prefoldin subunit 2

Overview
Nameprefoldin subunit 2
Smed IDSMED30018984
Length (bp)514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of prefoldin subunit 2 (SMED30018984) t-SNE clustered cells

Violin plots show distribution of expression levels for prefoldin subunit 2 (SMED30018984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of prefoldin subunit 2 (SMED30018984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for prefoldin subunit 2 (SMED30018984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v4_1368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30018984SMESG000075156.1 SMESG000075150.1 dd_Smed_v6_1368_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of prefoldin subunit 2 vs. Ensembl Human
Match: PFDN2 (prefoldin subunit 2 [Source:HGNC Symbol;Acc:HGNC:8867])

HSP 1 Score: 116.701 bits (291), Expect = 3.163e-33
Identity = 63/139 (45.32%), Postives = 91/139 (65.47%), Query Frame = 3
Query:   69 SDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-GSEKTEQKVESKEG----AASSGVLVS 470
            + K A S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ++K+IE +      K K++  F+EKH I+  G ++     E+ EG    A+S+GVLVS
Sbjct:   16 AGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS 154          
BLAST of prefoldin subunit 2 vs. Ensembl Celegans
Match: pfd-2 (Prefoldin subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5M2])

HSP 1 Score: 67.0106 bits (162), Expect = 1.664e-14
Identity = 36/108 (33.33%), Postives = 67/108 (62.04%), Query Frame = 3
Query:   90 QQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEK 413
            Q+++  +F+++  +Q+ +A +++ +E E RE G V++V+ +   D+KCFR +   LVE TVK+V+P LQ N   L  + + +N+   +K K++   K  H I+  +EK
Sbjct:   17 QRKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEPDQKCFRLISDTLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRLLTEK 124          
BLAST of prefoldin subunit 2 vs. Ensembl Fly
Match: Pfdn2 (gene:FBgn0010741 transcript:FBtr0076238)

HSP 1 Score: 106.301 bits (264), Expect = 1.510e-29
Identity = 56/118 (47.46%), Postives = 81/118 (68.64%), Query Frame = 3
Query:   57 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSE 410
            MS +S K A SQ+ I  +FQ +  EQ+ + N L+ LEM+LREH  VI+ L  A+ +RKCFR +GGVL E+TVKEVLP L EN++ + K I+++ N+ ++K  ++  FKE+H IK   E
Sbjct:    1 MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGE 118          
BLAST of prefoldin subunit 2 vs. Ensembl Fly
Match: Pfdn2 (gene:FBgn0010741 transcript:FBtr0332708)

HSP 1 Score: 106.301 bits (264), Expect = 1.510e-29
Identity = 56/118 (47.46%), Postives = 81/118 (68.64%), Query Frame = 3
Query:   57 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSE 410
            MS +S K A SQ+ I  +FQ +  EQ+ + N L+ LEM+LREH  VI+ L  A+ +RKCFR +GGVL E+TVKEVLP L EN++ + K I+++ N+ ++K  ++  FKE+H IK   E
Sbjct:    1 MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGE 118          
BLAST of prefoldin subunit 2 vs. Ensembl Zebrafish
Match: pfdn2 (prefoldin subunit 2 [Source:ZFIN;Acc:ZDB-GENE-060519-27])

HSP 1 Score: 112.464 bits (280), Expect = 9.259e-32
Identity = 57/140 (40.71%), Postives = 89/140 (63.57%), Query Frame = 3
Query:   75 KNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQ------KVESKEGAA--SSGVLVS 470
            ++  S +++   FQ M  EQ++MA+K +E EME+ EH LVI  L E +  RKCFR +GGVLVE+TVKEVLP L+ N+EQ+ K++E +N     K +++  ++E++ I+   E  +Q      + +  EG +   +GVLVS
Sbjct:   17 QSTPSAEQVVATFQRMRQEQRSMASKAAEFEMEINEHSLVIDTLKEVDPSRKCFRLVGGVLVERTVKEVLPALENNKEQISKIVETLNTQMQVKGRELTEYRERYNIRLVGEDDKQGKADASQAKDSEGGSKGGAGVLVS 156          
BLAST of prefoldin subunit 2 vs. Ensembl Zebrafish
Match: pfdn2 (prefoldin subunit 2 [Source:ZFIN;Acc:ZDB-GENE-060519-27])

HSP 1 Score: 112.464 bits (280), Expect = 9.259e-32
Identity = 57/140 (40.71%), Postives = 89/140 (63.57%), Query Frame = 3
Query:   75 KNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQ------KVESKEGAA--SSGVLVS 470
            ++  S +++   FQ M  EQ++MA+K +E EME+ EH LVI  L E +  RKCFR +GGVLVE+TVKEVLP L+ N+EQ+ K++E +N     K +++  ++E++ I+   E  +Q      + +  EG +   +GVLVS
Sbjct:   17 QSTPSAEQVVATFQRMRQEQRSMASKAAEFEMEINEHSLVIDTLKEVDPSRKCFRLVGGVLVERTVKEVLPALENNKEQISKIVETLNTQMQVKGRELTEYRERYNIRLVGEDDKQGKADASQAKDSEGGSKGGAGVLVS 156          
BLAST of prefoldin subunit 2 vs. Ensembl Xenopus
Match: kdm4b (lysine (K)-specific demethylase 4B [Source:Xenbase;Acc:XB-GENE-1012886])

HSP 1 Score: 108.612 bits (270), Expect = 2.723e-30
Identity = 63/145 (43.45%), Postives = 89/145 (61.38%), Query Frame = 3
Query:   57 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKEGA-------ASSGVLVS 470
            M+  + K   ++Q +   F  +  EQ+ +A+K +ELEMEL EH LVI  L E    RKCFR +GGVLVE+TVKEVLP L+ N+EQ+ K++E ++     K +++  F+EKH I+   E  E K   KEG        +S+GVLVS
Sbjct:    1 MASNAAKQVAAEQ-VVAGFNRLRQEQRGLASKAAELEMELNEHTLVIDTLKEVEQGRKCFRMVGGVLVERTVKEVLPALENNKEQINKILESLSTQLQTKGRELNEFREKHNIRIMGE-DEAKQPPKEGGDSDGSKPSSAGVLVS 143          
BLAST of prefoldin subunit 2 vs. Ensembl Xenopus
Match: kdm4b (lysine (K)-specific demethylase 4B [Source:Xenbase;Acc:XB-GENE-1012886])

HSP 1 Score: 107.071 bits (266), Expect = 1.277e-29
Identity = 60/127 (47.24%), Postives = 81/127 (63.78%), Query Frame = 3
Query:  111 FQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKEGA-------ASSGVLVS 470
            F  +  EQ+ +A+K +ELEMEL EH LVI  L E    RKCFR +GGVLVE+TVKEVLP L+ N+EQ+ K++E ++     K +++  F+EKH I+   E  E K   KEG        +S+GVLVS
Sbjct:   14 FNRLRQEQRGLASKAAELEMELNEHTLVIDTLKEVEQGRKCFRMVGGVLVERTVKEVLPALENNKEQINKILESLSTQLQTKGRELNEFREKHNIRIMGE-DEAKQPPKEGGDSDGSKPSSAGVLVS 139          
BLAST of prefoldin subunit 2 vs. Ensembl Xenopus
Match: kdm4b (lysine (K)-specific demethylase 4B [Source:Xenbase;Acc:XB-GENE-1012886])

HSP 1 Score: 91.2781 bits (225), Expect = 1.549e-23
Identity = 56/127 (44.09%), Postives = 78/127 (61.42%), Query Frame = 3
Query:  111 FQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKEGA-------ASSGVLVS 470
            F  +  EQ+ +A+K +ELEM+  E   VI  L E    RKCFR +GGVLVE+TVKEVLP L+ N+EQ+ K++E ++     K +++  F+EKH I+   E  E K   KEG        +S+GVLVS
Sbjct:   14 FNRLRQEQRGLASKAAELEMDNEESFNVI--LPEVEQGRKCFRMVGGVLVERTVKEVLPALENNKEQINKILESLSTQLQTKGRELNEFREKHNIRIMGE-DEAKQPPKEGGDSDGSKPSSAGVLVS 137          
BLAST of prefoldin subunit 2 vs. Ensembl Mouse
Match: Pfdn2 (prefoldin 2 [Source:MGI Symbol;Acc:MGI:1276111])

HSP 1 Score: 114.005 bits (284), Expect = 2.411e-32
Identity = 61/133 (45.86%), Postives = 89/133 (66.92%), Query Frame = 3
Query:   87 SQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-GSEKTEQKVESKEG----AASSGVLVS 470
            S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ++K+IE ++     K K++  F+EKH I+  G ++     E+ EG    A+S+GVLVS
Sbjct:   22 SAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS 154          
BLAST of prefoldin subunit 2 vs. Ensembl Mouse
Match: Pfdn2 (prefoldin 2 [Source:MGI Symbol;Acc:MGI:1276111])

HSP 1 Score: 82.8037 bits (203), Expect = 1.721e-20
Identity = 40/75 (53.33%), Postives = 54/75 (72.00%), Query Frame = 3
Query:   87 SQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQ 311
            S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ
Sbjct:   16 SAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALEGNKEQ 90          
BLAST of prefoldin subunit 2 vs. UniProt/SwissProt
Match: sp|Q9UHV9|PFD2_HUMAN (Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.519e-32
Identity = 63/139 (45.32%), Postives = 91/139 (65.47%), Query Frame = 3
Query:   69 SDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-GSEKTEQKVESKEG----AASSGVLVS 470
            + K A S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ++K+IE +      K K++  F+EKH I+  G ++     E+ EG    A+S+GVLVS
Sbjct:   16 AGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS 154          
BLAST of prefoldin subunit 2 vs. UniProt/SwissProt
Match: sp|A1A4P5|PFD2_BOVIN (Prefoldin subunit 2 OS=Bos taurus OX=9913 GN=PFDN2 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.569e-32
Identity = 63/139 (45.32%), Postives = 91/139 (65.47%), Query Frame = 3
Query:   69 SDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-GSEKTEQKVESKEG----AASSGVLVS 470
            + K A S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ++K+IE +      K K++  F+EKH I+  G ++     E+ EG    A+S+GVLVS
Sbjct:   16 TGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS 154          
BLAST of prefoldin subunit 2 vs. UniProt/SwissProt
Match: sp|B0BN18|PFD2_RAT (Prefoldin subunit 2 OS=Rattus norvegicus OX=10116 GN=Pfdn2 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.082e-31
Identity = 62/135 (45.93%), Postives = 90/135 (66.67%), Query Frame = 3
Query:   81 AKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-GSEKTEQKVESKEGA----ASSGVLVS 470
            A S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ++K+IE ++     K K++  F+EKH I+  G ++     E+ EGA    +S+GVLVS
Sbjct:   20 AVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKSSSAGVLVS 154          
BLAST of prefoldin subunit 2 vs. UniProt/SwissProt
Match: sp|O70591|PFD2_MOUSE (Prefoldin subunit 2 OS=Mus musculus OX=10090 GN=Pfdn2 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.687e-31
Identity = 61/133 (45.86%), Postives = 89/133 (66.92%), Query Frame = 3
Query:   87 SQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-GSEKTEQKVESKEG----AASSGVLVS 470
            S +++   F  +  EQ+ +A+K +ELEMEL EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ++K+IE ++     K K++  F+EKH I+  G ++     E+ EG    A+S+GVLVS
Sbjct:   22 SAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS 154          
BLAST of prefoldin subunit 2 vs. UniProt/SwissProt
Match: sp|Q9VTE5|PFD2_DROME (Probable prefoldin subunit 2 OS=Drosophila melanogaster OX=7227 GN=Pfdn2 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.514e-28
Identity = 56/118 (47.46%), Postives = 81/118 (68.64%), Query Frame = 3
Query:   57 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSE 410
            MS +S K A SQ+ I  +FQ +  EQ+ + N L+ LEM+LREH  VI+ L  A+ +RKCFR +GGVL E+TVKEVLP L EN++ + K I+++ N+ ++K  ++  FKE+H IK   E
Sbjct:    1 MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGE 118          
BLAST of prefoldin subunit 2 vs. TrEMBL
Match: A0A4Y7MVI6 (EOG090X0L97 OS=Daphnia pulex OX=6669 GN=EOG090X0L97 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.443e-32
Identity = 70/145 (48.28%), Postives = 94/145 (64.83%), Query Frame = 3
Query:   60 SKKSDKNA-----KSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEK----TEQKVESKEGAASSGVLV 467
            SKK  KNA     KS +E+   FQ +  EQ+ +A+KLSELEM+L EH LVI+ L   + DRKCFR +GGVLVE+TVKEVLP L  N +Q+ K+IEV+NN  + K ++I  FKEK+ I+  ++     T    E +   A+ GVLV
Sbjct:    6 SKKQAKNAPKNVSKSNEEVIQGFQRLRTEQRQLASKLSELEMDLNEHKLVIETLQNVDEDRKCFRMVGGVLVERTVKEVLPALTSNRDQMTKVIEVLNNQISTKGQEINDFKEKNNIRIRNQNELPSTAPDNEGENKVANQGVLV 150          
BLAST of prefoldin subunit 2 vs. TrEMBL
Match: E9H6W9 (EOG090X0L97 OS=Daphnia pulex OX=6669 GN=EOG090X0L97 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.443e-32
Identity = 70/145 (48.28%), Postives = 94/145 (64.83%), Query Frame = 3
Query:   60 SKKSDKNA-----KSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEK----TEQKVESKEGAASSGVLV 467
            SKK  KNA     KS +E+   FQ +  EQ+ +A+KLSELEM+L EH LVI+ L   + DRKCFR +GGVLVE+TVKEVLP L  N +Q+ K+IEV+NN  + K ++I  FKEK+ I+  ++     T    E +   A+ GVLV
Sbjct:    6 SKKQAKNAPKNVNKSNEEVIQGFQRLRTEQRQLASKLSELEMDLNEHKLVIETLQNVDEDRKCFRMVGGVLVERTVKEVLPALTSNRDQMTKVIEVLNNQISTKGQEINDFKEKNNIRIRNQNELPSTAPDNEGENKVANQGVLV 150          
BLAST of prefoldin subunit 2 vs. TrEMBL
Match: A0A4Y7MYX2 (EOG090X0L97 OS=Daphnia pulicaria OX=35523 GN=EOG090X0L97 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 7.204e-32
Identity = 68/141 (48.23%), Postives = 93/141 (65.96%), Query Frame = 3
Query:   60 SKKSDKNA-KSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEK----TEQKVESKEGAASSGVLV 467
            +K S KN  KS +E+   FQ +  EQ+ +A+KLSELEM+L EH LVI+ L   + DRKCFR +GGVLVE+TVKEVLP L  N +Q+ K+IEV+NN  + K ++I  FKEK+ I+  ++     T    E +   A+ GVLV
Sbjct:   10 AKNSPKNVNKSNEEVIQGFQRLRTEQRQLASKLSELEMDLNEHKLVIETLQNVDEDRKCFRMVGGVLVERTVKEVLPALTSNRDQMAKVIEVLNNQISTKGQEINDFKEKNNIRIRNQNELPSTAPDNEGENKVANQGVLV 150          
BLAST of prefoldin subunit 2 vs. TrEMBL
Match: A0A4Y7M2V7 (EOG090X0L97 OS=Daphnia dolichocephala OX=2282166 GN=EOG090X0L97 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.120e-31
Identity = 70/147 (47.62%), Postives = 94/147 (63.95%), Query Frame = 3
Query:   60 SKKSDKN-----AKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIK------FGSEKTEQKVESKEGAASSGVLV 467
            SKK  KN     +KS +E+   FQ +  EQ+ +A+KLSELEM+L EH LVI+ L   ++DRKCFR +GGVLVE+TVKEVLP L  N +Q+ K+IEV+NN    K ++I  FKEK+ I+        S   +   E+K   A+ GVLV
Sbjct:    6 SKKQTKNVPKVASKSNEEVIQGFQRLRTEQRQLASKLSELEMDLNEHKLVIETLQNVDADRKCFRMVGGVLVERTVKEVLPALTSNRDQMTKVIEVLNNQITAKGQEINDFKEKNNIRIRNQNELPSAAPDNDGENK--VANQGVLV 150          
BLAST of prefoldin subunit 2 vs. TrEMBL
Match: A0A4Y7M8H7 (EOG090X0L97 OS=Daphnia longispina OX=42846 GN=EOG090X0L97 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 3.554e-31
Identity = 68/145 (46.90%), Postives = 94/145 (64.83%), Query Frame = 3
Query:   60 SKKSDKNA-----KSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKV----ESKEGAASSGVLV 467
            SKK+ K A     KS +E+   FQ +  EQ+ +A+KLSELEM+L EH LVI+ L   ++DRKCFR +GGVLVE+TVKEVLP L  N++Q+ K+IEV+NN    K ++I  FKEK+ I+  ++   Q      E +    + GVLV
Sbjct:    6 SKKTAKTAPKHANKSNEEVIQGFQRLRTEQRQLASKLSELEMDLNEHKLVIETLQNVDADRKCFRMVGGVLVERTVKEVLPALTSNKDQMTKVIEVLNNQITTKGQEINDFKEKNNIRIRNQNELQSAAPDNEGENKVTNQGVLV 150          
BLAST of prefoldin subunit 2 vs. Ensembl Cavefish
Match: pfdn2 (prefoldin subunit 2 [Source:NCBI gene;Acc:103037669])

HSP 1 Score: 115.546 bits (288), Expect = 4.287e-33
Identity = 63/138 (45.65%), Postives = 89/138 (64.49%), Query Frame = 3
Query:   87 SQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEK-------TEQKVESKEGAAS---SGVLVS 470
            S +++   FQ M  EQ++MA K +ELEME+ EH LVI  L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ+ K++E +N     K +++  ++E++ I+  SE        T Q  ES EGA S   +GVLVS
Sbjct:   18 SPEQVVATFQRMRQEQRSMAAKSAELEMEINEHSLVIDTLKEVDPTRKCYRLVGGVLVERTVKEVLPALENNKEQISKIVETLNTQMQTKGRELTEYRERYNIRLVSEDDRQGKGNTSQSKES-EGAGSKSGAGVLVS 154          
BLAST of prefoldin subunit 2 vs. Ensembl Cavefish
Match: PFDN2 (prefoldin subunit 2-like [Source:NCBI gene;Acc:103029369])

HSP 1 Score: 99.3673 bits (246), Expect = 1.111e-26
Identity = 44/105 (41.90%), Postives = 71/105 (67.62%), Query Frame = 3
Query:   87 SQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF 401
            S +++   FQ +  EQ++MA K +ELEME+ EH LVI  L E +  RKC+R +GGVLVE+TV EVLP L+ N+ Q+ K+++ + +    K K++  ++E++ I+ 
Sbjct:   28 SAEQVVAGFQRLRQEQRSMATKAAELEMEISEHSLVIDALKEVDPSRKCYRLIGGVLVERTVSEVLPALENNKGQISKIVDSLGSQMQTKGKELNEYRERYNIRI 132          
BLAST of prefoldin subunit 2 vs. Ensembl Yeast
Match: GIM4 (Subunit of the heterohexameric cochaperone prefoldin complex; complex binds specifically to cytosolic chaperonin and transfers target proteins to it [Source:SGD;Acc:S000000729])

HSP 1 Score: 57.3806 bits (137), Expect = 7.545e-12
Identity = 34/102 (33.33%), Postives = 56/102 (54.90%), Query Frame = 3
Query:   93 QEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIK 398
            Q  +NE++ +L E   +  K+ EL  +  EH +VIK L +A   RKC+R +GG LVE  V+  LP L+  +E ++  I  +     Q  K+   +K+ + I+
Sbjct:    9 QAKYNEYKQILEE---LQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALVESDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKIQ 107          
BLAST of prefoldin subunit 2 vs. Ensembl Nematostella
Match: EDO28349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6Q6])

HSP 1 Score: 72.7886 bits (177), Expect = 1.426e-17
Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 3
Query:   63 KKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQEN 302
            K +DK+  S + I   F  +  E   +  K+ ELEM+  EH +VI+ L E ++ RKCFR +GGVLVE+TV +VLP L  N
Sbjct:    9 KAADKDKLSPETILQLFNQLRQEYTNIITKVHELEMDQSEHSIVIEALKEVDASRKCFRMIGGVLVERTVGDVLPALDNN 88          
BLAST of prefoldin subunit 2 vs. Ensembl Medaka
Match: pfdn2 (prefoldin subunit 2 [Source:NCBI gene;Acc:101156921])

HSP 1 Score: 108.612 bits (270), Expect = 5.472e-30
Identity = 59/147 (40.14%), Postives = 88/147 (59.86%), Query Frame = 3
Query:   81 AKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKF-----------------GSEKTEQKVESKEGAASSGVLVS 470
            A+S +++   FQ M  EQ++MA+K +ELEM++ EH LVI+ L E +  RKC+R +GGVLVE+TVKEVLP L+ N+EQ+ K  E IN     K +++  ++E++ I+                   S +  ++  SK GA   GVLVS
Sbjct:   44 AQSAEQVVATFQRMRQEQRSMASKAAELEMDINEHSLVIETLKEVDPSRKCYRLVGGVLVERTVKEVLPALENNKEQISKATESINIQMQAKGRELTEYRERYNIRLVGEGEGEGEGEGQGQSGASSRDSERGGSKSGA---GVLVS 187          
BLAST of prefoldin subunit 2 vs. Planmine SMEST
Match: SMESG000075156.1 (SMESG000075156.1)

HSP 1 Score: 272.322 bits (695), Expect = 2.916e-95
Identity = 137/138 (99.28%), Postives = 137/138 (99.28%), Query Frame = 3
Query:   57 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKEGAASSGVLVS 470
            MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKE AASSGVLVS
Sbjct:    1 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKEAAASSGVLVS 138          
BLAST of prefoldin subunit 2 vs. Planmine SMEST
Match: SMESG000075150.1 (SMESG000075150.1)

HSP 1 Score: 267.7 bits (683), Expect = 2.126e-93
Identity = 135/138 (97.83%), Postives = 135/138 (97.83%), Query Frame = 3
Query:   57 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEKHGIKFGSEKTEQKVESKEGAASSGVLVS 470
            MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKL ELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKE HGIKFGSEKTEQKVESKE AASSGVLVS
Sbjct:    1 MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLGELEMELREHGLVIKVLCEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQKTKDIIAFKEIHGIKFGSEKTEQKVESKEAAASSGVLVS 138          
The following BLAST results are available for this feature:
BLAST of prefoldin subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PFDN23.163e-3345.32prefoldin subunit 2 [Source:HGNC Symbol;Acc:HGNC:8... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfd-21.664e-1433.33Prefoldin subunit 2 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pfdn21.510e-2947.46gene:FBgn0010741 transcript:FBtr0076238[more]
Pfdn21.510e-2947.46gene:FBgn0010741 transcript:FBtr0332708[more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pfdn29.259e-3240.71prefoldin subunit 2 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
pfdn29.259e-3240.71prefoldin subunit 2 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kdm4b2.723e-3043.45lysine (K)-specific demethylase 4B [Source:Xenbase... [more]
kdm4b1.277e-2947.24lysine (K)-specific demethylase 4B [Source:Xenbase... [more]
kdm4b1.549e-2344.09lysine (K)-specific demethylase 4B [Source:Xenbase... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pfdn22.411e-3245.86prefoldin 2 [Source:MGI Symbol;Acc:MGI:1276111][more]
Pfdn21.721e-2053.33prefoldin 2 [Source:MGI Symbol;Acc:MGI:1276111][more]
back to top
BLAST of prefoldin subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UHV9|PFD2_HUMAN1.519e-3245.32Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFD... [more]
sp|A1A4P5|PFD2_BOVIN1.569e-3245.32Prefoldin subunit 2 OS=Bos taurus OX=9913 GN=PFDN2... [more]
sp|B0BN18|PFD2_RAT1.082e-3145.93Prefoldin subunit 2 OS=Rattus norvegicus OX=10116 ... [more]
sp|O70591|PFD2_MOUSE1.687e-3145.86Prefoldin subunit 2 OS=Mus musculus OX=10090 GN=Pf... [more]
sp|Q9VTE5|PFD2_DROME1.514e-2847.46Probable prefoldin subunit 2 OS=Drosophila melanog... [more]
back to top
BLAST of prefoldin subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y7MVI63.443e-3248.28EOG090X0L97 OS=Daphnia pulex OX=6669 GN=EOG090X0L9... [more]
E9H6W93.443e-3248.28EOG090X0L97 OS=Daphnia pulex OX=6669 GN=EOG090X0L9... [more]
A0A4Y7MYX27.204e-3248.23EOG090X0L97 OS=Daphnia pulicaria OX=35523 GN=EOG09... [more]
A0A4Y7M2V73.120e-3147.62EOG090X0L97 OS=Daphnia dolichocephala OX=2282166 G... [more]
A0A4Y7M8H73.554e-3146.90EOG090X0L97 OS=Daphnia longispina OX=42846 GN=EOG0... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pfdn24.287e-3345.65prefoldin subunit 2 [Source:NCBI gene;Acc:10303766... [more]
PFDN21.111e-2641.90prefoldin subunit 2-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GIM47.545e-1233.33Subunit of the heterohexameric cochaperone prefold... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO283491.426e-1745.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of prefoldin subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfdn25.472e-3040.14prefoldin subunit 2 [Source:NCBI gene;Acc:10115692... [more]
back to top
BLAST of prefoldin subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075156.12.916e-9599.28SMESG000075156.1[more]
SMESG000075150.12.126e-9397.83SMESG000075150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018984 ID=SMED30018984|Name=prefoldin subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=514bp
TAAACTCAATTTGTTTATTTTAATCTGCTAGTACAATATTTTAAAATTAA
ATAGAGATGAGTAAGAAATCAGATAAGAATGCGAAGTCACAACAAGAAAT
TTTTAATGAATTTCAGAGTATGTTGATGGAACAAAAAGCAATGGCTAATA
AATTGAGTGAATTGGAAATGGAATTACGAGAACATGGACTTGTAATTAAA
GTACTATGTGAAGCTAATTCTGATAGAAAGTGTTTTAGAACATTAGGTGG
TGTTTTAGTTGAACAAACTGTTAAAGAAGTTTTACCATGTTTACAAGAAA
ATGAAGAACAACTGAAGAAAATGATAGAAGTTATTAACAACAATTGTAAT
CAAAAAACGAAGGATATTATTGCATTTAAAGAAAAACATGGAATTAAATT
TGGAAGTGAAAAAACCGAACAGAAAGTCGAATCCAAAGAGGGGGCAGCAT
CAAGTGGAGTTTTGGTTTCATAATTTAAAATACCTAATAAATTTTGTTTG
AATTTAAAAAAAAA
back to top

protein sequence of SMED30018984-orf-1

>SMED30018984-orf-1 ID=SMED30018984-orf-1|Name=SMED30018984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
MSKKSDKNAKSQQEIFNEFQSMLMEQKAMANKLSELEMELREHGLVIKVL
CEANSDRKCFRTLGGVLVEQTVKEVLPCLQENEEQLKKMIEVINNNCNQK
TKDIIAFKEKHGIKFGSEKTEQKVESKEGAASSGVLVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027235PFD2
IPR009053Prefoldin
IPR002777PFD_beta-like
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0051495positive regulation of cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0016272prefoldin complex
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005829cytosol
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
GO:0005515protein binding
GO:0044183protein binding involved in protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009053PrefoldinGENE3DG3DSA:1.10.287.370coord: 7..131
e-value: 3.4E-17
score: 64.3
IPR002777Prefoldin beta-likePFAMPF01920Prefoldin_2coord: 13..117
e-value: 5.5E-21
score: 74.5
IPR027235Prefoldin subunit 2PANTHERPTHR13303PREFOLDIN SUBUNIT 2coord: 3..138
NoneNo IPR availableSUPERFAMILYSSF46579Prefoldincoord: 11..112