+  V  DI   L L+           R N+FY++ + ++ + + + +    +             +     GIV+C  +   E +   +   GI A +Y+  L    + ++   W+  +  +I ATN+FGMG+DKP+VRFVIH  + +++  YYQESGRAGRDG +S C L++   +   I              G      +  I     +  +  +  TC+    S    +     DC   C VC   +    +++I       D +KS +++
Sbjct:    5 SAVHEALKKHFGHSKFKSDLQEKAVKCAVKKKQDVYVSMPTGSGKSLCFQLPGLMSENQITIVFSPLLALIKDQIDHLTKLKVPADSLNSKMSTKERDRVIMDLKAVRTN------LKFLYITPEQAA-TKFFQDLLQTLHKHNKLAYFAVDEAHCVSQWGHDFRPDYLKLGELRSKYSDVIWLALTATASREVKEDIYKQLRLHQPVAQFSTPSFRKNLFYDIVYKNSIEDDFQHLADFARHCLGNPKEFKDTPKPQRGCGIVYCRTRDQVERMAIGVTKQGIGAVAYHAGLKTGERTEVQEAWMRGDQPIICATNSFGMGVDKPSVRFVIHWDVPQNVAAYYQESGRAGRDGLQSYCRLYYGREDVRSIRFLLQNDAHRARGRGDKELLTERAIKQFEKITEFC-ERTTCRHKLFSDFFGD--PTPDCSGQCDVCKRPKKAEKALEIFHRLCMDDAFKSHISL 459          
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Match: RecQ5 (gene:FBgn0027375 transcript:FBtr0075715)

HSP 1 Score: 190.274 bits (482), Expect = 3.129e-50
Identity = 134/466 (28.76%), Postives = 224/466 (48.07%), Query Frame = 1
Query:  268 SNIKKLLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQLASMIS--GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEI---FKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIK------------SRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKI---------------GSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDI------ADVYKSALTI 1545
            S + + L+  F    FKS LQ K +   + K   +++S P GSGKSLC+QL  ++S    T+V +PL +LI+DQ+    K  +   SL+S  S K ++ +    KA+ T+       K +Y TP++ + +K     ++  +   +L    +DE HC S+  HDFR DY  L  L+S Y ++  L LTATA+  V  DI   L L+           R N+FY++ + ++ + + + +    +             +     GIV+C  +   E +   +   GI A +Y+  L    + ++   W+  +  +I ATN+FGMG+DKP+VRFVIH  + +++  YYQESGRAGRDG +S C L++   +   I                  + TE++ I     +  +  +  TC+    S    +     DC   C VC   +    +++I       D +KS +++
Sbjct:    5 SAVHEALKKHFGHSKFKSDLQEKAVKCAVKKKQDVYVSMPTGSGKSLCFQLPGLMSENQITIVFSPLLALIKDQIDHLTKLKVPADSLNSKMSTKERDRVIMDLKAVRTN------LKFLYITPEQAA-TKFFQDLLQTLHKHNKLAYFAVDEAHCVSQWGHDFRPDYLKLGELRSKYSDVIWLALTATASREVKEDIYKQLRLHQPVAQFSTPSFRKNLFYDIVYKNSIEDDFQHLADFARHCLGNPKEFKDTPKPQRGCGIVYCRTRDQVERMAIGVTKQGIGAVAYHAGLKTGERTEVQEAWMRGDQPIICATNSFGMGVDKPSVRFVIHWDVPQNVAAYYQESGRAGRDGLQSYCRLYYGREDVRSIRFLLQNDAHRARGRGDKELLTERA-IKQFEKITEFC-ERTTCRHKLFSDFFGD--PTPDCSGQCDVCKRPKKAEKALEIFHRLCMDDAFKSHISL 459          
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Match: RecQ4 (gene:FBgn0040290 transcript:FBtr0076729)

HSP 1 Score: 142.124 bits (357), Expect = 2.355e-34
Identity = 114/371 (30.73%), Postives = 178/371 (47.98%), Query Frame = 1
Query:  298 FKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASM-----ISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLV-------IDEIHCCSELSHDFRQDYKNLHGLKSLYPNL---PVLGLTATA----NNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDG-QSGIVFCFNQKDCENL------------------TNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILF 1296
            F   NF+  Q + I  TL  L  +   S GSGKSLCYQL +      +   TLVI+PL SL++DQ+     F +    L +N +   + +I + +    +D     ++  +P+ +        A E+A G   ++R +       IDE HC S+ SH+FR  Y  L   K L  NL    VLGLTATA      S+IN +  +   + +  +  D     N+   V    +E ++   +  L   RF+  QS I++C  + +CE +                  T +       A  Y+  +    ++ +   +++   +++VAT AFGMGI+KP++R VIH +M ++ E+Y QE GRAGRDG  S C LF
Sbjct:  866 FGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF-LRAHCLHTNQTAPQRMKIQQMIANGEID-----ILLVSPEAVV-------AGERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSY--LMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGIS---DGERGIISDIPLPDNLVLSVS--KDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLF 1216          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: recql (RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-050809-134])

HSP 1 Score: 348.591 bits (893), Expect = 3.228e-110
Identity = 202/558 (36.20%), Postives = 315/558 (56.45%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISEL-----ANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVK 1887
            + Y   +F WS  ++  L + F++  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +   +  ++L+++SS +    I   M TD   N  +KL+Y TP+KI+ SK L   +EKA+    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN+P++GLTATA ++V+ D +  L +     +    +NR N++YEV+F  NE    ++I  LI+ R+  QSGIV+ F+QKD E +  EL    I+A  Y+  +    K  +H +W ++  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+   + F+I + +  E +G   L+ M  Y  +   C+R  ++   DE +   +C  MC VC    ++  ++DI    +  L I++ +  + + K+T  K+         A Q  +      +R       L ++    HL+L GY   D+SF  ++   Y+  G K  L  N    I +++ +    ++ V+ V  +ESS  K
Sbjct:   72 QHYEDSDFSWSKEVQVNLCNIFQLSKFRPLQRAAINLSMSGKDLFLVMPTGRGKSLCYQLPALCSKGFTLVIAPLVSLMEDQLMYLQSVNVPAVTLNASSSKEDSKRILAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAFNMGLLARIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPNVPLIGLTATATSNVLKDCQKILCVQEPVTLTAP-FNRPNLYYEVRFKDNEDCT-DQIASLIRGRYKNQSGIVYVFSQKDAEVVATELQKRDIVAQPYHANMEPSHKSLVHQRWSSKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDSPADCIVFFGFMDIFRISTMVVMENTGQQKLHNMVAYCQNVDRCRRAMMAIHFDEVWNDEECNEMCDVCRHG-NDYITMDITQHARDVLHIVE-LASSMDEKLTPLKVCDAWLGKGPAKQRKMIKLTSLSR-------LEVESVIIHLLLHGYFSEDFSFTPYTTHFYLKLGRKAALLKNSGHSITMKMRRRGTSQSTVKKV--SESSGEK 613          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: recql (RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-050809-134])

HSP 1 Score: 348.591 bits (893), Expect = 3.228e-110
Identity = 202/558 (36.20%), Postives = 315/558 (56.45%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISEL-----ANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVK 1887
            + Y   +F WS  ++  L + F++  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +   +  ++L+++SS +    I   M TD   N  +KL+Y TP+KI+ SK L   +EKA+    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN+P++GLTATA ++V+ D +  L +     +    +NR N++YEV+F  NE    ++I  LI+ R+  QSGIV+ F+QKD E +  EL    I+A  Y+  +    K  +H +W ++  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+   + F+I + +  E +G   L+ M  Y  +   C+R  ++   DE +   +C  MC VC    ++  ++DI    +  L I++ +  + + K+T  K+         A Q  +      +R       L ++    HL+L GY   D+SF  ++   Y+  G K  L  N    I +++ +    ++ V+ V  +ESS  K
Sbjct:   72 QHYEDSDFSWSKEVQVNLCNIFQLSKFRPLQRAAINLSMSGKDLFLVMPTGRGKSLCYQLPALCSKGFTLVIAPLVSLMEDQLMYLQSVNVPAVTLNASSSKEDSKRILAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAFNMGLLARIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPNVPLIGLTATATSNVLKDCQKILCVQEPVTLTAP-FNRPNLYYEVRFKDNEDCT-DQIASLIRGRYKNQSGIVYVFSQKDAEVVATELQKRDIVAQPYHANMEPSHKSLVHQRWSSKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDSPADCIVFFGFMDIFRISTMVVMENTGQQKLHNMVAYCQNVDRCRRAMMAIHFDEVWNDEECNEMCDVCRHG-NDYITMDITQHARDVLHIVE-LASSMDEKLTPLKVCDAWLGKGPAKQRKMIKLTSLSR-------LEVESVIIHLLLHGYFSEDFSFTPYTTHFYLKLGRKAALLKNSGHSITMKMRRRGTSQSTVKKV--SESSGEK 613          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: recql (RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-050809-134])

HSP 1 Score: 344.739 bits (883), Expect = 1.188e-108
Identity = 201/558 (36.02%), Postives = 314/558 (56.27%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISEL-----ANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVK 1887
            + Y   +F WS  ++  L + F++  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +   +  ++L+++SS +    I   M TD   N  +KL+Y TP+KI+ SK L   +EKA+    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN+P++GLTATA ++V+ D +  L +     +    +NR N++YEV+F  NE    ++I  LI+ R+  QSGIV+ F+QKD E +  EL    I+A  Y+  +    K  +H +W ++  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+   + F+I + +  E +G   L+ M  Y  +    +R  ++   DE +   +C  MC VC    ++  ++DI    +  L I++ +  + + K+T  K+         A Q  +      +R       L ++    HL+L GY   D+SF  ++   Y+  G K  L  N    I +++ +    ++ V+ V  +ESS  K
Sbjct:   72 QHYEDSDFSWSKEVQVNLCNIFQLSKFRPLQRAAINLSMSGKDLFLVMPTGRGKSLCYQLPALCSKGFTLVIAPLVSLMEDQLMYLQSVNVPAVTLNASSSKEDSKRILAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAFNMGLLARIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPNVPLIGLTATATSNVLKDCQKILCVQEPVTLTAP-FNRPNLYYEVRFKDNEDCT-DQIASLIRGRYKNQSGIVYVFSQKDAEVVATELQKRDIVAQPYHANMEPSHKSLVHQRWSSKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDSPADCIVFFGFMDIFRISTMVVMENTGQQKLHNMVAYCQNVDRQRRAMMAIHFDEVWNDEECNEMCDVCRHG-NDYITMDITQHARDVLHIVE-LASSMDEKLTPLKVCDAWLGKGPAKQRKMIKLTSLSR-------LEVESVIIHLLLHGYFSEDFSFTPYTTHFYLKLGRKAALLKNSGHSITMKMRRRGTSQSTVKKV--SESSGEK 613          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: recql (RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-050809-134])

HSP 1 Score: 335.495 bits (859), Expect = 7.355e-105
Identity = 202/582 (34.71%), Postives = 315/582 (54.12%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQ------------------------DYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISEL-----ANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVK 1887
            + Y   +F WS  ++  L + F++  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +   +  ++L+++SS +    I   M TD   N  +KL+Y TP+KI+ SK L   +EKA+    L R+ +DE+HCCS+  HDFR                         DYK L  LK  +PN+P++GLTATA ++V+ D +  L +     +    +NR N++YEV+F  NE    ++I  LI+ R+  QSGIV+ F+QKD E +  EL    I+A  Y+  +    K  +H +W ++  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+   + F+I + +  E +G   L+ M  Y  +   C+R  ++   DE +   +C  MC VC    ++  ++DI    +  L I++ +  + + K+T  K+         A Q  +      +R       L ++    HL+L GY   D+SF  ++   Y+  G K  L  N    I +++ +    ++ V+ V  +ESS  K
Sbjct:   72 QHYEDSDFSWSKEVQVNLCNIFQLSKFRPLQRAAINLSMSGKDLFLVMPTGRGKSLCYQLPALCSKGFTLVIAPLVSLMEDQLMYLQSVNVPAVTLNASSSKEDSKRILAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAFNMGLLARIAVDEVHCCSQWGHDFRPGEILFYLDRVKLLNPKLTMLFFSLDYKLLGILKRQFPNVPLIGLTATATSNVLKDCQKILCVQEPVTLTAP-FNRPNLYYEVRFKDNEDCT-DQIASLIRGRYKNQSGIVYVFSQKDAEVVATELQKRDIVAQPYHANMEPSHKSLVHQRWSSKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDSPADCIVFFGFMDIFRISTMVVMENTGQQKLHNMVAYCQNVDRCRRAMMAIHFDEVWNDEECNEMCDVCRHG-NDYITMDITQHARDVLHIVE-LASSMDEKLTPLKVCDAWLGKGPAKQRKMIKLTSLSR-------LEVESVIIHLLLHGYFSEDFSFTPYTTHFYLKLGRKAALLKNSGHSITMKMRRRGTSQSTVKKV--SESSGEK 637          
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Match: blm (BLM RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-070702-5])

HSP 1 Score: 297.36 bits (760), Expect = 4.834e-86
Identity = 178/456 (39.04%), Postives = 249/456 (54.61%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKN----MCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKN 1572
            NFP S  + K+   KF +  F+  QL+ INA+L   D   +   G GKSLCYQL + +S G T+VI+PL SLI DQ+       I   SL  +        I+  +   DP      KL+Y TP+K+  S ++  A++  Y    L RLVIDE HC S+  HDFR DYK LH L+ ++PN+P++ LTATA   V  DI   L +     V   ++NR+N+ Y V      KK  EE  + IK  +   SGIV+C ++ DC+ L + L   GI A +Y+  L    ++ + NKW+N++ C+V+ AT AFGMGIDKP+VR+VIH S+ KS+E YYQESGRAGRDG+ S C+LF+  ++  +I   I  +K G        I NL+ M  +  +   C+R+ L +   E  F  + CK     +C  CA      S     DV K A  +  N EK  N
Sbjct:  659 NFPHSPEMMKIFHKKFGLHQFRFNQLEAINASLLGEDTFVLMPTGGGKSLCYQLPACVSAGVTVVISPLRSLIVDQVQKLTTLDICATSLSGDKKDSEAARIYMQLSRKDPA----IKLLYATPEKVCASGRMISALQNLYERGLLARLVIDEAHCVSQWGHDFRPDYKRLHELRRMFPNVPIMALTATATPRVQKDILNQLAMTRP-QVFTMSFNRNNLKYSV-LPKKPKKVDEECIQWIKKYYPRDSGIVYCLSRNDCDTLADSLQRAGIAALAYHAGLSDSDREYVQNKWINQDGCQVMCATIAFGMGIDKPDVRYVIHASLPKSVEGYYQESGRAGRDGEISHCVLFYSYSDVIRIKRLIAMDKDGNQQSKATHINNLHSMVHFCENVAECRRIQLLAYFGEHTFNTSFCKEHPEVICDNCARPNKYKSRNVTDDVKKIARFVQDNCEKVGN 1108          
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:549070])

HSP 1 Score: 369.392 bits (947), Expect = 5.827e-118
Identity = 221/615 (35.93%), Postives = 343/615 (55.77%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQL-----------SISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLF----LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT--LKSNE-KIDIPIRI----AKSDKMRNLVQNVKQNESSNV 1884
            +   + A++ +++ L   +++LI++K+ L              T      S +++ KE+F WS  I+  L + F++++F+SLQL+TINAT+   D   I   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ G+S  SL+++SS +    +   M      N   KL+Y TP+KI+ SK     +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN P++GLTATA   V+ D +  L +    L    ++NR N+FYEV+   +  ++   +I KLI SR+ GQSGI++CF+QKD E++T  L   GI A +Y+  +    K  +H KW     +++VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRA        CI  W+     ++ S +  E  G   L  M  Y      C+RV ++   DE +    C  MC  C ++E      DI    +  + I++   +  + K+T  K++     +     A L  R PG+         +++   HL+L  +L+ D+SF +++  +Y+  G K   L+S++  I +P+R     A +DK+++  Q+  Q+ +  V
Sbjct:   17 VSSELQAVEIQLQELLERQQELIQRKRLLNKKIQRLSEDSGPGTSAGGGDSAENWQKEDFLWSQKIRDALCNSFQLRSFRSLQLETINATMAGRDVFLIMPTGGGKSLCYQLPAVCSDGFTLVICPLVSLMEDQLMVLDRLGVSATSLNASSSKEHVKWVHGEMTNK---NSRLKLLYVTPEKIAKSKLFMSRLEKAYQAGLLARVAVDEVHCCSQWGHDFRPDYKTLGILKRQFPNSPLIGLTATATTHVLKDAQKILCVPKP-LTFTASFNRPNLFYEVRLKPSSSQDFIADIVKLINSRYRGQSGIIYCFSQKDSEHVTMSLQKLGIRAGTYHANMEPRDKTKVHTKWTANEIQIVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRA------VLCI-DWRPPSSLRLSSMVVMENVGQKKLYEMVGYCQSPDRCRRVLIAQHFDEVWDSAKCNKMCDNC-NSEGGWEKADITPYCRDIVKILEQANQM-DEKLTPLKLMDAWVGK---GVAKL--RVPGVRPPQLPRPEIERIIAHLLLQQFLREDFSFTAYATISYIKRGPKVDLLRSDKYAICLPMRSGGAGAGADKVKSPQQSTSQSLAPKV 613          
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:549070])

HSP 1 Score: 365.54 bits (937), Expect = 3.014e-117
Identity = 220/597 (36.85%), Postives = 334/597 (55.95%), Query Frame = 1
Query:  133 IDNEIKTLTHEKEDLIKKKKQL-----------SISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTK--NPKITGKKIISELANQMSLYFADLANRFPGIDYKLF----LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT--LKSNE-KIDIPIRI----AKSDKMRN 1845
            ++ +++ L   +++LI++K+ L              T      S +++ KE+F WS  I+  L + F++++F+SLQL+TINAT+   D   I   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ G+S  SL+++SS +    +   M      N   KL+Y TP+KI+ SK     +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN P++GLTATA   V+ D +  L +    L    ++NR N+FYEV+   +  ++   +I KLI SR+ GQSGI++CF+QKD E++T  L   GI A +Y+  +    K  +H KW     +++VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRA        CI  W+     ++ S +  E  G   L  M  Y      C+RV ++   DE +    C  MC  C       +S + AD+      I+K +E+    + K+T  K++     +     A L  R PG+         +++   HL+L  +L+ D+SF +++  +Y+  G K   L+S++  I +P+R     A +DK+R 
Sbjct:    1 VEIQLQELLERQQELIQRKRLLNKKIQRLSEDSGPGTSAGGGDSAENWQKEDFLWSQKIRDALCNSFQLRSFRSLQLETINATMAGRDVFLIMPTGGGKSLCYQLPAVCSDGFTLVICPLVSLMEDQLMVLDRLGVSATSLNASSSKEHVKWVHGEMTNK---NSRLKLLYVTPEKIAKSKLFMSRLEKAYQAGLLARVAVDEVHCCSQWGHDFRPDYKTLGILKRQFPNSPLIGLTATATTHVLKDAQKILCVPKP-LTFTASFNRPNLFYEVRLKPSSSQDFIADIVKLINSRYRGQSGIIYCFSQKDSEHVTMSLQKLGIRAGTYHANMEPRDKTKVHTKWTANEIQIVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRA------VLCI-DWRPPSSLRLSSMVVMENVGQKKLYEMVGYCQSPDRCRRVLIAQHFDEVWDSAKCNKMCDNC-------NSWEKADITPYCRDIVKILEQANQMDEKLTPLKLMDAWVGKG---VAKL--RVPGVRPPQLPRPEIERIIAHLLLQQFLREDFSFTAYATISYIKRGPKVDLLRSDKYAICLPMRSGGAGAGADKVRG 574          
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:549070])

HSP 1 Score: 363.614 bits (932), Expect = 2.777e-116
Identity = 210/574 (36.59%), Postives = 320/574 (55.75%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQL-----------SISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLF----LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT 1782
            +   + A++ +++ L   +++LI++K+ L              T      S +++ KE+F WS  I+  L + F++++F+SLQL+TINAT+   D   I   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ G+S  SL+++SS +    +   M      N   KL+Y TP+KI+ SK     +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN P++GLTATA   V+ D +  L +    L    ++NR N+FYEV+   +  ++   +I KLI SR+ GQSGI++CF+QKD E++T  L   GI A +Y+  +    K  +H KW     +++VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRA        CI  W+     ++ S +  E  G   L  M  Y      C+RV ++   DE +    C  MC  C ++E      DI    +  + I++   +  + K+T  K++     +     A L  R PG+         +++   HL+L  +L+ D+SF +++  +Y+  G K 
Sbjct:   14 VSSELQAVEIQLQELLERQQELIQRKRLLNKKIQRLSEDSGPGTSAGGGDSAENWQKEDFLWSQKIRDALCNSFQLRSFRSLQLETINATMAGRDVFLIMPTGGGKSLCYQLPAVCSDGFTLVICPLVSLMEDQLMVLDRLGVSATSLNASSSKEHVKWVHGEMTNK---NSRLKLLYVTPEKIAKSKLFMSRLEKAYQAGLLARVAVDEVHCCSQWGHDFRPDYKTLGILKRQFPNSPLIGLTATATTHVLKDAQKILCVPKP-LTFTASFNRPNLFYEVRLKPSSSQDFIADIVKLINSRYRGQSGIIYCFSQKDSEHVTMSLQKLGIRAGTYHANMEPRDKTKVHTKWTANEIQIVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRA------VLCI-DWRPPSSLRLSSMVVMENVGQKKLYEMVGYCQSPDRCRRVLIAQHFDEVWDSAKCNKMCDNC-NSEGGWEKADITPYCRDIVKILEQANQM-DEKLTPLKLMDAWVGKG---VAKL--RVPGVRPPQLPRPEIERIIAHLLLQQFLREDFSFTAYATISYIKRGPKV 569          
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:549070])

HSP 1 Score: 363.229 bits (931), Expect = 2.859e-116
Identity = 216/584 (36.99%), Postives = 328/584 (56.16%), Query Frame = 1
Query:  133 IDNEIKTLTHEKEDLIKKKKQL-----------SISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTK--NPKITGKKIISELANQMSLYFADLANRFPGIDYKLF----LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT--LKSNE-KIDIPIR 1818
            ++ +++ L   +++LI++K+ L              T      S +++ KE+F WS  I+  L + F++++F+SLQL+TINAT+   D   I   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ G+S  SL+++SS +    +   M      N   KL+Y TP+KI+ SK     +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +PN P++GLTATA   V+ D +  L +    L    ++NR N+FYEV+   +  ++   +I KLI SR+ GQSGI++CF+QKD E++T  L   GI A +Y+  +    K  +H KW     +++VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRA        CI  W+     ++ S +  E  G   L  M  Y      C+RV ++   DE +    C  MC  C       +S + AD+      I+K +E+    + K+T  K++     +     A L  R PG+         +++   HL+L  +L+ D+SF +++  +Y+  G K   L+S++  I +P+R
Sbjct:    1 VEIQLQELLERQQELIQRKRLLNKKIQRLSEDSGPGTSAGGGDSAENWQKEDFLWSQKIRDALCNSFQLRSFRSLQLETINATMAGRDVFLIMPTGGGKSLCYQLPAVCSDGFTLVICPLVSLMEDQLMVLDRLGVSATSLNASSSKEHVKWVHGEMTNK---NSRLKLLYVTPEKIAKSKLFMSRLEKAYQAGLLARVAVDEVHCCSQWGHDFRPDYKTLGILKRQFPNSPLIGLTATATTHVLKDAQKILCVPKP-LTFTASFNRPNLFYEVRLKPSSSQDFIADIVKLINSRYRGQSGIIYCFSQKDSEHVTMSLQKLGIRAGTYHANMEPRDKTKVHTKWTANEIQIVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRA------VLCI-DWRPPSSLRLSSMVVMENVGQKKLYEMVGYCQSPDRCRRVLIAQHFDEVWDSAKCNKMCDNC-------NSWEKADITPYCRDIVKILEQANQMDEKLTPLKLMDAWVGKG---VAKL--RVPGVRPPQLPRPEIERIIAHLLLQQFLREDFSFTAYATISYIKRGPKVDLLRSDKYAICLPMR 561          
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Match: blm (Bloom syndrome RecQ like helicase [Source:NCBI gene;Acc:100124311])

HSP 1 Score: 273.863 bits (699), Expect = 3.057e-79
Identity = 163/448 (36.38%), Postives = 242/448 (54.02%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDE-KFTVNDCKNMCSVCADT---ESEMSSIDIADVYKSALTIIK 1551
            NFP S  + K+   KF +  F++ QL+ INA L   DC  +   G GKSLCYQL   +S G T+VI+PL SLI DQ+       I    L  + +      I+  + + DP+     KL+Y TP+K+  S +L   +E  Y  + L R VIDE HC S+  HDFR DYK L+ L+  + ++P++ LTATAN  V  DI   L +     +   ++NR N+ Y+V      K+   +  + IK      SGI++C ++ +C+ + + L   G+ A +Y+  L    +  + +KW+N++ C+VI AT AFGMGIDKP+VR+VIH S+ KS+E YYQESGRAGRDG+ S C+LF+  ++  +I   I  EK G          NL  M  Y  +   C+R+ L +   E  F  N CK    V  D      E  S ++ D  ++ +  ++
Sbjct:  381 NFPHSKEMMKIFHKKFGLHRFRTNQLEAINACLLGEDCFILMPTGGGKSLCYQLPGCVSPGVTIVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDAEAASIYLQLSKKDPI----IKLLYVTPEKVCASTRLISTMENLYERQLLARFVIDEAHCVSQWGHDFRPDYKRLNMLRQKFQSVPMMALTATANPRVQKDILNQLKMTKP-QIFTMSFNRDNLKYDV-LPKKPKRVALDCVEWIKKYHPNDSGIIYCLSRHECDTMADTLQKGGLAALAYHAGLADSNRDYVQHKWINQDDCQVICATIAFGMGIDKPDVRYVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYSYSDVTRIRRLIQMEKDGNSHTKQTHFNNLYSMVHYCENVVECRRMQLLAYFGENNFNPNFCKENTRVSCDNCLGRKEFKSRNVTDDVRNIVRFVQ 822          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: Recql (RecQ protein-like [Source:MGI Symbol;Acc:MGI:103021])

HSP 1 Score: 412.149 bits (1058), Expect = 1.166e-134
Identity = 239/607 (39.37%), Postives = 352/607 (57.99%), Query Frame = 1
Query:  130 AIDNEIKTLTHEKEDLIKKKKQLSISTKGHSI-----------TSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKE-GEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMC-SVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDK--MRNLVQNVKQNESSNVK 1887
            AID +I+ LT  +++L+++K  L+   K +             TS   + KE+FPW   +K +LQ+ FK++ F+ LQL+TIN T+ + D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY   RL    +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D++  L +   CL    ++NR N+FYEV+   +  ++  E+I KLI  R+ GQSGI++CF+QKD E +T  L   GI A +Y+  +  + K  +H +W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  R+DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +  + C  MC + C D   E    ++    +  + I+K  E   N K+T  K+I     + +  L  A  +A   P  D    L++   H +L  YLK DYSF +++  +Y+  G +  L SNE   + +++ KS +  +R  +   +Q E  + K
Sbjct:   20 AIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKEDFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLMGLTATATNHVLKDVQKILCVGK-CLTFTASFNRPNLFYEVRQKPSSAEDFTEDIVKLINGRYKGQSGIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSKCRRVLIAQHFDEVWNADACNKMCDNCCKDVSFEKK--NVTQHCRDLIKILKQAEGL-NEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED----LERIVAHALLQQYLKEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVRGALSEARQVEQVDSK 614          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: Recql (RecQ protein-like [Source:MGI Symbol;Acc:MGI:103021])

HSP 1 Score: 411.764 bits (1057), Expect = 1.631e-134
Identity = 239/607 (39.37%), Postives = 352/607 (57.99%), Query Frame = 1
Query:  130 AIDNEIKTLTHEKEDLIKKKKQLSISTKGHSI-----------TSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKE-GEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMC-SVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDK--MRNLVQNVKQNESSNVK 1887
            AID +I+ LT  +++L+++K  L+   K +             TS   + KE+FPW   +K +LQ+ FK++ F+ LQL+TIN T+ + D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY   RL    +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D++  L +   CL    ++NR N+FYEV+   +  ++  E+I KLI  R+ GQSGI++CF+QKD E +T  L   GI A +Y+  +  + K  +H +W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  R+DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +  + C  MC + C D   E    ++    +  + I+K  E   N K+T  K+I     + +  L  A  +A   P  D    L++   H +L  YLK DYSF +++  +Y+  G +  L SNE   + +++ KS +  +R  +   +Q E  + K
Sbjct:   20 AIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKEDFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLMGLTATATNHVLKDVQKILCVGK-CLTFTASFNRPNLFYEVRQKPSSAEDFTEDIVKLINGRYKGQSGIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSKCRRVLIAQHFDEVWNADACNKMCDNCCKDVSFEKK--NVTQHCRDLIKILKQAEGL-NEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED----LERIVAHALLQQYLKEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVRGALSEARQVEQVDSK 614          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: Recql (RecQ protein-like [Source:MGI Symbol;Acc:MGI:103021])

HSP 1 Score: 412.149 bits (1058), Expect = 1.732e-134
Identity = 239/607 (39.37%), Postives = 352/607 (57.99%), Query Frame = 1
Query:  130 AIDNEIKTLTHEKEDLIKKKKQLSISTKGHSI-----------TSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKE-GEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMC-SVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDK--MRNLVQNVKQNESSNVK 1887
            AID +I+ LT  +++L+++K  L+   K +             TS   + KE+FPW   +K +LQ+ FK++ F+ LQL+TIN T+ + D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY   RL    +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D++  L +   CL    ++NR N+FYEV+   +  ++  E+I KLI  R+ GQSGI++CF+QKD E +T  L   GI A +Y+  +  + K  +H +W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  R+DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +  + C  MC + C D   E    ++    +  + I+K  E   N K+T  K+I     + +  L  A  +A   P  D    L++   H +L  YLK DYSF +++  +Y+  G +  L SNE   + +++ KS +  +R  +   +Q E  + K
Sbjct:   20 AIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKEDFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLMGLTATATNHVLKDVQKILCVGK-CLTFTASFNRPNLFYEVRQKPSSAEDFTEDIVKLINGRYKGQSGIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSKCRRVLIAQHFDEVWNADACNKMCDNCCKDVSFEKK--NVTQHCRDLIKILKQAEGL-NEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED----LERIVAHALLQQYLKEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVRGALSEARQVEQVDSK 614          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: Blm (Bloom syndrome, RecQ like helicase [Source:MGI Symbol;Acc:MGI:1328362])

HSP 1 Score: 296.975 bits (759), Expect = 7.880e-86
Identity = 171/449 (38.08%), Postives = 249/449 (55.46%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSN-SSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNE-NCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEK 1563
            NFP +  + K+   KF + NF++ QL+ INA L   DC  +   G GKSLCYQL + +S G T+VI+PL SLI DQ+     F I    L  + +  +  N   +  + DP+     KL+Y TP+K+  S +L   +E  Y  K L R VIDE HC S+  HDFRQDYK ++ L+  +P++PV+ LTATAN  V  DI T L +     V   ++NR N+ Y V      KK   +  + I+      SGI++C ++++C+ + + L   G+ A +Y+  L    + ++ +KW+N+ NC+VI AT AFGMGIDKP+VRFVIH S+ KS+E YYQESGRAGRDG+ S C+LF+   +  ++   I  EK G        + NL  M  Y  +   C+R+ L +   EK F  + CK    V  D   +       DV      II+ +++
Sbjct:  659 NFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIVDQVQKLTSFDIPATYLTGDKTDSEAANIYLQLSKKDPI----IKLLYVTPEKVCASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP-QVFSMSFNRHNLKYYV-LPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQREGLAALAYHAGLSDSARDEVQHKWINQDNCQVICATIAFGMGIDKPDVRFVIHASLPKSMEGYYQESGRAGRDGEISHCVLFYTYHDVTRLKRLIMMEKDGNYHTKETHVNNLYSMVHYCENITECRRIQLLAYFGEKGFNPDFCKKYPDVSCDNCCKTKDYKTKDVTDDVKNIIRFVQE 1101          
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Match: Blm (Bloom syndrome, RecQ like helicase [Source:MGI Symbol;Acc:MGI:1328362])

HSP 1 Score: 296.59 bits (758), Expect = 8.571e-86
Identity = 171/449 (38.08%), Postives = 249/449 (55.46%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSN-SSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNE-NCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEK 1563
            NFP +  + K+   KF + NF++ QL+ INA L   DC  +   G GKSLCYQL + +S G T+VI+PL SLI DQ+     F I    L  + +  +  N   +  + DP+     KL+Y TP+K+  S +L   +E  Y  K L R VIDE HC S+  HDFRQDYK ++ L+  +P++PV+ LTATAN  V  DI T L +     V   ++NR N+ Y V      KK   +  + I+      SGI++C ++++C+ + + L   G+ A +Y+  L    + ++ +KW+N+ NC+VI AT AFGMGIDKP+VRFVIH S+ KS+E YYQESGRAGRDG+ S C+LF+   +  ++   I  EK G        + NL  M  Y  +   C+R+ L +   EK F  + CK    V  D   +       DV      II+ +++
Sbjct:  656 NFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIVDQVQKLTSFDIPATYLTGDKTDSEAANIYLQLSKKDPI----IKLLYVTPEKVCASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP-QVFSMSFNRHNLKYYV-LPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQREGLAALAYHAGLSDSARDEVQHKWINQDNCQVICATIAFGMGIDKPDVRFVIHASLPKSMEGYYQESGRAGRDGEISHCVLFYTYHDVTRLKRLIMMEKDGNYHTKETHVNNLYSMVHYCENITECRRIQLLAYFGEKGFNPDFCKKYPDVSCDNCCKTKDYKTKDVTDDVKNIIRFVQE 1098          
BLAST of ATP-dependent DNA helicase vs. UniProt/SwissProt
Match: sp|Q6AYJ1|RECQ1_RAT (ATP-dependent DNA helicase Q1 OS=Rattus norvegicus OX=10116 GN=Recql PE=1 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.706e-134
Identity = 228/590 (38.64%), Postives = 346/590 (58.64%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQLSISTK-----------GHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDK 1836
            +   + A+D +I+ LT  + +L+++K  L+   K           G   TS   + KE+FPWS  +K +L+D FK++ F+ LQL+T+NAT+ + D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+S+SS     E  K + T+ ++ N   KLIY TP+KI+ SK     +EKAY   RL  + +DE+HCCS+  HDFR DYK L  LK  +PN+ ++GLTATA N V+ D +  L +   CL    ++NR N++YEV+   +  ++  E I  LI  R+ G+SGI++CF+QKD E +T  L   G+ A +Y+  +  + +  +H +W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  R+DCIL++   + F+I S +  E  G   L  M  Y  +   C+R  ++   DE +  + C  MC  C   +S     +I +  ++ + I+K  E   N K+T  K+I     + +  F       P +  +  L+K   H +L  YLK DYSF +++  +Y+  G + +L SNE   + +++ +S +
Sbjct:   14 VSSELHAVDIQIQELTERQHELLQRKSVLTKRIKQCLEDSAAEASGDCDTSPAAWSKEDFPWSGKVKHVLRDVFKLQKFRPLQLETVNATMARKDIFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLQQLGISATMLNSSSS----KEHVKCVHTEMMNKNSHLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGVAVDEVHCCSQWGHDFRPDYKALGILKRQFPNISLIGLTATATNHVLKDAQKILCVEK-CLTFTASFNRPNLYYEVRQKPSSAEDFIENIANLINGRYKGKSGIIYCFSQKDSEQVTISLQKLGVRAGTYHANMEPEDRTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDWRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRALIAQHFDEVWNADACNKMCDNCCKDDS-FEKKNITEHCQALIKILKQAEGL-NEKLTPLKLIDAWMGKGAAKFRVAGVAVPALP-REDLEKIIVHALLQQYLKEDYSFTAYATISYLKVGPRASLLSNEGHAVTMQVKRSTQ 595          
BLAST of ATP-dependent DNA helicase vs. UniProt/SwissProt
Match: sp|Q9Z129|RECQ1_MOUSE (ATP-dependent DNA helicase Q1 OS=Mus musculus OX=10090 GN=Recql PE=1 SV=2)

HSP 1 Score: 412.149 bits (1058), Expect = 1.211e-133
Identity = 239/607 (39.37%), Postives = 352/607 (57.99%), Query Frame = 1
Query:  130 AIDNEIKTLTHEKEDLIKKKKQLSISTKGHSI-----------TSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKE-GEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMC-SVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDK--MRNLVQNVKQNESSNVK 1887
            AID +I+ LT  +++L+++K  L+   K +             TS   + KE+FPW   +K +LQ+ FK++ F+ LQL+TIN T+ + D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY   RL    +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D++  L +   CL    ++NR N+FYEV+   +  ++  E+I KLI  R+ GQSGI++CF+QKD E +T  L   GI A +Y+  +  + K  +H +W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  R+DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +  + C  MC + C D   E    ++    +  + I+K  E   N K+T  K+I     + +  L  A  +A   P  D    L++   H +L  YLK DYSF +++  +Y+  G +  L SNE   + +++ KS +  +R  +   +Q E  + K
Sbjct:   20 AIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAEASSDLDTSPAAWNKEDFPWFGKVKDVLQNVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSQLKLIYVTPEKIAKSKMFMSRLEKAYEAGRLTGAAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLMGLTATATNHVLKDVQKILCVGK-CLTFTASFNRPNLFYEVRQKPSSAEDFTEDIVKLINGRYKGQSGIIYCFSQKDSEQITISLQKLGIHAGTYHANMEPEDKTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNVSKCRRVLIAQHFDEVWNADACNKMCDNCCKDVSFEKK--NVTQHCRDLIKILKQAEGL-NEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPRED----LERIVAHALLQQYLKEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKKSAQSSVRGALSEARQVEQVDSK 614          
BLAST of ATP-dependent DNA helicase vs. UniProt/SwissProt
Match: sp|P46063|RECQ1_HUMAN (ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3)

HSP 1 Score: 408.683 bits (1049), Expect = 2.299e-132
Identity = 246/609 (40.39%), Postives = 353/609 (57.96%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQ--------LSISTKGHS---ITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNV 1884
            I   + A++ +I+ LT  +++LI+KKK         L  S  G S    +S   + KE+FPWS  +K +LQ+ FK++ F+ LQL+TIN T+   +   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY  +R  R+ +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D +  L +   C     ++NR N++YEV+   SN +   E+I KLI  R+ GQSGI++CF+QKD E +T  L N GI A +Y+  L  + K  +H KW     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  ++DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +    C  MC  C   +S     +I +  +  + I+K  E+  N K+T  K+I     + +  L  A  +A   P  D    L+K   H ++  YLK DYSF +++  +Y+  G K  L +NE   I +++ KS       QN  + ESS  
Sbjct:   14 ITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEK-CFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCK-DSAFERKNITEYCRDLIKILKQAEEL-NEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRED----LEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKS------TQNSFRAESSQT 605          
BLAST of ATP-dependent DNA helicase vs. UniProt/SwissProt
Match: sp|Q5RF63|RECQ1_PONAB (ATP-dependent DNA helicase Q1 OS=Pongo abelii OX=9601 GN=RECQL PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.855e-131
Identity = 240/593 (40.47%), Postives = 347/593 (58.52%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQ--------LSISTKGHS---ITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDK 1836
            I   + A++ +I+ LT  +E+LI+KKK         L  S  G S    +S   + KE+FPWS  +K +LQ+ FK++ F+ LQL+TIN T+   +   +   G GK LCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KLIY TP+KI+ SK     +EKAY  +R  R+ +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D +  L +   C     ++NR N++YEV+   SN +   E+I KLI  R+ GQSGI++CF+QKD E +T  L N GI A +Y+  L  + K  +H KW     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  ++DCIL++   + F+I S +  E  G   L  M  Y  +   C+R+ ++   DE +    C  MC  C   +S     +I +  +  + I+K  E+  N K+T  K+I     + +  L  A  +A   P  D    L+K   H ++  YLK DYSF +++  +Y+  G K  L +NE   I +++ KS +
Sbjct:   14 ITSELHAVEIQIQELTERQEELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNKEDFPWSGKVKDVLQNVFKLQKFRPLQLETINVTMAGKEVFLVMPTGGGKGLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEK-CFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLRNLGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRLLMAQHFDEVWNSEACNKMCDNCCK-DSAFERKNITEYCRDLIKILKQAEEL-NEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRED----LEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQ 595          
BLAST of ATP-dependent DNA helicase vs. UniProt/SwissProt
Match: sp|Q9TXJ8|RECQ1_CAEEL (Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans OX=6239 GN=K02F3.12 PE=3 SV=3)

HSP 1 Score: 402.134 bits (1032), Expect = 5.877e-130
Identity = 230/610 (37.70%), Postives = 357/610 (58.52%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKK----KQLSISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDN--VTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEV-KFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCAD-----TESEMSSIDIADVYKSALTIIK---NIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKK 1890
            ++D  I  ID +I  L  +K +L +K+    +++ + T   S      + ++ FPWS    K+L+++F ++ F+ LQ   INA + K D + I S G GKSLCYQL ++++ G  LV++PL SL++DQ++     GI   SL++N+S     E  K +E D + N    ++L+Y TP+K++ SKK+   +EK+     L  + IDE+HCCS+  HDFR DY  L+ LK  +  +P+LGLTATA ++V++D+K  L + +  L  +  +NRSN+ Y+V +   +E +  EEI K IK  F GQ+GI++C ++ DCE +   L ++GI A  Y+  +    +   H  W++   +VIVAT AFGMGIDKPNVRFVIH S+ KS+ENYYQESGRAGRDG+ + CIL+++LA+ FK  S +  E++GI NL  M RY  D  TC+RV L+   +E +  + C+  C  C +       S   S D+++  K+ + II+   N  K  + +ITG K++ EL          L  +  G   + F +K   +L+L GYL+ D+ +  +S  +YV+ GSK    N K  I +R  +  K R      K+  SS+V++
Sbjct:   38 DLDGEIGQIDQQISQLRRKKSELTQKRQAIERKIELKTNEDSDVVTDRWDRDGFPWSDEATKILKEQFHLEKFRPLQRAAINAVMSKEDAVVILSTGGGKSLCYQLPALLANGLALVVSPLISLVEDQILQLRSLGIDSSSLNANTS----KEEAKRVE-DAITNKDSKFRLLYVTPEKLAKSKKMMNKLEKSLSVGFLKLIAIDEVHCCSQWGHDFRTDYSFLNVLKRQFKGVPILGLTATATSNVLDDVKDMLGIQA-ALTFRAGFNRSNLKYKVVQKPGSEDECTEEIAKTIKRDFAGQTGIIYCLSRNDCEKVAKALKSHGIKAKHYHAYMEPVDRSGAHQGWISGKIQVIVATVAFGMGIDKPNVRFVIHHSLPKSIENYYQESGRAGRDGQPATCILYYRLADIFKQSSMVQQERTGIQNLYNMVRYAADSSTCRRVKLAEHFEEAWEPSWCQKQCDTCENGNGFVGTSSKESTDVSEAAKTTVRIIEEHLNSAKDGSGRITGNKLV-EL----------LTKKLKGSRNREFCEKLIVNLLLEGYLQEDFHYTVYSVISYVVIGSKWRVYNGKDAIKMRHVEESKSR------KRKASSSVEE 624          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: E9G2Y5 (ATP-dependent DNA helicase OS=Daphnia pulex OX=6669 GN=RecQ1 PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 9.329e-135
Identity = 221/583 (37.91%), Postives = 355/583 (60.89%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQLSISTKGHSIT--SNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELAN--QMSLYFADL--ANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDK 1836
            ID  +  ++ +I  L   K  L+K+K+ L       +    +++D+   +FPW+  + + L+D F I+ F+ +QL  +NATL   D I I   G GKSLCYQL +++S G TLVI PL SL++DQ+   EK GI    L+++SS +  N +  AM TD   ++  KL+Y TP+K++ SK+    ++K Y  KR   + +DE+HCCS+  HDFR DYK L  L+SL+P +P++GLTATA  +V ND++  LN+  + LV K ++NR N++YEV+   + +KE  +E+ +L+ +RF GQSGI++  + KDC+ L +EL       +SY+ +L    + ++H  W     + +VAT AFGMGIDKP+VRFVIH S+SKS+EN+YQESGRAGRD  ++ CI++W+L++ F++ + +FTE++G+ NL  M  Y LD   C+R  ++S  DE++  + C  MC  C+  +S  + I+I +   +   I++  E+ +  ++T +K+I    N  Q+SL   D   A + P    +  L     H +L GYLK D+ F  +S  +Y++ G +    N++I + +  +  D+
Sbjct:   13 IDAELRIVEEDIDKLQERKTTLLKRKQALKEKANEEATKKLASQDWESNDFPWTKKLYQTLKDAFHIEKFRPMQLSAMNATLKGHDVILIMPTGGGKSLCYQLPALVSDGITLVITPLVSLMEDQLASLEKLGIEAAKLNASSSKEEVNMVHLAM-TDAKSSL--KLLYVTPEKLAKSKRFMTKLQKMYQIKRFACVAVDEVHCCSQWGHDFRPDYKYLGVLRSLFPTVPIVGLTATATLNVTNDVQKMLNMK-NSLVFKASFNRPNLYYEVRIKPSTQKECIDELVQLLTNRFHGQSGIIYTTSVKDCDQLASELRQQKCRVASYHASLEPADRTEVHTGWRENRYQAVVATIAFGMGIDKPDVRFVIHHSISKSMENFYQESGRAGRDDLQACCIVYWRLSDLFRLSTMVFTEQTGLRNLYAMAAYCLDPERCRREIIASHFDERWESSSCNKMCDHCSK-DSTSAEINIVEHLTTLRQILERAEE-QQVRVTAQKLIDAWQNTGQVSLRLPDFKKAAKLPRDKCESIL----AHFLLEGYLKEDFHFTPYSTISYLLLGERAHFINKEITMKVEASSVDE 585          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: J3S495 (ATP-dependent DNA helicase OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 6.572e-134
Identity = 225/576 (39.06%), Postives = 341/576 (59.20%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQL--------------SISTKGHSI---TSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEG-EEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS-LYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK 1779
            + + +V++DNE++ L  + ++L++ ++QL              S +  G S    ++ +D+ KE+FPWS+ I+ +LQ  F ++NF+ LQL+TINAT+   D   +   G GKSLCYQL +  S GFTLVI PL SL++DQ+++ E+ G+S   L+++SS +    +   M +    N   KL+Y TP+KI+ SK     +EKAY   +L R+ +DE+HCCS+  HDFR DYK L  LK  +PN P++GLTATA   V+ D +  L +   C++   ++NR N++YEV+   +  +   E+I KLI  R+ G SGI++CF+QKD E +T  L   GI A +Y+  +    K  +H +W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD +R+DCIL++   + F+I + +  E  G   L  M  Y  D   C+RV ++   DE +    C  MC  C   E+ +  +D+A+  +  L I++ +++ K      K I + L   +S L     A R P    +  L++   HL+L  YLK D+SF +F+  +YV  G +
Sbjct:    8 LQEELVSVDNELQALEIQIQELLEHQQQLIQKKTVLKKKITHFSDTESGSSKETESATEDWNKEDFPWSTKIRDVLQKSFGLQNFRPLQLETINATMAGRDVFLVMPTGGGKSLCYQLPAEGSPGFTLVICPLISLMEDQLMMLEQLGVSATLLNASSSKEHVKWVHAEMLSR---NSQLKLLYVTPEKIAKSKMFMSKLEKAYQTGQLTRIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPNAPLIGLTATATGHVLRDAQNILCV-PKCIIFTASFNRPNLYYEVRQKPSSAQNCIEDIVKLINGRYKGLSGIIYCFSQKDAEQVTMSLQKLGIKAGTYHANMEPKDKSRVHKRWCANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDQRADCILYYGFGDIFRISTMVVMENVGQQKLYGMVSYCHDMGRCRRVQIAHHFDEAWDSASCNKMCDNCCQEET-LEKMDVAEHCRDLLKILEQVDQRKEKFTPLKLIDAWLGKGLSKLGLEIAAPRLP----REVLERIVAHLILQQYLKEDFSFTAFATISYVKIGPR 574          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: A0A091T4B1 (ATP-dependent DNA helicase (Fragment) OS=Phaethon lepturus OX=97097 GN=N335_01061 PE=3 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 7.639e-134
Identity = 246/609 (40.39%), Postives = 360/609 (59.11%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQLSISTKGHS-----------ITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKS 1893
            I+  + A++ +I+ L  ++++LI+KK ++    K  S            TS + + K++FPW   IK +LQ KFK++ F+SLQL+TINA L   D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V E+ GIS   L+++SS     E  K + T+ +D N   KLIY TP+KI+ SK     +EKAY    L R+ +DE+HCCS+  HDFR DYK+L  LK  +PN P++GLTATA N V+ D +  L++  +C+    ++NR N++YEV+   SN +   E+I K++  R+ G SGIV+CF+QKD E +T  L   GI A +Y+  +    K  +H  W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD +++DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +   +C  MC  C   E+    +DI   YK  + I++  E   + K+T  K+I   + +    F  +A   P    +  L++   HL+L  YLK D+SF +F+  +Y+  G K +L  NE   I I+   + K    V   K ++SSN+K S
Sbjct:    9 IENELQAVEMQIQELVDKQQELIEKKMRVESLIKQSSGDPEAGGSKDNETSAEAWNKKDFPWYEKIKTVLQSKFKLQKFRSLQLETINAALAGKDIFLVMPTGGGKSLCYQLPAVCSDGFTLVICPLISLMEDQLMVLEQLGISAALLNASSS----KEHVKWVHTEMLDRNSQLKLIYVTPEKIAKSKMFMSKLEKAYQAGCLARIAVDEVHCCSQWGHDFRPDYKSLGILKRQFPNAPLIGLTATATNHVLKDAQKILHVQ-NCITFTASFNRPNLYYEVRHKPSNNEDFIEDIVKIVNGRYKGLSGIVYCFSQKDSEQVTVSLQKLGIKAGTYHANMDAKYKTKVHKGWAANQIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDQKADCILYYGFGDIFRISSMVVMENVGQEKLYDMVSYCQNMNKCRRVLIAHHFDEVWDSANCNRMCDNCC-RENSCEKMDITGYYKDLIKILEQAENM-SEKLTPLKLIDAWSGKGVSKFR-VAEVTPPKHPREELERIIAHLLLQQYLKEDFSFTAFATISYLKIGPKASLLKNEAHVITIQGIANKKS---VCKDKPSQSSNLKGS 606          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: A0A3Q0CWF0 (ATP-dependent DNA helicase OS=Mesocricetus auratus OX=10036 GN=Recql PE=3 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.111e-133
Identity = 241/606 (39.77%), Postives = 360/606 (59.41%), Query Frame = 1
Query:  130 AIDNEIKTLTHEKEDLIKKKKQLSISTK----GHSITSNKD-------YGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMC-SVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMS--LYFAD-LANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDK--MRNLVQNVKQNESSNV 1884
            A+D +I+ LT  +++L++KK  L+   K    G    ++ D       + KE+FPWS  +K +LQ+ FK++ F++LQL+T+N T+ + D   +   G GKSLCYQL ++ S GFTLVI PL SL++DQ++V ++ GIS   L+++SS     E  K +  + V+ N   KL+Y TP+KI+ SK     +EKAY   RL R+ +DE+HCCS+  HDFR DYK L  LK  +PN  ++GLTATA N V+ D +  L +   CL    ++NR N++YEV+    N +   E+I KLI  R+ GQSGI++CF+QKD E +T  L   GI A +Y+  +  + K  +H +W  +  +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD  R+DCIL++   + F+I S +  E  G   L  M  Y  +   C+RV ++   DE +  + C  MC + C DT  E    +I    +  + I+K  E+  N K+T  K++     + +  L  A  +A   P  D    L+K   H +L  YLK DYSF +++  +Y+  GS+ +L SNE   + +++ +S +  +R       Q+E ++V
Sbjct:   20 AVDIQIQELTERQQELLQKKAVLTKKIKQCLEGSDAVASSDCDSSPAEWDKEDFPWSGKVKDVLQNVFKLQKFRALQLETVNVTMARKDIFLVMPTGGGKSLCYQLPALCSEGFTLVICPLISLMEDQLMVLKQLGISATMLNASSS----KEHVKWVHAEMVNKNSQLKLVYVTPEKIAKSKMFMSRLEKAYEAGRLTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNTSLIGLTATATNHVLKDAQKILCVEK-CLTFTASFNRPNLYYEVRQKPPNAEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTISLQKLGIRAGTYHANMEPEDKTKVHTQWSADELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDSRADCILYYGFGDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLIAQHFDEVWNADACNKMCDNCCKDTLFEKR--NITQHCRGLVKILKQAEQL-NEKLTPLKLMDAWTGKGAAKLRVAGVVAPALPRED----LEKIIAHALLQQYLKEDYSFTAYATISYLKVGSRASLLSNEAHVVTLQVTRSTQSSIRAASSEAYQSEHADV 613          
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Match: A0A091RGT0 (ATP-dependent DNA helicase (Fragment) OS=Mesitornis unicolor OX=54374 GN=N332_14986 PE=3 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 1.689e-133
Identity = 244/609 (40.07%), Postives = 360/609 (59.11%), Query Frame = 1
Query:  112 IDKRIVAIDNEIKTLTHEKEDLIKKKKQLS---------ISTKGHSITSN--KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVD-NVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKS 1893
            I+  + A++ +I+ L  ++++LI+KK ++          +   G   T N  K + K++FPW   IK  LQ KFK++ F+SLQL+T+NA +   D   +   G GKSLCYQL ++IS GFTLVI PL SL++DQ++V E+ GIS   L+++SS     E  K + T+ ++ N   KLIY TP+KI+ SK     +EKAY    L R+ +DE+HCCS+  HDFR DYK+L  LK  +PN P++GLTATA N V+ D +  L++   C+    ++NR N++YEV+   SN +   E+I K+I  R+ G SGI++CF+QKD E +T  L   GI A +Y+  +    K  +H  W     +V+VAT AFGMGIDKP+VRFVIH SMSKS+ENYYQESGRAGRD +++DCIL++   + F+I S +  E  G   L  M  Y  +  TC+RV ++   DE +   +C  MC  C   E+    +DI    +  + I++  E   + K+T  K+I   + +  +    +A   P    +  L++   HL+L  YLK D+SF +F+  +Y+  G K +L +NE   I I+   S K    V   K ++SSNVK S
Sbjct:    9 IENELQAVEMQIQELVDKQQELIQKKMRVKNLIKQSAGDLEAGGSKDTENSAKAWNKKDFPWYEKIKTALQSKFKLQKFRSLQLETVNAAMAGKDIFLVMPTGGGKSLCYQLPAVISDGFTLVICPLISLMEDQLMVLEQLGISATLLNASSS----KEHVKWVHTEMLNRNSQLKLIYVTPEKIAKSKMFMSKLEKAYQAGCLARIAVDEVHCCSQWGHDFRPDYKSLGILKRQFPNTPLIGLTATATNHVLKDAQKILHVQK-CITFTASFNRPNLYYEVRHKPSNNEDFIEDIVKIINGRYKGLSGIIYCFSQKDSEQVTVSLQKLGIKAGTYHANMDAKYKTKVHKGWAANQIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDQKADCILYYGFGDIFRISSMVVMENVGQEKLYDMVSYCQNTNTCRRVLIAHHFDEVWDSANCNRMCDNCC-RENSCEKMDITGYCRDLIKILEQAENM-SEKLTPLKLIDAWSGK-GVSKLRVAEVTPPKHPREKLERIIAHLLLQQYLKEDFSFTAFATISYLKTGPKASLLNNEAHVITIQGITSTKS---VYKDKPSQSSNVKGS 606          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:103027659])

HSP 1 Score: 368.237 bits (944), Expect = 1.487e-117
Identity = 209/567 (36.86%), Postives = 320/567 (56.44%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-----------TLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKS 1893
            + Y + +F WS ++++ L++ FKI  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +  G+S ++L+++SS +    +   M TD   N  +KL+Y TP+KI+ SK L   +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +P +P++GLTATA ++++ D +  L +  D +     +NR N++YEV+  S+E   GE I  LIK R+  QSGIV+ F+QKD E +  +L   GILA  Y+  +    K  +H  W  +  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+  ++ F+I + +  E +G   L  M  Y  +   C+R  ++   DE +   +C  MC VC      ++     D+ K A  ++K +E   + + K+T  K+      + +     +      I  +  ++    HL+L GY   D+SF  ++ + Y+ AG K           T+K   K+  P       ++   V +VK +E S  K S
Sbjct:   75 QHYEESDFSWSKDVQEKLENIFKISKFRPLQRAAINLSMSGRDLFLVMPTGRGKSLCYQLPAVCSKGFTLVIAPLVSLMEDQLMYLKSVGVSAVTLNASSSKEDSKFVMAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAYNMGLLERIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPKVPLVGLTATATSNILKDCQKILCV-PDPVTLTAPFNRPNLYYEVRVKSSEDSNGE-IAALIKGRYKDQSGIVYVFSQKDAELVAIDLQQRGILAQPYHANMEPSDKSRVHRHWSTKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDHPADCIVFYGFSDIFRISTMVVMENTGQQKLQNMVAYCQNVDRCRRAMMAVHFDEVWDDEECHQMCDVCRHGNDYVT----MDITKHARDVVKLVELASSVDEKMTPLKVCDTWMGKGNAKLRKMIQT--TILSRQEVESIIVHLLLNGYFSEDFSFTPYTTYFYLKAGRKAALLKSENHSITMKMKRKVPTP----SPGRLSVAVSSVKDSEGSGAKSS 626          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:103027659])

HSP 1 Score: 364.385 bits (934), Expect = 2.278e-114
Identity = 202/540 (37.41%), Postives = 309/540 (57.22%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-----------TLKSNEKIDIP 1812
            + Y + +F WS ++++ L++ FKI  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +  G+S ++L+++SS +    +   M TD   N  +KL+Y TP+KI+ SK L   +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +P +P++GLTATA ++++ D +  L +  D +     +NR N++YEV+  S+E   GE I  LIK R+  QSGIV+ F+QKD E +  +L   GILA  Y+  +    K  +H  W  +  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+  ++ F+I + +  E +G   L  M  Y  +   C+R  ++   DE +   +C  MC VC      ++     D+ K A  ++K +E   + + K+T  K+      + +     +      I  +  ++    HL+L GY   D+SF  ++ + Y+ AG K           T+K   K+  P
Sbjct:   75 QHYEESDFSWSKDVQEKLENIFKISKFRPLQRAAINLSMSGRDLFLVMPTGRGKSLCYQLPAVCSKGFTLVIAPLVSLMEDQLMYLKSVGVSAVTLNASSSKEDSKFVMAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAYNMGLLERIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPKVPLVGLTATATSNILKDCQKILCV-PDPVTLTAPFNRPNLYYEVRVKSSEDSNGE-IAALIKGRYKDQSGIVYVFSQKDAELVAIDLQQRGILAQPYHANMEPSDKSRVHRHWSTKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDHPADCIVFYGFSDIFRISTMVVMENTGQQKLQNMVAYCQNVDRCRRAMMAVHFDEVWDDEECHQMCDVCRHGNDYVT----MDITKHARDVVKLVELASSVDEKMTPLKVCDTWMGKGNAKLRKMIQT--TILSRQEVESIIVHLLLNGYFSEDFSFTPYTTYFYLKAGRKAALLKSENHSITMKMKRKVPTP 603          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:103027659])

HSP 1 Score: 363.614 bits (932), Expect = 2.665e-114
Identity = 202/540 (37.41%), Postives = 309/540 (57.22%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSK-----------TLKSNEKIDIP 1812
            + Y + +F WS ++++ L++ FKI  F+ LQ   IN ++   D   +   G GKSLCYQL ++ S GFTLVIAPL SL++DQ++  +  G+S ++L+++SS +    +   M TD   N  +KL+Y TP+KI+ SK L   +EKAY    L R+ +DE+HCCS+  HDFR DYK L  LK  +P +P++GLTATA ++++ D +  L +  D +     +NR N++YEV+  S+E   GE I  LIK R+  QSGIV+ F+QKD E +  +L   GILA  Y+  +    K  +H  W  +  +V+VAT AFGMGIDK +VRFVIH ++SKS+ENYYQESGRAGRD   +DCI+F+  ++ F+I + +  E +G   L  M  Y  +   C+R  ++   DE +   +C  MC VC      ++     D+ K A  ++K +E   + + K+T  K+      + +     +      I  +  ++    HL+L GY   D+SF  ++ + Y+ AG K           T+K   K+  P
Sbjct:   75 QHYEESDFSWSKDVQEKLENIFKISKFRPLQRAAINLSMSGRDLFLVMPTGRGKSLCYQLPAVCSKGFTLVIAPLVSLMEDQLMYLKSVGVSAVTLNASSSKEDSKFVMAGM-TD--KNSPFKLLYVTPEKIAKSKLLMSKLEKAYNMGLLERIAVDEVHCCSQWGHDFRPDYKLLGILKRQFPKVPLVGLTATATSNILKDCQKILCV-PDPVTLTAPFNRPNLYYEVRVKSSEDSNGE-IAALIKGRYKDQSGIVYVFSQKDAELVAIDLQQRGILAQPYHANMEPSDKSRVHRHWSTKKIQVVVATVAFGMGIDKADVRFVIHHTISKSIENYYQESGRAGRDDHPADCIVFYGFSDIFRISTMVVMENTGQQKLQNMVAYCQNVDRCRRAMMAVHFDEVWDDEECHQMCDVCRHGNDYVT----MDITKHARDVVKLVELASSVDEKMTPLKVCDTWMGKGNAKLRKMIQT--TILSRQEVESIIVHLLLNGYFSEDFSFTPYTTYFYLKAGRKAALLKSENHSITMKMKRKVPTP 603          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: blm (BLM RecQ like helicase [Source:NCBI gene;Acc:103043866])

HSP 1 Score: 297.36 bits (760), Expect = 4.526e-86
Identity = 174/470 (37.02%), Postives = 259/470 (55.11%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDE-KFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSL 1626
            +FP SS + K+   +F +  F+  QL+ INATL   D   +   G GKSLCYQL + +S G T+VI+PL SLI DQ+       I   SL  + S      I+  + + DPV     KL+Y TP+K+S S ++  A++  Y    L R VIDE HC S+  HDFR DYK LH L+  +PN+P++ LTATA   V  DI   + +N    V   ++NR N+ Y V      KK  EE    IK  +   SGI++C ++ DC+ + + L   GI A +Y+  L    ++ + NKW+N++ C+V+ AT AFGMGIDKP+VR+VIH S+ KS+E YYQESGRAGRDG+ S C+LF+  ++  +I   +  +K G          NL+ M  +  +   C+R+ L +   E KF  + CK    V  D  +        +V +    I++ +++    K+ G+   S   N+++L
Sbjct:  641 SFPHSSEMMKIFHKRFGLHQFRFNQLEAINATLLGEDTFVLMPTGGGKSLCYQLPACVSAGVTVVISPLRSLIVDQVQKLTTLDIPATSLSGDKSESEAGRIYMQLSKKDPV----IKLLYATPEKVSASGRMISALQNLYERNLLARFVIDEAHCVSQWGHDFRPDYKRLHELRQKFPNVPIMALTATATPRVQKDILNQMAMNRP-QVFTMSFNRHNLKYSV-LPKKPKKVDEECINWIKKYYPRDSGIIYCLSRNDCDTMADSLQRAGIAALAYHAGLNDKDREYVQNKWINQDRCQVMCATIAFGMGIDKPDVRYVIHASLPKSVEGYYQESGRAGRDGEISHCVLFYSYSDVIRIKRILAMDKDGNHHSRATHTNNLHSMVHFCENVSECRRIQLLAYFGENKFNADFCKEHPEVICDNCARPHQYKARNVTEDVKKIVRFVQENCQ-KVGGRYSKSSQQNRLTL 1103          
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Match: recql5 (RecQ like helicase 5 [Source:NCBI gene;Acc:103031687])

HSP 1 Score: 217.238 bits (552), Expect = 3.167e-59
Identity = 139/427 (32.55%), Postives = 217/427 (50.82%), Query Frame = 1
Query:  274 IKKLLQDKFKIKNFKSLQLK-TINATLDKLDCIFISSP-GSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETD-PVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQS-----GIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKI---------------GSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSIL-DEKFTVNDCKNMCSVC 1479
            +++ L+  F  + F+S Q +  + A L+    +F+  P G+GKSLCYQL ++++ G TLVI+PL +LIQDQ+   ++  I   S++S      + +I + +E++ PV     K++Y TP+ ++ S      +        L RL +DE HC S+  HDFR DY  L  L++  P +P + LTATA   V  DI  +L L S  L       R N+ Y+V F          +    K    G S     GIV+C  ++ CE++ + L   GI+A  Y+  L    + +    W+     VIVAT +FGMG+DK NVRFV H +++KSL +YYQESGRAGRDG  S C +++   +  ++               GS    +K+ I +   M  +   +  C+  ++S    D+K    +C   C  C
Sbjct:    6 VERALKTHFGFERFRSRQQEEVVRAVLEGERDVFVCMPTGAGKSLCYQLPALLATGITLVISPLIALIQDQVEHLKELNIPARSINSKLPAGERRQILEDLESESPV----LKMLYITPEMVA-SPSFQPCLSSLCSRGLLARLAVDEAHCVSQWGHDFRPDYLKLGELRARLPGVPCVALTATAPKRVQEDIARSLRLRSP-LTFSTPVFRKNLKYDVIFRDLLPDPYVHLHAFAKEALGGSSAEKGCGIVYCRTRESCEDVAHRLTKLGIVAKPYHAGLKAGDRTESQADWMAGKVPVIVATISFGMGVDKANVRFVAHWNVAKSLASYYQESGRAGRDGIPSSCRIYYSRKDRDQLNFLIRKEVSRKQEKRGSEKEQDKAAIQDFEAMVNFCEQE-GCRHATISQFFGDQK---PNCAGSCDYC 422          
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Match: recql (RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-050809-134])

HSP 1 Score: 355.91 bits (912), Expect = 3.503e-114
Identity = 197/577 (34.14%), Postives = 329/577 (57.02%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKKKQLS-------------ISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKE-GEEICKLIKSRFDGQSG--IVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCAD--TESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT 1782
            E+D+    +  +I+ L  ++E L+++K  +               S    S  + + + +E+F WS+ +K +L++ FK+ NF+SLQL+ +NA++   D   I   G GKSLCYQL ++ S GFTLVI+PL SL++DQ++  E+  I    L ++S+ +    +  AM ++   +   KL+Y TP+KI+ SK     +EKAY  +RL R+ IDE+HCCS+  +DFR DYK L  LK  +P +P+L LTATA + V++D+K+ L +    L    ++NR N+ Y+V     + ++  E + +LI  ++ GQSG  IV+CF++KD E +   L + G+ A SY+  +  D +  +H  W +   +V+VAT AFGMGIDKP+VRFVIH S+SKS+ENYYQESGRAGRDG  +DC+L++   + F+    +  E++G   L  M  Y      C+R  ++   DE +    C  MC  C       E S +  A   +  + I+++ ++ K  K+T  +++     + ++     +   P +  +   +     L+++GY++ +YS+  ++  +Y++ G K 
Sbjct:   21 ELDR----VGTQIQELVEQQELLLERKASIQNKISKLQRKQSKEQSGSADSARAAEKWEREDFSWSTKLKCILREVFKMDNFRSLQLQAMNASIAGHDVFLIMPTGGGKSLCYQLPALCSKGFTLVISPLISLMEDQIMALEQLKIPAAMLSASSTKEHVKTVQAAMISN---DHELKLLYVTPEKIAKSKIFMSKLEKAYKGERLARIAIDEVHCCSQWGNDFRPDYKVLGILKRQFPKVPLLCLTATATSVVLDDVKSILAVPG-ALSFTASFNRPNLHYQVHRKPTKFEDCMENMVRLINKKYKGQSGPGIVYCFSRKDAEEVAAALTSLGVGAGSYHSDIPADRRSRLHRHWTSNRLQVVVATVAFGMGIDKPDVRFVIHHSLSKSMENYYQESGRAGRDGAPADCVLYYSFPDVFRQSQMVSMERTGQEKLYGMVAYCQTYNRCRRSLIAEHFDEVWDAAQCDRMCDHCRGGVVAEEASVVRHA---RGLIAILRHAQQ-KQEKLTPLRLLEAWQGRGAVKLRVSSVPTPSLSQQ-GCEIIVLQLLMLGYIREEYSYTPYATISYLVVGQKA 584          
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Match: blm (BLM RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-070702-5])

HSP 1 Score: 285.419 bits (729), Expect = 5.807e-86
Identity = 162/454 (35.68%), Postives = 250/454 (55.07%), Query Frame = 1
Query:  238 DYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNE-NCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG---------IPNLNIMNRYILDDCTCKRVSLSSILDEK-FTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE 1560
            ++   +FP S+ + K+ + KF +  F+  QL+ INA +   DC  +   G GKSLCYQL + +S G ++V++PL SLI DQ+       I    L  + +      I+  + + +PV     KL+Y TP+K+S S +L  A++  Y  + L R VIDE HC S+  HDFR DYK L  L+  +P +P++ LTATA   V  DI   L +N+       ++NR N+ YEV      KK  E+  + I+S +   SGI++C ++ +C+ +   L   G+ A SY+  L    +      W+N+  CKVI AT AFGMGIDKP+VR+VIH S+ KS+E YYQESGRAGRDG  + C+LF+   +  ++   I +E+ G         + NL  M  +  +   C+R+ L +   EK F    C+   +V  D  S M +  + DV ++  T+++ ++
Sbjct:   91 EFQGTSFPHSAEMLKVFRHKFGLLRFRKNQLEAINAAMFNRDCFVLMPTGGGKSLCYQLPACLSPGVSVVVSPLRSLIVDQVQRLASLDIPATHLSGDINDGDLAAIYMQLAKKEPV----VKLLYVTPEKLSCSTRLLSALDNLYQRQLLSRFVIDEAHCVSQWGHDFRPDYKRLSELRRRFPTVPIMALTATATTRVQTDILHQLTMNAPLSGFIQSFNRDNLKYEV-LPKKPKKVAEDCLQWIRSNYPRDSGIIYCLSRHECDTMAESLRRAGLDALSYHAGLTDKQRDQSQQCWINQRRCKVICATIAFGMGIDKPDVRYVIHASLPKSIEGYYQESGRAGRDGIVAKCVLFYGYGDVTRLRRIIHSEREGGSRESKQMHMSNLYSMVHFCENISECRRLQLLAYFGEKGFDPGFCRKNPTVACDNCSSMQTFRLRDVTENVKTVVRFLQ 539          
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Match: recql5 (RecQ helicase-like 5 [Source:ZFIN;Acc:ZDB-GENE-071214-1])

HSP 1 Score: 223.402 bits (568), Expect = 3.240e-64
Identity = 147/466 (31.55%), Postives = 233/466 (50.00%), Query Frame = 1
Query:  274 IKKLLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQL-ASMISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF---LSNEKKEGEEIC------KLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFW--------------KLAEYFK--IGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSA----LTIIKNIEKTKNP 1575
            ++  L   F  + F+S LQ     A       +F+S P G+GKSLCYQL A M  G +LVI PL +LIQDQ+    +  I   +L+S      +  + + +  DP    + K++Y TP+ ++ +      + +    + L  LV+DE HC S+  HDFR DY  L  L+SL   +P + LTATA   V  DI + L+L+    + K +  R N+FY V +   + +  K+  + C      K     FDG SGIV+   ++ C+ L +EL   G+   +Y+  L  D +  +  +W+     VIVAT +FGMG+DK NVRFV H +++KS+  YYQESGRAGRDGK + C L++               +A  F+   G    T+K+ +     +  +  +   C+  +++    +K  + DC++ C  C D+   +  +D      S+     T I+  +K   P
Sbjct:    1 VRDTLGRVFGFEAFRSALQEDAARAVASGTKDVFVSMPTGAGKSLCYQLPAVMAPGVSLVICPLIALIQDQLDHLHQLNIPARTLNSKMGAHERQAVVEDLHADPP---SLKMLYITPE-MAATHSFGAVLGRLASRQLLSCLVVDEAHCVSQWGHDFRPDYLKLGRLRSLLRGVPCVALTATATKQVQEDIVSILSLDKPA-IFKSSCFRPNLFYNVSYKEVIQDPYKDLTQFCLKALGKKNAAGGFDG-SGIVYSRTRESCDMLAHELTKRGVKTKAYHAGLKTDDRSKVQVEWMEGETPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPAFCRLYYCRKERGQVSFLISKDIAAMFQDDTGKVSETDKAAMAGFEALVNFC-EKLGCRHKAIAQYFGDK--IADCRSACDSCKDSALVVQDLDALQKVGSSKSFGRTAIQQPQKASGP 457          
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005409.1 (pep scaffold:Pmarinus_7.0:GL485130:385:11513:1 gene:ENSPMAG00000004903.1 transcript:ENSPMAT00000005409.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 2.750e-17
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 1
Query: 1066 ASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCK--NMCSVCADTESEMSSI---DIADV 1524
            A SY+  +    +K +  +++    +++VAT AFGMG+DK +VR ++H +M KS E+Y QE GRAGRDG+ + C +F                 S   +L  + R+I  + T  R+++  +L + F    C+  ++C    +TE E   +   ++AD+
Sbjct:  139 AESYHAGMTAAERKAVQTRFMRGALRIVVATVAFGMGLDKADVRAIVHYNMPKSFESYVQEIGRAGRDGEPAHCHMFL---------------DSEARDLQELRRHIYAN-TIDRITVKKLLQKVFPACKCRELHLCRQRLETEEEFGYVRDDEMADI 280          
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Match: DDX41 (DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:18674])

HSP 1 Score: 51.6026 bits (122), Expect = 9.013e-8
Identity = 27/100 (27.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query:  997 IVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILF 1296
            ++F   + D + +   L+  G+ A + +G    + +      +      V+VAT+    G+D PN++ VI+  M + +ENY    GR GR GK      F
Sbjct:   50 LIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAMESFREGKKDVLVATDVASKGLDFPNIQHVINYDMPEEIENYVHRIGRTGRSGKTGIATTF 149          
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Match: SGS1 (RecQ family nucleolar DNA helicase; role in genome integrity maintenance, chromosome synapsis, meiotic joint molecule/crossover formation; stimulates activity of Top3p; rapidly lost in response to rapamycin in Rrd1p-dependent manner; forms nuclear foci upon DNA replication stress; yeast SGS1 complements mutations in human homolog BLM implicated in Bloom syndrome; also similar to human WRN implicated in Werner syndrome; human BLM and WRN can each complement yeast null mutant [Source:SGD;Acc:S000004802])

HSP 1 Score: 285.034 bits (728), Expect = 9.515e-83
Identity = 181/540 (33.52%), Postives = 285/540 (52.78%), Query Frame = 1
Query:  256 FPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMI-----SGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGE--EICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEK-----SGIPNLNIMNRYIL--DDCT-CKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKIT------------GKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNF--TYVIAGSKTLK 1788
            +PWS  +   L + FK+  F+  QL+ +NATL   D   +   G GKSLCYQL +++      G T+VI+PL SL+QDQ+       I      S  + + + + F       +D     L+Y +P+ IS S++  +AI + Y D +L R+V+DE HC S   HDFR DYK L   K  YP++P++ LTATA+  V  DI   L L     + K ++NR+N++YEV    N+K +    EIC  +KSRF  Q+GI++C ++K CE  + ++  NGI  + Y+  +  D +  +   W  +  +VI AT AFGMGIDKP+VRFV H ++ ++LE YYQE+GRAGRDG  S CI ++   +   + + I  +K     +   +LN + + +   D+ T C+R  + S  +E F    C   C  C ++ + ++  +  DV + A  I+K +E  +N ++T              KI+   AN  +L    +         K  +++ F HL+ +  L+ +YS  + S F  +YV  G    K
Sbjct:  660 YPWSDEVLYRLHEVFKLPGFRPNQLEAVNATLQGKDVFVLMPTGGGKSLCYQLPAVVKSGKTHGTTIVISPLISLMQDQVEHLLNKNIKASMFSSRGTAEQRRQTFNLFINGLLD-----LVYISPEMISASEQCKRAISRLYADGKLARIVVDEAHCVSNWGHDFRPDYKELKFFKREYPDIPMIALTATASEQVRMDIIHNLELKEPVFL-KQSFNRTNLYYEV----NKKTKNTIFEICDAVKSRFKNQTGIIYCHSKKSCEQTSAQMQRNGIKCAYYHAGMEPDERLSVQKAWQADEIQVICATVAFGMGIDKPDVRFVYHFTVPRTLEGYYQETGRAGRDGNYSYCITYFSFRDIRTMQTMIQKDKNLDRENKEKHLNKLQQVMAYCDNVTDCRRKLVLSYFNEDFDSKLCHKNCDNCRNSANVIN--EERDVTEPAKKIVKLVESIQNERVTIIYCQDVFKGSRSSKIVQ--ANHDTLEEHGIGKSM----QKSEIERIFFHLITIRVLQ-EYSIMNNSGFASSYVKVGPNAKK 1180          
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Match: HRQ1 (3'-5' DNA helicase that has DNA strand annealing activity; helicase activity is stimulated by fork structure and 3'-tail length of substrates; acts with Rad4p in nucleotide-excision repair; belongs to the widely conserved RecQ family of proteins which are involved in maintaining genomic integrity; similar to the human RecQ4p implicated in Rothmund-Thomson syndrome (RTS) [Source:SGD;Acc:S000002699])

HSP 1 Score: 79.7221 bits (195), Expect = 7.433e-16
Identity = 89/350 (25.43%), Postives = 150/350 (42.86%), Query Frame = 1
Query:  307 KNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASM------ISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNV----TYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSEL--SHDFRQDYKNLHGLKSLYPNLPVLGLTATAN-NSVINDIKTTLNLNSDCLVHKDNYN---RSNIFYEVKFLSNEKKEGEEICK-----LIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILAS---------SYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGR 1266
            +NF S Q   IN+     + I  +S  SGKSL YQLA++           + I P  +L QDQ   + K  +S I    N+ V   +      +T+P +        ++I+T PD I  S     A  + +    L  +V+DE+H    L  SH      + L      Y N  +  ++ +A   S +  +K    +N   L+H+D      +  + +    L   +++ E   +     L++   +    I FC+ ++ CE L  E+ N  I            SY G      ++ I  +  + N K +++TNA  +GID   +  V+      S+ N++Q+SGRAGR
Sbjct:  289 ENFYSHQADAINSLHQGENVIITTSTSSGKSLIYQLAAIDLLLKDPESTFMYIFPTKALAQDQK-RAFKVILSKIPELKNAVVDTYDG-----DTEPEERAYIRKNARVIFTNPDMIHTSILPNHANWRHFL-YHLKLVVVDELHIYKGLFGSHVALVMRRLLRLCHCFYENSGLQFISCSATLKSPVQHMKDMFGINEVTLIHEDGSPTGAKHLVVWNPPILPQHERKRENFIRESAKILVQLILNNVRTIAFCYVRRVCELLMKEVRNIFIETGREDLVTEVMSYRGGYSASDRRKIEREMFHGNLKAVISTNALELGIDIGGLDAVLMCGFPLSMANFHQQSGRAGR 631          
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 68.1662 bits (165), Expect = 1.500e-12
Identity = 50/211 (23.70%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  691 LVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKI 1323
            LV+DE       +  F+Q   ++     L  N  V+ ++AT N  ++   +  +N     LV +D  +   I   V  +  E+ + + +C +  S    Q  ++FC  +K  + L+  L+ +     S +G +  + +  + N +   + +V+++T+ +  GID   V  VI+  + + +ENY    GR+GR G++   I F   A+  K+
Sbjct:  170 LVLDEADELLSETLGFKQQIYDIFA--KLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYDSLTITQC-VIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKL 377          
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 55.4546 bits (132), Expect = 1.976e-8
Identity = 85/408 (20.83%), Postives = 161/408 (39.46%), Query Frame = 1
Query:  181 KKKKQLSISTKGHSITSN-KDYGKENFPWSSNIKKLLQDKFKIKNF---KSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMI------------SGFTLVIAPLGSLIQDQMIVSEKFGIS------CISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKI--------SNSKKLTK-AIEKA-----YGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILF 1296
            +K+ +++IS  GH I      + +  FP        + ++ K + F     +Q +     L   D + I++ GSGK+L Y L  ++                LV+AP   L         KFG S      C+      S +I+ ++ +  E          ++  TP ++        +N K++T   +++A      G +  +R ++D+I    +         K +  L + Y N P+     +   S  ++I   + + SD     +  +R N + E     NE K                  ++F   ++ C+++T  L  +G  A + +G      +  +  ++ N    ++VAT+    GID   + +VI+  M  ++E+Y    GR GR G     I F
Sbjct:   96 RKENEMTIS--GHDIPKPITTFDEAGFP------DYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIR-DLSRGSE----------IVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDF----EKRDRLNKYLETASQDNEYKT-----------------LIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 463          
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 54.6842 bits (130), Expect = 2.932e-8
Identity = 78/331 (23.56%), Postives = 140/331 (42.30%), Query Frame = 1
Query:  361 DCIFISSPGSGKSLCYQLASMISGF----------TLVIAP---LGSLIQDQMIV-SEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTAT--------ANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDG----QSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGK 1275
            D + ++  GSGK+  + + + IS             LVI+P   L S I D +IV ++K G+ C  +        Q    K  +          ++  TP ++     L    E +    ++  LV+DE      L   F +D KN+   ++       L  TAT        A+  + N IK ++  N+D L    N   + I   V     E+K    + +L+K    G    +  ++F   +K+   +   L  NG   ++ +G L    +    N++ +    +++AT+    G+D PNV+ VI+++   ++E+Y    GR GR G+
Sbjct:  151 DVVGVAETGSGKTFAFGVPA-ISHLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKKSQ----------VVVATPGRL-----LDLLQEGSVDLSQVNYLVLDEADRM--LEKGFEEDIKNII-RETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIG-NTDQLTA--NKRITQIVEVVDPRGKERK----LLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQ 455          
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Match: EDO32632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG5])

HSP 1 Score: 388.267 bits (996), Expect = 1.057e-126
Identity = 211/580 (36.38%), Postives = 337/580 (58.10%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKKKQLSISTKGHS-------ITSN------KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVK--------FLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNP--KITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGS 1776
            EI + +  I+ +I++L   ++ L+ +K++L +    +S        +SN       D+    F WS  ++  L++ FKI  F+ LQL+ INAT+  +DCI I   G GKSLC+QL +++S G TLV++PL SL++DQ+   ++ GI    L+++S+ +  N +  ++     D    K++Y TP+KI+ SK+    +EK+Y    L R+VIDE+HC S+  HDFR DYK L  LK  YP +P+LGLTATA   VI D+K  L L+++CL+ K ++NR N+FYEV+        F+S        I +LI  RF G SGI++CF++KD E +  E+ + GI A+ Y+  +  + +  +H  W     +V+VAT AFGMGIDK NVRFVIH S SKS+ENYYQESGRAGRD KR+ CI+F++  + F+  + +FTE++G+ NL  + RY      C+R  +     E +    CK MC  C+  + E    ++ D+ + A  ++K +E+ K    ++T  K++     + ++         P +      ++   HLV+ G L+ ++ F  +S  +Y++ G+
Sbjct:    9 EISEELQDIEVQIESLLERQQFLLSRKQELEVIALSNSNDSVLLSFSSNVACAQGSDWSSTAFSWSQEVEAALKNVFKIDTFRHLQLECINATMSGVDCILIMPTGGGKSLCFQLPAVVSKGLTLVVSPLVSLMEDQLWALKRLGIKAALLNASSTREEVNSVHASIVDKKSD---LKMLYVTPEKIAKSKRFMAKLEKSYESGLLSRIVIDEVHCTSQWGHDFRPDYKILGILKRQYPGVPILGLTATATTKVIEDVKKILGLHANCLLLKASFNRPNLFYEVQSKPTTNSAFMST-------IHQLITKRFSGDSGIIYCFSRKDAEQVAIEMSSRGIKAACYHADMPPESRSQVHMAWTTNKLQVVVATVAFGMGIDKSNVRFVIHHSFSKSMENYYQESGRAGRDEKRASCIVFYRPFDIFRHSTMVFTEQTGLQNLYGIVRYCQQQGVCRRTLIGRHFGEGWDPAQCKQMCDNCSRRDDERGLNELHDITQYASDLLKILEQAKAAGDRVTANKLVDAWCGRGAVSLRVRGVSAPSLTPSE-CERVVVHLVVEGVLREEFHFTPYSTISYIVKGA 577          
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Match: EDO34091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQC9])

HSP 1 Score: 226.868 bits (577), Expect = 4.651e-67
Identity = 127/359 (35.38%), Postives = 202/359 (56.27%), Query Frame = 1
Query:  265 SSNIKKLLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQ-------SGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAE 1311
            ++++KK L++ FK + FKS LQ +        L  +F+S P GSGKSLCYQL ++++ G T+V +PL +LIQDQ+       I+  +L+S      ++E  + M+       T KL+Y TP+ ++ +    K ++  Y  K L    +DE HC S+  HDFR DY  L  L++ Y ++  + LTATA + V  DI T L++ S+  V K    R N++Y++ F    +    ++ +   +  + +       SGI++C  +  C+ + + L   G+ A  Y+  L  D +  +  +W+     VI AT +FGMG+DK +VRFV H S+ +S+E YYQESGRAGRDG+ S C L++  AE
Sbjct:    2 ATDLKKTLRNVFKFREFKSELQQRACETVSKGLQDVFVSMPTGSGKSLCYQLPAVVAPGITIVFSPLIALIQDQVTYLRTLKITVETLNSKLP---ESERKRVMKDLYFVKPTVKLLYITPE-LAATPGFQKVLDSLYKRKLLSLFAVDEAHCVSQWGHDFRPDYLRLGKLRNKYKDVAWVALTATATSRVKEDILTALHMQSNVAVFKSQCYRPNLYYDISFKELLEDPYADLKQFADAALEDEDSGEAKGSGIIYCRTRDACQEVASRLSRKGLSAKPYHAGLKSDKRDKVQQEWMEGKVAVICATISFGMGVDKGDVRFVAHWSLPQSMEGYYQESGRAGRDGQPSYCRLYYSRAE 356          
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Match: EDO25520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW89])

HSP 1 Score: 162.54 bits (410), Expect = 3.985e-44
Identity = 87/235 (37.02%), Postives = 134/235 (57.02%), Query Frame = 1
Query:  595 YKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFW 1299
            Y+L+Y +P+++      T+  E+      +  + +DE HC S+  HDFR DY  +  LK ++   PVL +TA+A N V  DI   L L +  L  K    R NI Y + +  +E+K+ + +  L  ++    S I++C ++K  E + N L+ NG  +  Y+  L   ++++  N WLN N + IVAT AFGMGIDKP+VR V++  + + LE YYQESGRAGRD   +  IL +
Sbjct:   39 YELLYISPERLQ-----TRLFEEYLPALNINLIAVDEAHCISQWGHDFRPDYLKIAQLKQVFARTPVLAVTASATNEVKQDIARQLQLKTPTLYQK-GIERKNIHYTIHY--SERKDNDLLEALGNNK---GSKIIYCRSRKTTERINNLLLQNGYSSVVYHAGLDKKVRENAQNDWLNNNTETIVATTAFGMGIDKPDVRLVVNYDLPEHLEAYYQESGRAGRDELPAKSILLY 262          
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Match: EDO32537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUT5])

HSP 1 Score: 139.813 bits (351), Expect = 1.860e-34
Identity = 111/396 (28.03%), Postives = 186/396 (46.97%), Query Frame = 1
Query:  349 LDKLDCIFISSPGSGKSLCYQLASMI-----SGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHG-LKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKS-RFDG-QSGIVFCFNQKDCENLTNEL---------------VNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNM 1467
            L  +  + + S G+GKSLCYQL + +        TLVI+PL SL++DQ I    FG+    L +N +   + +I     TD        L+ +    +      +  +  +     +    IDE HC SE SH+FR  Y  +   L+  Y     LGLTATA  S  + +   L +     V +      N+   V   S ++ + + + +L++  RF   +S I++C  ++  E +   +               V +G  A SY+  +    ++ +  ++++   + + AT AFGMG+DK +VR +IH +M KS E+Y QE GRAGRDGK S C              ++F ++ G  +L  + R+I  + T  RV++  +++  F   DCK +
Sbjct:    4 LSGMSSLVVLSTGAGKSLCYQLPAYMYHKRSPCLTLVISPLVSLMEDQ-ITGLPFGLKGACLHNNQTKPQRLKIL----TDITAGKVAVLLVSPEALVGGGMGGSGCLPSSTKMPPIAFACIDEAHCLSEWSHNFRPSYLRVCKILRDRYGVQCFLGLTATATQSTADSVAQHLGIADAGAVIRGAAVPPNLRLSV---SRDRDKDKALIELLQGPRFSRCESIIIYCTRREVTERVATLIRTCMQHMQPTIRHDDVISGSDAESYHAGMSAAQRRKVQKRFMSGELRAVAATVAFGMGLDKSDVRAIIHYNMPKSFESYVQEIGRAGRDGKPSHC--------------HVFLDREG-QDLCELRRHIFSN-TVDRVTVKRLVNRIFPRCDCKKL 375          
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Match: EDO33287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSN3])

HSP 1 Score: 120.553 bits (301), Expect = 1.872e-31
Identity = 66/179 (36.87%), Postives = 104/179 (58.10%), Query Frame = 1
Query:  787 LPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEE---ICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEY 1314
            +P++ LTATA   V  DI  +L L +  +V    ++R N+++EV    +   E      I  + K  F G + I++C  +K  E + + L  NGIL  +Y+  +    +K  H+K++ +  + +VAT AFGMGIDKP+VR +IH    K +E+Y QE GRAGRDG+ S C +F+K  ++
Sbjct:    1 MPIVALTATATPDVRRDICLSLKLKTPSVVCT-GFDRPNLYFEVHKKGDSVMEDLRPLLISDINKFSFAGPT-IIYCPTKKTTEMIADALKANGILCEAYHAGMALKKRKSAHHKFIRDEIQCVVATVAFGMGIDKPDVRQIIHYGAPKDIESYSQEIGRAGRDGEPSSCYVFYKPGDF 177          
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:101164117])

HSP 1 Score: 361.303 bits (926), Expect = 2.729e-113
Identity = 203/571 (35.55%), Postives = 324/571 (56.74%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLF---------LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKSYLKR 1905
            + Y +  FPWS+ + + L+  F +  F+ LQL+ IN T++  D   +   G GKSLCYQL ++ S GFTLV++PL SL++DQ+++     +   +L+++S  +    +  A+ TDP     +KL+Y TP+KI+ SK L   +EKAY  K L R+ +DE+HCCS+  HDFR DYK L  LK  +P++P+LGLTATA +SV+ D +  L +     +   ++NR+N++YEV+   S+      +I  LIK+R+  QSGIV+ F+QKD E++++ L  +GI A  Y+  +  + K  +H KW +   +V+VAT AFGMGIDKP+VRFVIH ++SKS+ENYYQESGRAGRD + +DCI+++  A+ F+I + +  E  G   L  M  +  +   C+R  ++   DE +   DC  MC  C       +  +  DV + A  +++ +E   + + ++T  K++                R P    K+           +     L+L GYL+ D+SF  ++ + YV  G +  L  N+   + +++  S      V ++   ESS VK  + K+
Sbjct:   79 QRYDEAEFPWSAAVDQHLRTSFHLSAFRPLQLRAINLTMEGRDVFLVMPTGRGKSLCYQLPAVCSEGFTLVVSPLVSLMEDQLLLLRSLQVPAAALNASSGKEHTKTVLAAL-TDP--KAPFKLVYVTPEKIAKSKLLMSRLEKAYKAKLLSRMAVDEVHCCSQWGHDFRPDYKLLGILKRQFPSVPLLGLTATATSSVLQDCRKILCVPQPVTL-TASFNRANLYYEVRVKDSDSDLSLSDISSLIKNRYKEQSGIVYVFSQKDAESVSSALQKSGIQAYPYHANMDPEDKSRVHRKWTSNKIQVVVATVAFGMGIDKPDVRFVIHHTISKSIENYYQESGRAGRDDRPADCIVYFGFADIFRISTMVVMESVGQKKLLQMVDFCQNVDRCRRSLMAVHFDEVWDDEDCNQMCDTCRHP----AGYNTLDVTQHARQVVQIVELATSMDERLTPLKLVEA-----------WRGRGPAKRRKMIQTTELPRRQAEAVIVFLLLQGYLREDFSFTPYTTYFYVKLGRRAPLLKNQAHSLTMKMKMSGA--EPVSDLSAAESSEVKGPHAKQ 628          
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:101164117])

HSP 1 Score: 361.303 bits (926), Expect = 2.729e-113
Identity = 203/571 (35.55%), Postives = 324/571 (56.74%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLF---------LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKSYLKR 1905
            + Y +  FPWS+ + + L+  F +  F+ LQL+ IN T++  D   +   G GKSLCYQL ++ S GFTLV++PL SL++DQ+++     +   +L+++S  +    +  A+ TDP     +KL+Y TP+KI+ SK L   +EKAY  K L R+ +DE+HCCS+  HDFR DYK L  LK  +P++P+LGLTATA +SV+ D +  L +     +   ++NR+N++YEV+   S+      +I  LIK+R+  QSGIV+ F+QKD E++++ L  +GI A  Y+  +  + K  +H KW +   +V+VAT AFGMGIDKP+VRFVIH ++SKS+ENYYQESGRAGRD + +DCI+++  A+ F+I + +  E  G   L  M  +  +   C+R  ++   DE +   DC  MC  C       +  +  DV + A  +++ +E   + + ++T  K++                R P    K+           +     L+L GYL+ D+SF  ++ + YV  G +  L  N+   + +++  S      V ++   ESS VK  + K+
Sbjct:   79 QRYDEAEFPWSAAVDQHLRTSFHLSAFRPLQLRAINLTMEGRDVFLVMPTGRGKSLCYQLPAVCSEGFTLVVSPLVSLMEDQLLLLRSLQVPAAALNASSGKEHTKTVLAAL-TDP--KAPFKLVYVTPEKIAKSKLLMSRLEKAYKAKLLSRMAVDEVHCCSQWGHDFRPDYKLLGILKRQFPSVPLLGLTATATSSVLQDCRKILCVPQPVTL-TASFNRANLYYEVRVKDSDSDLSLSDISSLIKNRYKEQSGIVYVFSQKDAESVSSALQKSGIQAYPYHANMDPEDKSRVHRKWTSNKIQVVVATVAFGMGIDKPDVRFVIHHTISKSIENYYQESGRAGRDDRPADCIVYFGFADIFRISTMVVMESVGQKKLLQMVDFCQNVDRCRRSLMAVHFDEVWDDEDCNQMCDTCRHP----AGYNTLDVTQHARQVVQIVELATSMDERLTPLKLVEA-----------WRGRGPAKRRKMIQTTELPRRQAEAVIVFLLLQGYLREDFSFTPYTTYFYVKLGRRAPLLKNQAHSLTMKMKMSGA--EPVSDLSAAESSEVKGPHAKQ 628          
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:101164117])

HSP 1 Score: 361.303 bits (926), Expect = 2.729e-113
Identity = 203/571 (35.55%), Postives = 324/571 (56.74%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF-LSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLF---------LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT-LKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKSYLKR 1905
            + Y +  FPWS+ + + L+  F +  F+ LQL+ IN T++  D   +   G GKSLCYQL ++ S GFTLV++PL SL++DQ+++     +   +L+++S  +    +  A+ TDP     +KL+Y TP+KI+ SK L   +EKAY  K L R+ +DE+HCCS+  HDFR DYK L  LK  +P++P+LGLTATA +SV+ D +  L +     +   ++NR+N++YEV+   S+      +I  LIK+R+  QSGIV+ F+QKD E++++ L  +GI A  Y+  +  + K  +H KW +   +V+VAT AFGMGIDKP+VRFVIH ++SKS+ENYYQESGRAGRD + +DCI+++  A+ F+I + +  E  G   L  M  +  +   C+R  ++   DE +   DC  MC  C       +  +  DV + A  +++ +E   + + ++T  K++                R P    K+           +     L+L GYL+ D+SF  ++ + YV  G +  L  N+   + +++  S      V ++   ESS VK  + K+
Sbjct:   79 QRYDEAEFPWSAAVDQHLRTSFHLSAFRPLQLRAINLTMEGRDVFLVMPTGRGKSLCYQLPAVCSEGFTLVVSPLVSLMEDQLLLLRSLQVPAAALNASSGKEHTKTVLAAL-TDP--KAPFKLVYVTPEKIAKSKLLMSRLEKAYKAKLLSRMAVDEVHCCSQWGHDFRPDYKLLGILKRQFPSVPLLGLTATATSSVLQDCRKILCVPQPVTL-TASFNRANLYYEVRVKDSDSDLSLSDISSLIKNRYKEQSGIVYVFSQKDAESVSSALQKSGIQAYPYHANMDPEDKSRVHRKWTSNKIQVVVATVAFGMGIDKPDVRFVIHHTISKSIENYYQESGRAGRDDRPADCIVYFGFADIFRISTMVVMESVGQKKLLQMVDFCQNVDRCRRSLMAVHFDEVWDDEDCNQMCDTCRHP----AGYNTLDVTQHARQVVQIVELATSMDERLTPLKLVEA-----------WRGRGPAKRRKMIQTTELPRRQAEAVIVFLLLQGYLREDFSFTPYTTYFYVKLGRRAPLLKNQAHSLTMKMKMSGA--EPVSDLSAAESSEVKGPHAKQ 628          
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Match: recql (RecQ like helicase [Source:NCBI gene;Acc:101164117])

HSP 1 Score: 348.977 bits (894), Expect = 3.932e-110
Identity = 192/558 (34.41%), Postives = 301/558 (53.94%), Query Frame = 1
Query:  235 KDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICK------------------------------LIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIE--KTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLF---------LDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKT 1782
            + Y +  FPWS+ + + L+  F +  F+ LQL+ IN T++  D   +   G GKSLCYQL ++ S GFTLV++PL SL++DQ+++     +   +L+++S  +    +  A+ TDP     +KL+Y TP+KI+ SK L   +EKAY  K L R+ +DE+HCCS+  HDFR DYK L  LK  +P++P+LGLTATA +SV+ D +  L +     +   ++NR+N++YEV             C                               LIK+R+  QSGIV+ F+QKD E++++ L  +GI A  Y+  +  + K  +H KW +   +V+VAT AFGMGIDKP+VRFVIH ++SKS+ENYYQESGRAGRD + +DCI+++  A+ F+I + +  E  G   L  M  +  +   C+R  ++   DE +   DC  MC  C       +  +  DV + A  +++ +E   + + ++T  K++                R P    K+           +     L+L GYL+ D+SF  ++ + YV  G + 
Sbjct:   79 QRYDEAEFPWSAAVDQHLRTSFHLSAFRPLQLRAINLTMEGRDVFLVMPTGRGKSLCYQLPAVCSEGFTLVVSPLVSLMEDQLLLLRSLQVPAAALNASSGKEHTKTVLAAL-TDP--KAPFKLVYVTPEKIAKSKLLMSRLEKAYKAKLLSRMAVDEVHCCSQWGHDFRPDYKLLGILKRQFPSVPLLGLTATATSSVLQDCRKILCVPQPVTL-TASFNRANLYYEVSGPRTHIHTHTHTCSAGIRAHQQDFPAQVRVKDSDSDLSLSDISSLIKNRYKEQSGIVYVFSQKDAESVSSALQKSGIQAYPYHANMDPEDKSRVHRKWTSNKIQVVVATVAFGMGIDKPDVRFVIHHTISKSIENYYQESGRAGRDDRPADCIVYFGFADIFRISTMVVMESVGQKKLLQMVDFCQNVDRCRRSLMAVHFDEVWDDEDCNQMCDTCRHP----AGYNTLDVTQHARQVVQIVELATSMDERLTPLKLVEA-----------WRGRGPAKRRKMIQTTELPRRQAEAVIVFLLLQGYLREDFSFTPYTTYFYVKLGRRA 617          
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Match: blm (BLM RecQ like helicase [Source:NCBI gene;Acc:100049173])

HSP 1 Score: 284.263 bits (726), Expect = 1.117e-81
Identity = 189/539 (35.06%), Postives = 279/539 (51.76%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAM-ETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSG--------IPNLNIMNRYILDDCTCKRVSLSSILDE-KFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPG-----IDYKLF----------LDKAFCHLVLVGYLKLD-YSFGSFSNFTYVIAGSKTL 1785
            NFP S  + K+   +F +  F+  QL+ INA L   D   +   G GKSLCYQL + +S G T+V++PL SLI DQ+       I   SL  + S      I+  +   DP+     KL+Y TP+K+S S +L  A++  Y    L R +IDE HC S+  HDFR D+K LH L+  +P++ ++ LTATA   V  DI   LN+     V   ++NRSN+ Y V      KK  E+    IK  +   SGIV+C ++ DC+ +   L   GI A SY+  L    ++ + +KW+N++ C+VI AT AFGMGIDKP+VR+VIH S+ KS+E YYQESGRAGRDG+ S CILF+   +  +I   I  ++ G          NL+ M  +  +   C+R+ L +   E  F  N CK+   V  D  ++ +   + +V +    I++ ++  +N +  G +   + A Q  L    L + F G     I   +F           D+ F  LVL   L  D Y   +    +Y+ AG K +
Sbjct:  597 NFPHSQEMMKIFHKRFGLHQFRFNQLEAINAALLGEDAFVLMPTGGGKSLCYQLPACVSPGVTVVVSPLKSLIVDQIQKLTTLDIPATSLSGDKSDSEAGRIYMQLSRKDPL----IKLLYVTPEKVSASGRLISALQNLYERGLLARFIIDEAHCVSQWGHDFRPDFKRLHELRQKFPSVRMMALTATATPRVQKDILNQLNMMRP-QVFTMSFNRSNLKYSV-LPKKPKKVDEDCIGWIKKHYPRDSGIVYCLSRNDCDAMAESLKRAGIQALSYHAGLSDGDREYVQSKWINQDGCQVICATIAFGMGIDKPDVRYVIHASLPKSVEGYYQESGRAGRDGEISHCILFYSYTDVHRIKRIISMDREGDSHTKATHFNNLHSMVHFCENVMECRRIQLLAYFGELNFNRNFCKDHPDVSCDNCAKPNQYQMKNVTEDVKKIVRFVQ--ENCEKVGSR-FGKTAQQNRLTLNMLVDIFIGSKSAKIQTGMFGMGGAYSRHNADRLFKKLVLENILVEDLYITNNGQAVSYISAGPKAM 1126          
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Match: SMESG000064966.1 (SMESG000064966.1)

HSP 1 Score: 1227.62 bits (3175), Expect = 0.000e+0
Identity = 607/616 (98.54%), Postives = 611/616 (99.19%), Query Frame = 1
Query:  109 EIDKRIVAIDNEIKTLTHEKEDLIKKKKQLSISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKSYLKRLFKGSNDDIVETKILKR 1956
            EIDKRIVAIDNEIKTLTHEKE+LIKKKKQLS  TKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITG K+ISELANQMSLY ADLA+RFPGIDYKLFLDKAFCHLVL GYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRI+KSDKMRNLVQNVKQNESSNVKKSYLKRLFKGSNDDIVETKILKR
Sbjct:    6 EIDKRIVAIDNEIKTLTHEKENLIKKKKQLS--TKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGNKMISELANQMSLYCADLASRFPGIDYKLFLDKAFCHLVLAGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRISKSDKMRNLVQNVKQNESSNVKKSYLKRLFKGSNDDIVETKILKR 619          
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Match: SMESG000064967.1 (SMESG000064967.1)

HSP 1 Score: 452.21 bits (1162), Expect = 1.101e-154
Identity = 208/340 (61.18%), Postives = 266/340 (78.24%), Query Frame = 1
Query:  178 IKKKKQLSISTKGHSITSNKDYGKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVR 1197
            +KKK+ L    K   +  N DY  ++FPWS  + K+LQ+ FK+  F++LQLKTIN TL K DCI I   G GKSLCYQL S+++G T+ ++PL SL+QDQ+++S++FGI  +SLD+N  VK+QNE++K+M++DPVD + YKLI+ TP+KIS SKKL KAIEK+Y D R+ R+VIDEIHCCS+  HDFR DYK LH  KSL+P +P+LGLTATA +S+I+DIK  L LN+DCLV++D YNR N+FY VKFLSN+ K+ +EICKLIKSR+ GQSGIV+CF QKDCE LTNELV NGI A  Y+    Y+ +KD+H+KWLNE C VIVAT AFGMGIDKPNVR
Sbjct:    1 MKKKQALEQHIKSAFVNDNTDYENDSFPWSLTVNKILQEVFKMDKFRALQLKTINTTLSKRDCILIKPTGGGKSLCYQLPSLLTGLTIAVSPLVSLMQDQLLISQRFGIPSVSLDANCPVKLQNEVYKSMQSDPVDKLKYKLIFVTPEKISKSKKLMKAIEKSYADNRISRIVIDEIHCCSQWGHDFRPDYKGLHIFKSLFPKIPILGLTATATDSIIDDIKEILGLNADCLVYRDVYNRPNLFYNVKFLSNDDKDDKEICKLIKSRYLGQSGIVYCFTQKDCETLTNELVLNGINACFYHANTSYEYRKDVHSKWLNEECNVIVATIAFGMGIDKPNVR 340          
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Match: SMESG000060148.1 (SMESG000060148.1)

HSP 1 Score: 275.018 bits (702), Expect = 1.159e-79
Identity = 177/570 (31.05%), Postives = 291/570 (51.05%), Query Frame = 1
Query:  253 NFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSGKSLCYQLASMIS-GFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRLVIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNEN-CKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKSGI--------PNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKN----MCSVCADT-ESEMSSIDIADVYKSALTIIKNI----------------EKTKNPKITGKKIISE-LANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYL--KLDYSFGSFSNFTYVIAGSK---TLKSNEKIDIPIRIAKSDKMRNLV 1851
            +FP +  +    ++ F +  F+  Q + IN+TL+  D   I   G GKSLCYQL ++I+ G T+VI+PL SLI DQ+   ++  I    L  +      ++I   +++     +  KL+Y TP+K+  S+KL    +     K L R VIDE HC S+  HDFR  Y+ L  L++ +PN+P++ LTATA   V  DI   L + ++      ++NR N+ +E++     KK   EI  L+ ++F  QSGIV+C ++ +C+ + + +  +G+   +Y+  +    +K +   W+NEN CK++VAT AFGMGIDKP+VRFV+H S+ KS+E +YQE+GRAGRDG  + C+LF+   +  ++   I+++ SG           L +M  Y  +   C+R  + +   E F    C      +C  C ++ ++++   D+ D  K+ +  +  I                    N KI  K+  +  L    S++  + A RF            F HLV  GYL  K+  +   F    +V+ G K    L  N  + +PI   ++ K ++ V
Sbjct:  309 DFPHTERMMIAFKEVFGLNGFRRNQKEAINSTLNGFDTFVIMPTGGGKSLCYQLPAVITEGVTIVISPLKSLIHDQVTKLQELDIVATHLSGDLKEAEVDKILLQLQSQ---FMQIKLLYVTPEKVVESRKLMNVFQSLNQRKLLSRFVIDEAHCVSQWGHDFRPHYRLLGVLRTTFPNVPMIALTATATTKVREDILYQLKMKNNTKWFIQSFNRGNLRWEIR-PKTAKKCISEIINLVNAKFRDQSGIVYCLSRNECDEVASVMAQSGLKCQAYHAGMSDTKRKQVQEMWINENGCKIVVATIAFGMGIDKPDVRFVVHYSIPKSIEGFYQETGRAGRDGLPATCVLFYSWTDVVRMRKLIYSDNSGTVETKKQHEQQLFLMVSYCENLIDCRRTQVLNHFGEHFDRKLCGAVKGCICDNCQNSNDNKVVMRDLTDHAKAVVKYVMEISNVGWGSTLNYVLDVFRGANNAKIVEKQGANNWLYGTGSVFSKNDAERF------------FHHLVFEGYLWEKMVVTQADFV-VAHVVPGPKHQLLLSGNATVQMPISKPRTTKDKDKV 861          
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Match: SMESG000028029.1 (SMESG000028029.1)

HSP 1 Score: 209.92 bits (533), Expect = 2.669e-57
Identity = 151/425 (35.53%), Postives = 225/425 (52.94%), Query Frame = 1
Query:  283 LLQDKFKIKNFKS-LQLKTINATLDKLDCIFISSP-GSGKSLCYQLASMI--SGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKIQNEIFKAMETDPV--DNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVR-LVIDEIHCCSELSHDFRQDYKNLHGLKS-LYPNLPVLGLTATANNSVINDIKTTLNLNSDCLVHKDNYNRSNIFYEVKF---LSNEKKE-GEEICKLIKSRF-------DGQSGIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCKVIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCILFWKLAEYFKIGSNIFTEKS-----GIPNLNIMNRYILDDCTCKRVSLSSILDEKFTVNDCKNMCSVCAD 1485
            +L+  F+   FKS LQ + I   +   + +FIS P GSGKSLCYQ  ++   +G +++I+PL +LI DQ++   K  I   +++S S V  +NE+   + T     D    +L+Y TP++   S    + I K+   K L+   VIDE HC SE  HDFR DY  L  L+S L  N+P + LTATAN  V  DI   LN  +        + R NIFY+VKF   L++ K+   + I K +           D  S IV+C  ++ CE +   L + G+ A  Y+  +   I+++I   W+N    ++ AT +FGMG+DK NVR V H ++ KSL  YYQESGRAGRDGK S   +++  +E   I   I  +K          L IM  YI +   C+ + ++   +++FT   CK +C  C +
Sbjct:    9 VLKHTFQFDEFKSPLQKEAIENIIHSKNDVFISMPTGSGKSLCYQFPAVYFETGVSIIISPLLALIHDQILHLSKRNICARTINSKSKVDERNEVISDLTTFNCFKDATKIRLLYVTPEQCQTS--TFQNIAKSLSKKNLLNYFVIDEAHCLSEWGHDFRPDYLKLGQLRSTLLNNIPCIALTATANKKVSEDIIKCLNFKNHKTFRMPVF-RDNIFYDVKFTDLLTDSKRHIFDFIFKCLGCPTSNNCNWNDIGSCIVYCRKREHCEEMALLLTSYGLQAKPYHAGIKQSIREEIQLDWINGKFPIVAATISFGMGVDKSNVRVVCHWTIPKSLTAYYQESGRAGRDGKLSYSRIYYDPSETNTITFLINKQKEKERVKANAWLQIMRDYI-EIPKCRHLRIAEHFNDEFTA--CKTLCDFCTN 427          
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Match: SMESG000064968.1 (SMESG000064968.1)

HSP 1 Score: 172.555 bits (436), Expect = 5.736e-50
Identity = 88/148 (59.46%), Postives = 112/148 (75.68%), Query Frame = 1
Query: 1465 MCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKKIISELANQMSLYFADLANRFPG-IDYKLFLDKAFCHLVLVGYLKLDYSFGSFSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKSYLKR 1905
            MCS+C DTES MS +DI DV KSAL II N++K+KNP ITG K++ ELANQM+LY  DL NRFPG ID KLF DKA C+L+  GYLKL++ FGSF+N+TY+++G KTL S EKI+  IRI  SD   NL +N + ++S  ++KS LKR
Sbjct:    1 MCSICTDTESTMSPVDITDVCKSALAIIDNVKKSKNPNITGNKLVGELANQMNLYSTDLINRFPGIIDIKLFFDKAICYLIHEGYLKLNFHFGSFTNYTYIVSGKKTLASEEKINFSIRIPISDLKINL-ENSEVSKSGKLEKSSLKR 147          
The following BLAST results are available for this feature:
BLAST of ATP-dependent DNA helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RECQL4.787e-13340.39RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:99... [more]
RECQL4.787e-13340.39RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:99... [more]
BLM1.366e-8237.19BLM RecQ like helicase [Source:HGNC Symbol;Acc:HGN... [more]
BLM1.733e-8237.19BLM RecQ like helicase [Source:HGNC Symbol;Acc:HGN... [more]
BLM1.822e-8237.64BLM RecQ like helicase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K02F3.121.676e-13137.70Putative ATP-dependent DNA helicase Q1 [Source:Un... [more]
K02F3.121.676e-13137.70Putative ATP-dependent DNA helicase Q1 [Source:Un... [more]
K02F3.124.620e-13137.70Putative ATP-dependent DNA helicase Q1 [Source:Un... [more]
him-61.633e-7533.85Bloom syndrome protein homolog [Source:UniProtKB/... [more]
rcq-51.673e-5831.90ATP-dependent DNA helicase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Blm4.041e-7735.23gene:FBgn0002906 transcript:FBtr0082434[more]
RecQ56.942e-5328.60gene:FBgn0027375 transcript:FBtr0100362[more]
RecQ58.011e-5328.60gene:FBgn0027375 transcript:FBtr0075714[more]
RecQ53.129e-5028.76gene:FBgn0027375 transcript:FBtr0075715[more]
RecQ42.355e-3430.73gene:FBgn0040290 transcript:FBtr0076729[more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
recql3.228e-11036.20RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-05080... [more]
recql3.228e-11036.20RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-05080... [more]
recql1.188e-10836.02RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-05080... [more]
recql7.355e-10534.71RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-05080... [more]
blm4.834e-8639.04BLM RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
recql5.827e-11835.93RecQ like helicase [Source:NCBI gene;Acc:549070][more]
recql3.014e-11736.85RecQ like helicase [Source:NCBI gene;Acc:549070][more]
recql2.777e-11636.59RecQ like helicase [Source:NCBI gene;Acc:549070][more]
recql2.859e-11636.99RecQ like helicase [Source:NCBI gene;Acc:549070][more]
blm3.057e-7936.38Bloom syndrome RecQ like helicase [Source:NCBI gen... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Recql1.166e-13439.37RecQ protein-like [Source:MGI Symbol;Acc:MGI:10302... [more]
Recql1.631e-13439.37RecQ protein-like [Source:MGI Symbol;Acc:MGI:10302... [more]
Recql1.732e-13439.37RecQ protein-like [Source:MGI Symbol;Acc:MGI:10302... [more]
Blm7.880e-8638.08Bloom syndrome, RecQ like helicase [Source:MGI Sym... [more]
Blm8.571e-8638.08Bloom syndrome, RecQ like helicase [Source:MGI Sym... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYJ1|RECQ1_RAT1.706e-13438.64ATP-dependent DNA helicase Q1 OS=Rattus norvegicus... [more]
sp|Q9Z129|RECQ1_MOUSE1.211e-13339.37ATP-dependent DNA helicase Q1 OS=Mus musculus OX=1... [more]
sp|P46063|RECQ1_HUMAN2.299e-13240.39ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9... [more]
sp|Q5RF63|RECQ1_PONAB1.855e-13140.47ATP-dependent DNA helicase Q1 OS=Pongo abelii OX=9... [more]
sp|Q9TXJ8|RECQ1_CAEEL5.877e-13037.70Putative ATP-dependent DNA helicase Q1 OS=Caenorha... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9G2Y59.329e-13537.91ATP-dependent DNA helicase OS=Daphnia pulex OX=666... [more]
J3S4956.572e-13439.06ATP-dependent DNA helicase OS=Crotalus adamanteus ... [more]
A0A091T4B17.639e-13440.39ATP-dependent DNA helicase (Fragment) OS=Phaethon ... [more]
A0A3Q0CWF01.111e-13339.77ATP-dependent DNA helicase OS=Mesocricetus auratus... [more]
A0A091RGT01.689e-13340.07ATP-dependent DNA helicase (Fragment) OS=Mesitorni... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
recql1.487e-11736.86RecQ like helicase [Source:NCBI gene;Acc:103027659... [more]
recql2.278e-11437.41RecQ like helicase [Source:NCBI gene;Acc:103027659... [more]
recql2.665e-11437.41RecQ like helicase [Source:NCBI gene;Acc:103027659... [more]
blm4.526e-8637.02BLM RecQ like helicase [Source:NCBI gene;Acc:10304... [more]
recql53.167e-5932.55RecQ like helicase 5 [Source:NCBI gene;Acc:1030316... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
recql3.503e-11434.14RecQ helicase-like [Source:ZFIN;Acc:ZDB-GENE-05080... [more]
blm5.807e-8635.68BLM RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
recql53.240e-6431.55RecQ helicase-like 5 [Source:ZFIN;Acc:ZDB-GENE-071... [more]
ENSPMAT00000005409.12.750e-1730.38pep scaffold:Pmarinus_7.0:GL485130:385:11513:1 gen... [more]
DDX419.013e-827.00DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SGS19.515e-8333.52RecQ family nucleolar DNA helicase; role in genome... [more]
HRQ17.433e-1625.433'-5' DNA helicase that has DNA strand annealing a... [more]
FAL11.500e-1223.70Nucleolar protein required for maturation of 18S r... [more]
DBP21.976e-820.83ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP32.932e-823.56RNA-Dependent ATPase, member of DExD/H-box family;... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326321.057e-12636.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340914.651e-6735.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255203.985e-4437.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO325371.860e-3428.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332871.872e-3136.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
recql2.729e-11335.55RecQ like helicase [Source:NCBI gene;Acc:101164117... [more]
recql2.729e-11335.55RecQ like helicase [Source:NCBI gene;Acc:101164117... [more]
recql2.729e-11335.55RecQ like helicase [Source:NCBI gene;Acc:101164117... [more]
recql3.932e-11034.41RecQ like helicase [Source:NCBI gene;Acc:101164117... [more]
blm1.117e-8135.06BLM RecQ like helicase [Source:NCBI gene;Acc:10004... [more]
back to top
BLAST of ATP-dependent DNA helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064966.10.000e+098.54SMESG000064966.1[more]
SMESG000064967.11.101e-15461.18SMESG000064967.1[more]
SMESG000060148.11.159e-7931.05SMESG000060148.1[more]
SMESG000028029.12.669e-5735.53SMESG000028029.1[more]
SMESG000064968.15.736e-5059.46SMESG000064968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018991 ID=SMED30018991|Name=ATP-dependent DNA helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=2149bp
AAATAATTGAATAACTTATTAATTATTTTATAAAATCAGGATCTTAATTT
TTTTGTGAATTAGCTTATTTTATTCCAAAATTTTTAGAACTCAATGAACA
ATTCCTCTGAAATTGATAAAAGAATTGTTGCTATAGATAATGAAATTAAA
ACTCTTACACATGAAAAAGAAGATTTAATTAAAAAAAAGAAACAGTTATC
TATATCCACGAAAGGACACTCGATTACTTCAAATAAAGATTATGGAAAAG
AAAATTTTCCATGGTCATCAAATATTAAGAAGTTGTTGCAAGATAAATTT
AAAATTAAAAACTTTAAATCATTACAATTGAAAACTATTAATGCCACTTT
GGATAAATTAGATTGTATATTTATATCGTCACCCGGCAGTGGAAAGAGCT
TATGTTACCAATTAGCGTCAATGATTTCAGGATTTACGCTGGTTATTGCT
CCACTGGGTTCATTGATACAGGATCAAATGATTGTATCAGAAAAGTTTGG
TATATCATGTATTTCTCTTGATTCTAACAGTTCTGTAAAAATACAGAATG
AAATATTTAAAGCCATGGAAACTGATCCGGTAGATAATGTAACATATAAA
TTGATTTACACAACTCCGGATAAGATTTCAAACAGTAAAAAACTGACGAA
AGCCATTGAAAAAGCTTATGGTGATAAACGTTTAGTAAGACTGGTTATAG
ACGAAATACATTGCTGCAGTGAATTAAGTCATGATTTTCGTCAAGATTAT
AAAAACCTTCATGGATTGAAATCTCTTTATCCAAATCTGCCAGTTCTTGG
TTTGACAGCAACTGCCAATAATTCTGTAATCAATGATATAAAAACGACTT
TAAATTTGAATTCTGACTGCTTAGTTCATAAAGACAATTATAATCGATCA
AATATCTTCTATGAAGTAAAGTTTTTATCAAATGAAAAAAAAGAAGGTGA
AGAAATTTGTAAATTGATAAAAAGTCGATTTGATGGCCAATCAGGAATTG
TGTTTTGCTTTAATCAAAAAGACTGTGAAAATCTCACTAATGAGCTTGTA
AATAATGGGATTTTAGCATCTTCATATTATGGAACATTGGGATATGATAT
TAAAAAGGATATTCATAATAAATGGCTTAATGAAAATTGCAAGGTAATTG
TGGCCACAAATGCATTCGGAATGGGCATCGATAAACCAAACGTGAGGTTT
GTCATCCATATGTCTATGAGTAAAAGCTTAGAGAATTACTATCAAGAATC
TGGTAGAGCAGGCCGTGACGGTAAAAGATCCGATTGTATTTTGTTCTGGA
AATTAGCAGAATACTTCAAAATTGGTTCAAATATATTTACTGAAAAATCT
GGAATCCCAAATCTTAATATTATGAATCGATATATTTTGGATGATTGCAC
CTGCAAACGGGTATCTCTGTCTTCGATCTTAGATGAAAAATTTACAGTAA
ATGATTGCAAAAATATGTGTTCAGTTTGTGCAGATACTGAATCTGAAATG
TCATCAATCGATATTGCTGATGTTTACAAATCCGCATTGACAATTATTAA
GAACATAGAAAAAACCAAAAATCCAAAAATTACTGGCAAGAAAATAATAT
CAGAACTGGCCAATCAAATGAGTTTATATTTCGCTGATTTGGCTAATCGA
TTTCCTGGAATCGATTATAAATTGTTTCTTGACAAAGCATTTTGTCATTT
GGTTCTTGTTGGCTATCTGAAACTGGATTATAGTTTTGGTTCTTTCAGTA
ATTTCACTTATGTAATTGCCGGAAGTAAAACTCTGAAATCAAACGAAAAA
ATCGATATTCCAATCCGAATCGCTAAATCGGATAAAATGAGAAATCTCGT
TCAAAATGTCAAACAAAATGAATCATCGAATGTCAAGAAAAGTTATTTGA
AACGGCTTTTCAAAGGTTCGAATGATGATATTGTCGAAACGAAAATTCTA
AAACGTTAAGGAAACTGAAATTTTGTTTGTAATTGTGCAATTATTTATTT
TCTATGTCTAATCACGGTTGCCATGAATTTGGGGTAGCGGTTATTTTTAT
GTATTTCTGATAGTGTAATTTTGTACGAATATTATACGAATATCACAATT
TATGTAACTTTTCTCTTTGTAATAAAATTTATTTTCGTCTTTAATCAAA
back to top

protein sequence of SMED30018991-orf-1

>SMED30018991-orf-1 ID=SMED30018991-orf-1|Name=SMED30018991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=622bp
MNNSSEIDKRIVAIDNEIKTLTHEKEDLIKKKKQLSISTKGHSITSNKDY
GKENFPWSSNIKKLLQDKFKIKNFKSLQLKTINATLDKLDCIFISSPGSG
KSLCYQLASMISGFTLVIAPLGSLIQDQMIVSEKFGISCISLDSNSSVKI
QNEIFKAMETDPVDNVTYKLIYTTPDKISNSKKLTKAIEKAYGDKRLVRL
VIDEIHCCSELSHDFRQDYKNLHGLKSLYPNLPVLGLTATANNSVINDIK
TTLNLNSDCLVHKDNYNRSNIFYEVKFLSNEKKEGEEICKLIKSRFDGQS
GIVFCFNQKDCENLTNELVNNGILASSYYGTLGYDIKKDIHNKWLNENCK
VIVATNAFGMGIDKPNVRFVIHMSMSKSLENYYQESGRAGRDGKRSDCIL
FWKLAEYFKIGSNIFTEKSGIPNLNIMNRYILDDCTCKRVSLSSILDEKF
TVNDCKNMCSVCADTESEMSSIDIADVYKSALTIIKNIEKTKNPKITGKK
IISELANQMSLYFADLANRFPGIDYKLFLDKAFCHLVLVGYLKLDYSFGS
FSNFTYVIAGSKTLKSNEKIDIPIRIAKSDKMRNLVQNVKQNESSNVKKS
YLKRLFKGSNDDIVETKILKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR011991WHTH_DNA-bd_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003678DNA helicase activity
GO:0004003ATP-dependent DNA helicase activity
GO:0004386helicase activity
GO:0005515protein binding
GO:0008026ATP-dependent helicase activity
GO:0009378four-way junction helicase activity
GO:0016787hydrolase activity
GO:0036310annealing helicase activity
GO:0043140ATP-dependent 3'-5' DNA helicase activity
Vocabulary: biological process
TermDefinition
GO:0000724double-strand break repair via homologous recombination
GO:0000733DNA strand renaturation
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0032508DNA duplex unwinding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0005737cytoplasm
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 254..262
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..106
e-value: 1.3E-28
score: 101.9
NoneNo IPR availablePANTHERPTHR13710DNA HELICASE RECQ FAMILY MEMBERcoord: 1..209
NoneNo IPR availableCDDcd18794SF2_C_RecQcoord: 1..43
e-value: 1.51139E-26
score: 98.4348
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 2..33
e-value: 6.6E-6
score: 26.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 1..73
score: 10.22
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 109..219
e-value: 8.7E-8
score: 34.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..119