MANSC domain-containing protein

Overview
NameMANSC domain-containing protein
Smed IDSMED30018983
Length (bp)1988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MANSC domain-containing protein (SMED30018983) t-SNE clustered cells

Violin plots show distribution of expression levels for MANSC domain-containing protein (SMED30018983) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MANSC domain-containing protein (SMED30018983) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MANSC domain-containing protein (SMED30018983) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018983

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018983h1SMcG0015945 SmedASXL_008781SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018983h1SMcG0015945 dd_Smed_v4_10934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018983h1SMcG0015945 dd_Smed_v4_10934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018983h1SMcG0015945 dd_Smed_v6_10934_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018983h1SMcG0002691 OX_Smed_1.0.08793ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: LRP11 (LDL receptor related protein 11 [Source:HGNC Symbol;Acc:HGNC:16936])

HSP 1 Score: 56.9954 bits (136), Expect = 4.903e-8
Identity = 38/132 (28.79%), Postives = 55/132 (41.67%), Query Frame = 3
Query:  105 ISLNVLSNADEEC----NRNFSIRKNAIILTKSSKAKGAIFIHK-QVISKFADCYALCCSNRDCTVAVYE-------NKVNHKCYIFNC--KQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDV 458
            + L       E+C    +  +S   +AII TK S A GA F+     +  +  C A CCS   C+VAV E             CY+FNC  +  NVC F  HS Y S    +      + +   + + + D 
Sbjct:   77 LELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRCSVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSSYSLSRAPDGAALATARASPRQEKDA 208          
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: LRP11 (LDL receptor related protein 11 [Source:HGNC Symbol;Acc:HGNC:16936])

HSP 1 Score: 56.6102 bits (135), Expect = 1.101e-7
Identity = 37/107 (34.58%), Postives = 48/107 (44.86%), Query Frame = 3
Query:  105 ISLNVLSNADEEC----NRNFSIRKNAIILTKSSKAKGAIFIHK-QVISKFADCYALCCSNRDCTVAVYE-------NKVNHKCYIFNC--KQPNVCSFTEHSNYIS 383
            + L       E+C    +  +S   +AII TK S A GA F+     +  +  C A CCS   C+VAV E             CY+FNC  +  NVC F  HS Y S
Sbjct:   77 LELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRCSVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSS 183          
BLAST of MANSC domain-containing protein vs. Ensembl Fly
Match: CG6495 (gene:FBgn0027550 transcript:FBtr0080114)

HSP 1 Score: 69.707 bits (169), Expect = 4.831e-12
Identity = 61/232 (26.29%), Postives = 92/232 (39.66%), Query Frame = 3
Query:  135 EECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPN--VCSFTEHSNYISMMYVKPESK-----VNVISHEKNEKPKNDV-----------LKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDE-------LNCEDKSSGTRNN 755
            E C  +F + KN II T  S+A G  ++    +    +C  LCC    C V ++E K    CY+F C  P    C FT H+NY S + + P+ K     V     +    P N+V           LKP    K      ++          T          + ++     + C +    F C        CIA+Y+ C+G+ +C DGSDE       L+   K + T +N
Sbjct:   45 EVCIGHFDVHKNTIIRTGESQAIGGKYLQGIELDTIEECERLCCETDACDVYIFERKAGGYCYLFECGPPEDFRCKFTRHANYTSAV-LNPQPKPVGELVTTPRPQLPHIPSNNVSQQEWELSNLKLKPEARDKPTVSTAAVVAPTSGTGTGTGVGLGVGQSPVYQSQSVPAAHCGR--FQFTCHSGE----CIAVYNACDGIPQCEDGSDEGPECNIVLSTATKPATTSSN 269          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 a [Source:ZFIN;Acc:ZDB-GENE-040426-2169])

HSP 1 Score: 53.1434 bits (126), Expect = 7.908e-7
Identity = 32/107 (29.91%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   90 LIFFMISLNVLSNADEECNRNFSIRKNAIIL-TKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHK----CYIFNC--KQPNVCSFTEHSNYISMM 389
            L+F   S +     ++ C   FS+ K   +L T  S  +GA F+    +SK  DC   CC++ +C +A+ E++ + K    C+I NC  KQ  VC F     + + +
Sbjct:   16 LLFLHQSPSAAQEEEKLCKDKFSVGKEDFVLNTDESVKEGATFLGSPQVSKPEDCVMACCNDPNCNLALMEHREDPKSINTCFIINCLYKQKKVCHFVRKKGFTNYL 122          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 a [Source:ZFIN;Acc:ZDB-GENE-040426-2169])

HSP 1 Score: 53.1434 bits (126), Expect = 8.372e-7
Identity = 32/107 (29.91%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   90 LIFFMISLNVLSNADEECNRNFSIRKNAIIL-TKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHK----CYIFNC--KQPNVCSFTEHSNYISMM 389
            L+F   S +     ++ C   FS+ K   +L T  S  +GA F+    +SK  DC   CC++ +C +A+ E++ + K    C+I NC  KQ  VC F     + + +
Sbjct:   16 LLFLHQSPSAAQEEEKLCKDKFSVGKEDFVLNTDESVKEGATFLGSPQVSKPEDCVMACCNDPNCNLALMEHREDPKSINTCFIINCLYKQKKVCHFVRKKGFTNYL 122          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 a [Source:ZFIN;Acc:ZDB-GENE-040426-2169])

HSP 1 Score: 53.1434 bits (126), Expect = 8.372e-7
Identity = 32/107 (29.91%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   90 LIFFMISLNVLSNADEECNRNFSIRKNAIIL-TKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHK----CYIFNC--KQPNVCSFTEHSNYISMM 389
            L+F   S +     ++ C   FS+ K   +L T  S  +GA F+    +SK  DC   CC++ +C +A+ E++ + K    C+I NC  KQ  VC F     + + +
Sbjct:   16 LLFLHQSPSAAQEEEKLCKDKFSVGKEDFVLNTDESVKEGATFLGSPQVSKPEDCVMACCNDPNCNLALMEHREDPKSINTCFIINCLYKQKKVCHFVRKKGFTNYL 122          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 a [Source:ZFIN;Acc:ZDB-GENE-040426-2169])

HSP 1 Score: 53.1434 bits (126), Expect = 8.528e-7
Identity = 32/107 (29.91%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   90 LIFFMISLNVLSNADEECNRNFSIRKNAIIL-TKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHK----CYIFNC--KQPNVCSFTEHSNYISMM 389
            L+F   S +     ++ C   FS+ K   +L T  S  +GA F+    +SK  DC   CC++ +C +A+ E++ + K    C+I NC  KQ  VC F     + + +
Sbjct:   16 LLFLHQSPSAAQEEEKLCKDKFSVGKEDFVLNTDESVKEGATFLGSPQVSKPEDCVMACCNDPNCNLALMEHREDPKSINTCFIINCLYKQKKVCHFVRKKGFTNYL 122          
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86VZ4|LRP11_HUMAN (Low-density lipoprotein receptor-related protein 11 OS=Homo sapiens OX=9606 GN=LRP11 PE=2 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 5.286e-7
Identity = 37/107 (34.58%), Postives = 48/107 (44.86%), Query Frame = 3
Query:  105 ISLNVLSNADEEC----NRNFSIRKNAIILTKSSKAKGAIFIHK-QVISKFADCYALCCSNRDCTVAVYE-------NKVNHKCYIFNC--KQPNVCSFTEHSNYIS 383
            + L       E+C    +  +S   +AII TK S A GA F+     +  +  C A CCS   C+VAV E             CY+FNC  +  NVC F  HS Y S
Sbjct:   77 LELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRCSVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSS 183          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A564Y5F6 (MANSC domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2870 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.093e-40
Identity = 88/217 (40.55%), Postives = 125/217 (57.60%), Query Frame = 3
Query:   90 LIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSS 740
            LI   I   +LS A + C ++F I+ N IILT  S+  GA F+HK       +C   CC + +C+V V+ +K    C++FNC +PNVC+FT  + Y   ++++ +SK  +        PK   ++    G L  +CG    C  EN++C SG C+C+ GFI +   CV SLC KP+L FQC D +    CIA+YD CNG+ EC DGSDE  C DKS+
Sbjct:    3 LITLQICTLILSVATKTCEKDFDIKLNTIILTHESEKTGAAFLHKLSADSLEECVKYCCDSTECSVGVFGSKNVDTCFLFNCHEPNVCNFTTKTGY--TVFIQRDSKPVL--------PKIHKVETFPPGALRGMCGPHNPCVAENTICDSGQCVCKAGFIEKRHKCVPSLCGKPDLQFQCDDGTA---CIAIYDVCNGISECPDGSDEAFC-DKSA 205          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A183LYI7 (MANSC domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS8862 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.171e-40
Identity = 97/297 (32.66%), Postives = 150/297 (50.51%), Query Frame = 3
Query:   81 MKHLIFFMISLNVL---------------SNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAIS-QAHPKIQQNVDDHQIVDKNVSRFLPEIQDL 923
            MK+LIF  I+  ++               ++ +  C +NF  + N IILT+ S + GA F+ K  +S F +CY +CC+  +C+ A++E+K    C++F+C+QP  C ++ HSNY ++  V  ES V +  H                      C S   C    ++C+ G CICQ G+I + G CV+S+C  PEL FQC D S    C+A+YD+CNG+ EC DGSDEL C  +    +N T      +Q Q +    ++   S +S Q   + Q N        ++ S  L ++ DL
Sbjct:    1 MKNLIFLTITYQLVVAIWPITTFTYNNIDNSINNNCGKNFQFKPNRIILTQKSISAGAKFLKKLKVSSFKECYFMCCNTNECSTAIFESKATQSCFMFDCRQPGQCFYSSHSNYDTI--VLEESNVGLNQH----------------------CDSNNLCDEVKTICSDGVCICQSGWIAKKGSCVQSVCKSPELQFQCDDSST---CVAIYDKCNGIVECPDGSDELICPSRLIHKQNETNPSLLRNQKQGEFDEGILSKPSNVSYQPLERYQSNQPSLLTTSRSTSPALMDLNDL 270          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A0X3PXT2 (MANSC domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR91034 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 6.680e-40
Identity = 86/220 (39.09%), Postives = 127/220 (57.73%), Query Frame = 3
Query:   96 FFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKP--------ESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCED 731
             F+ +L  + +  ++C++ F +  + IIL++SS+  GA+F+ K V     +CY  CC +  CT AVY +K   +CY+FNC  PNVC+FT H++Y   +  +P        +S    +S   N +PK         G L   CG    C  EN++C SG C+CQ G+I +   CVRS+C KP+L FQC D S    CIA+YD CNG+ EC D SDE++C++
Sbjct:   11 IFVFAL--ICSFAKKCDKKFDLHVDKIILSESSEKNGAVFLKKIVPQSSEECYKTCCESDQCTAAVYTSKRGKECYLFNCGDPNVCNFTSHADYSVFVLQQPIKHPARTSDSATTALSSATNSQPK---------GTLHGRCGPTISCTDENTICDSGLCVCQAGWIEKMHTCVRSVCKKPDLQFQCNDGSA---CIAVYDVCNGIAECRDESDEISCDE 216          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A3Q0KNP0 (MANSC domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.903e-39
Identity = 85/218 (38.99%), Postives = 125/218 (57.34%), Query Frame = 3
Query:  141 CNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNT--VIRRNNDQSQ 788
            C +NF  + N IILT+ S + GA F+ K  +S F +CY +CC+  +C+ A++E+K    C++F+C+QP  C ++ HSNY ++  V  ES         N+  KN V        L + C S   C    ++C+ G CICQ G+I + G CV+S+C  P+L FQC D S    C+A+YD+CNG+ EC DGSDEL C  +    +N T   + RN  Q +
Sbjct:   36 CGKNFQFKPNRIILTQKSISAGAKFLKKLKVSSFKECYFMCCNTNECSTAIFESKATQSCFMFDCRQPGQCFYSSHSNYDTI--VLEESN-------GNQSLKNKV-------GLNQHCDSNNVCDEVKTICSDGICICQSGWIAKKGSCVQSVCKSPDLQFQCDDSST---CVAIYDKCNGIVECPDGSDELFCPSRVIHKQNETNPSLPRNQKQGE 234          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A183KWK0 (MANSC domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS19444 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 6.767e-38
Identity = 83/230 (36.09%), Postives = 125/230 (54.35%), Query Frame = 3
Query:   81 MKHLIFFMISLNVL---------------SNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNC 725
            MK+LIF  I+  ++               ++ +  C +NF  + N IILT+ S + GA F+ K  +S F +CY +CC+  +C+ A++E+K    C++F+C+QP  C ++ HSNY ++  +  ES V +  H                      C S   C    ++C+ G CICQ G+I + G CV+S+C  PEL FQC D S    C+A+YD+CNG+ EC DGSDEL C
Sbjct:    1 MKNLIFLTITYQLVVAIWPITTFTYNNIDNSINNNCGKNFQFKPNRIILTQKSISAGAKFLKKLKVSSFKECYFMCCNTNECSTAIFESKATQSCFMFDCRQPGQCFYSSHSNYDTI--ILEESNVGLNQH----------------------CDSNNLCDEVKTICSDGICICQSGWIAKKGSCVQSVCKSPELQFQCDDSST---CVAIYDKCNGIVECPDGSDELFC 203          
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 [Source:NCBI gene;Acc:103032340])

HSP 1 Score: 50.8322 bits (120), Expect = 3.661e-6
Identity = 34/115 (29.57%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  135 EECNRNFSIRKNAIIL-TKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVN----HKCYIFNC--KQPNVCSF---TEHSNYISMMYVKPESKVNVISHEKNEKPK 449
            ++C   F+  K+  +L T  S  +GA F+    +S  ++C + CCS+ +C +A+ E+       H C+ FNC  KQ  VC F   T   NY+    V      ++ S ++++ PK
Sbjct:   28 QQCMSKFTQGKDGFVLDTDESVKEGATFLSSPQVSTVSECVSACCSDPNCNLALIESTSEESTIHACFTFNCLYKQKQVCRFVRKTGFKNYLLNSGVFRSYLQDIPSTQEDKPPK 142          
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 [Source:NCBI gene;Acc:103032340])

HSP 1 Score: 50.447 bits (119), Expect = 4.358e-6
Identity = 27/88 (30.68%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  135 EECNRNFSIRKNAIIL-TKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVN----HKCYIFNC--KQPNVCSFTEHSNY 377
            ++C   F+  K+  +L T  S  +GA F+    +S  ++C + CCS+ +C +A+ E+       H C+ FNC  KQ  VC F   + +
Sbjct:   28 QQCMSKFTQGKDGFVLDTDESVKEGATFLSSPQVSTVSECVSACCSDPNCNLALIESTSEESTIHACFTFNCLYKQKQVCRFVRKTGF 115          
BLAST of MANSC domain-containing protein vs. Ensembl Nematostella
Match: EDO43585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY69])

HSP 1 Score: 62.3882 bits (150), Expect = 3.132e-10
Identity = 43/155 (27.74%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  114 NVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAV--YENKVN-----HKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKV--NVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTC 551
            NV  +A + C +   ++KN I+ TK +   GA ++ + VIS   +CY LCC +  C +A+  Y N  +       CY+F+C  P+ C +  +S+Y ++ +   E  +  ++    +NE+      KP       E C      G   +MC+S  C
Sbjct:   21 NVFPSAQDGCPK-IQVKKNQILRTKEALNNGAKYLKRAVISTARECYNLCCRHSSCNLAMISYTNSTSGSDAVRMCYLFDCGSPSKCMYAPYSHYATIEFDDREDYLESDLFGKMRNEQ----KAKPKTSHHRDEDCPP----GAPTAMCSSNPC 166          
BLAST of MANSC domain-containing protein vs. Ensembl Medaka
Match: lrp11 (low-density lipoprotein receptor-related protein 11 [Source:NCBI gene;Acc:101175213])

HSP 1 Score: 53.1434 bits (126), Expect = 8.108e-7
Identity = 33/105 (31.43%), Postives = 50/105 (47.62%), Query Frame = 3
Query:  135 EECNRNFSIRKNAIILTKSSKAKGAIFI-HKQVISKFADCYALCCSNRDCTVAVYENKVNHK-----CYIFNC--KQPNVCSFTEHSNYISMMYVKPESKVNVIS 425
            + C  +FS  K  II TK S   GA F+     +  + DC   CC+   CTVAV + +         CY+FNC  +  NVCSF+    + +     P + + ++S
Sbjct:   60 DSCVVDFSASKERIIRTKVSTQHGAAFLLAPDRVHSWRDCVHACCAQPHCTVAVLQEEPRKAGDSLGCYLFNCTYRNTNVCSFSPQRGFTTYSR-DPNTTLGLLS 163          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000068862.1 (SMESG000068862.1)

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 575/578 (99.48%), Postives = 576/578 (99.65%), Query Frame = 3
Query:   81 MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAISQAHPKIQQNVDDHQIVDKNVSRFLPEIQDLKHLKPESSRRINPLAENQLLVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKTSSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPNSDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADXXXXXXXXXXXXRNPFLIXXXXXXXXXXXXXXFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHPTPNSKLKIKEDLDDAERRSSKEWSTAVXXXXXXXXXXXXXXXXXXXKMRSWRHRLRKGKKGKSLTTDEGDYLINGMYL 1814
            MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVIS+FADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAISQAHPKIQQNVDDHQIVDKNVS FLPEIQDLKHLKPESSRRINPLAENQLLVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKTSSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPNSDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADYSEPEEESYSKSRNPFLIDNDYYNPNYYYRNPFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHPTPNSKLKIKED DDAERRSSKEWSTAVIILSLGLLITATLLIAIGLKMRSWRHRLRKGKKGKSLTTDEGDYLINGMYL
Sbjct:    1 MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISRFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAISQAHPKIQQNVDDHQIVDKNVSHFLPEIQDLKHLKPESSRRINPLAENQLLVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKTSSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPNSDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADYSEPEEESYSKSRNPFLIDNDYYNPNYYYRNPFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHPTPNSKLKIKEDFDDAERRSSKEWSTAVIILSLGLLITATLLIAIGLKMRSWRHRLRKGKKGKSLTTDEGDYLINGMYL 578          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000068862.1 (SMESG000068862.1)

HSP 1 Score: 1066.6 bits (2757), Expect = 0.000e+0
Identity = 568/571 (99.47%), Postives = 569/571 (99.65%), Query Frame = 3
Query:  102 MISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAISQAHPKIQQNVDDHQIVDKNVSRFLPEIQDLKHLKPESSRRINPLAENQLLVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKTSSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPNSDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADXXXXXXXXXXXXRNPFLIXXXXXXXXXXXXXXFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHPTPNSKLKIKEDLDDAERRSSKEWSTAVXXXXXXXXXXXXXXXXXXXKMRSWRHRLRKGKKGKSLTTDEGDYLINGMYL 1814
            MISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVIS+FADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAISQAHPKIQQNVDDHQIVDKNVS FLPEIQDLKHLKPESSRRINPLAENQLLVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKTSSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPNSDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADYSEPEEESYSKSRNPFLIDNDYYNPNYYYRNPFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHPTPNSKLKIKED DDAERRSSKEWSTAVIILSLGLLITATLLIAIGLKMRSWRHRLRKGKKGKSLTTDEGDYLINGMYL
Sbjct:    1 MISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISRFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAISQAHPKIQQNVDDHQIVDKNVSHFLPEIQDLKHLKPESSRRINPLAENQLLVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKTSSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPNSDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADYSEPEEESYSKSRNPFLIDNDYYNPNYYYRNPFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHPTPNSKLKIKEDFDDAERRSSKEWSTAVIILSLGLLITATLLIAIGLKMRSWRHRLRKGKKGKSLTTDEGDYLINGMYL 571          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000068862.1 (SMESG000068862.1)

HSP 1 Score: 460.299 bits (1183), Expect = 3.854e-160
Identity = 220/221 (99.55%), Postives = 221/221 (100.00%), Query Frame = 3
Query:   81 MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSG 743
            MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVIS+FADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSG
Sbjct:    1 MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISRFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSG 221          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000068862.1 (SMESG000068862.1)

HSP 1 Score: 444.891 bits (1143), Expect = 2.939e-154
Identity = 213/214 (99.53%), Postives = 214/214 (100.00%), Query Frame = 3
Query:  102 MISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSG 743
            MISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVIS+FADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSG
Sbjct:    1 MISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQVISRFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENSMCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQCNGLYECGDGSDELNCEDKSSG 214          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000003951.1 (SMESG000003951.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.083e-7
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  144 NRNFSIRKNAIILTKSSKAKGAIFIHKQVISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYISMMYVKPESKV 413
            N +  I++N II    S A GA  +H  V + F  C   CCSN  C+V V   K++H CY+ +C +  +C F  H+NY  ++ +K  S++
Sbjct:   24 NFSLKIKENYIIKYHESIANGAELLH--VFNNFTACETECCSNPKCSVIVNNFKLHH-CYLIHCPKGYICKFVPHANYSIVLKLKRNSEI 110          
The following BLAST results are available for this feature:
BLAST of MANSC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LRP114.903e-828.79LDL receptor related protein 11 [Source:HGNC Symbo... [more]
LRP111.101e-734.58LDL receptor related protein 11 [Source:HGNC Symbo... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG64954.831e-1226.29gene:FBgn0027550 transcript:FBtr0080114[more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spint1a7.908e-729.91serine peptidase inhibitor, Kunitz type 1 a [Sourc... [more]
spint1a8.372e-729.91serine peptidase inhibitor, Kunitz type 1 a [Sourc... [more]
spint1a8.372e-729.91serine peptidase inhibitor, Kunitz type 1 a [Sourc... [more]
spint1a8.528e-729.91serine peptidase inhibitor, Kunitz type 1 a [Sourc... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q86VZ4|LRP11_HUMAN5.286e-734.58Low-density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of MANSC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y5F62.093e-4040.55MANSC domain-containing protein (Fragment) OS=Hyme... [more]
A0A183LYI74.171e-4032.66MANSC domain-containing protein OS=Schistosoma mar... [more]
A0A0X3PXT26.680e-4039.09MANSC domain-containing protein OS=Schistocephalus... [more]
A0A3Q0KNP03.903e-3938.99MANSC domain-containing protein OS=Schistosoma man... [more]
A0A183KWK06.767e-3836.09MANSC domain-containing protein OS=Schistosoma cur... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spint1a3.661e-629.57serine peptidase inhibitor, Kunitz type 1 [Source:... [more]
spint1a4.358e-630.68serine peptidase inhibitor, Kunitz type 1 [Source:... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435853.132e-1027.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrp118.108e-731.43low-density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068862.10.000e+099.48SMESG000068862.1[more]
SMESG000068862.10.000e+099.47SMESG000068862.1[more]
SMESG000068862.13.854e-16099.55SMESG000068862.1[more]
SMESG000068862.12.939e-15499.53SMESG000068862.1[more]
SMESG000003951.11.083e-735.56SMESG000003951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018983 ID=SMED30018983|Name=MANSC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1988bp
TGAATTCTAGGTTTTGAATTTGTTTATTTATTTAAAAAGAAGCCTTCACT
TTTTAAAACTGGAGATAAATAATTAAAAGAATGAAACACTTGATATTTTT
CATGATTTCTTTAAATGTTTTGTCAAACGCCGATGAGGAATGTAATAGAA
ATTTCTCTATAAGAAAAAATGCTATTATCTTGACAAAGTCATCTAAGGCC
AAAGGAGCTATATTCATTCATAAACAAGTTATTTCGAAATTTGCTGATTG
TTATGCTTTGTGTTGTAGTAATCGTGACTGTACCGTTGCAGTTTATGAAA
ATAAAGTCAATCATAAATGTTATATTTTTAACTGTAAACAACCAAATGTT
TGTAGTTTTACAGAACATTCTAATTACATATCAATGATGTATGTAAAACC
TGAAAGTAAAGTAAATGTAATATCACATGAGAAAAATGAAAAACCTAAAA
ATGATGTTCTTAAACCGTCTGTTGATGGAAAATTAGGAGAAATTTGTGGA
TCGTTGCGCAAATGTGGGCCTGAAAATTCCATGTGCACATCTGGAACTTG
TATATGTCAAATCGGTTTTATTGGCAGAAACGGCGATTGCGTTCGATCAC
TTTGTCCAAAGCCAGAATTAATGTTCCAGTGTTTCGATGTATCTAAAATG
CCGTTTTGCATTGCTCTCTATGATCAGTGTAACGGATTGTATGAATGCGG
TGACGGATCCGATGAATTGAATTGCGAAGATAAGTCTAGCGGCACACGAA
ATAATACTGTCATTAGACGCAATAATGATCAATCTCAACAAAAAAATTCA
CATCAGGTAGTTTATGGAAACTCTGCCATTTCACAGGCTCATCCAAAAAT
TCAGCAAAATGTTGATGATCATCAAATTGTTGACAAAAATGTTTCTCGTT
TTCTTCCAGAAATTCAAGATTTGAAACATCTTAAACCTGAAAGTTCACGC
CGAATTAATCCATTGGCTGAAAATCAATTGTTGGTTTTAAAATCCAAAAA
TAAGTTACCAAAATATTCCAATATAAATCATAATCATGACAAAAACAGCC
GACAATACACAAAGCCTCAAAGAGATACTGACTCCAACAACCAAATCGAT
GATAACCGCAATTATGCTAAAATTAAAACTTCCTCCTATCCGCATCTGAC
AAAAATTGATGATTATTATCAAAAAAGTGGTCCGGAATCATCTGAAAGTC
GGAATCGAATAAAAAGTTCCGATTCTTATTTGCCAGACTATGATTTCTCA
CAACCAAATATAAATAACAGAGATCCCAATTCAGACTGGTACGGCGATAA
AAGTTCAAATCCATATTCCGATTCCATTTATCAAGATTCTCCAACTAAAT
ATTCAAATGATCGTAGTGGCTATGCCGACTATTCCGAACCGGAAGAAGAA
TCTTACAGTAAATCTCGAAACCCCTTCTTGATTGATAATGATTACTATAA
TCCTAATTATTACTATCGCAACCCGTTCGAAAAATCAATGTATCATGGCA
ATCAGAGGAAAAATAAACCAGAAGTTAATAAAATTCTAATCAATCCGAAG
TCTCAATCCAATCTACATGAAAATCATCCAACGCCTAATTCAAAACTTAA
AATCAAAGAAGATTTGGATGACGCAGAGAGAAGAAGTTCCAAAGAATGGA
GCACCGCAGTAATTATCCTTAGTTTGGGACTATTAATTACTGCAACGCTA
TTGATTGCCATTGGTTTGAAAATGCGTTCTTGGCGCCATAGATTAAGAAA
AGGTAAAAAAGGAAAGTCTCTCACAACAGACGAAGGCGACTATTTAATAA
ATGGAATGTACCTATGATCATAATTTATTGATTAATTATTTTATTCAACG
TAATAATTTGATGGCTATTTTATTGTGAAATAGTGCTGTTCCAGTGTGAT
GTTGTTTGATATTATCATTTTATGATTGATCTCTCTCTCTCTATTATACA
TGTCGCATAATAACAATGAGATATTTTTATACTTTGCT
back to top

protein sequence of SMED30018983-orf-1

>SMED30018983-orf-1 ID=SMED30018983-orf-1|Name=SMED30018983-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MKHLIFFMISLNVLSNADEECNRNFSIRKNAIILTKSSKAKGAIFIHKQV
ISKFADCYALCCSNRDCTVAVYENKVNHKCYIFNCKQPNVCSFTEHSNYI
SMMYVKPESKVNVISHEKNEKPKNDVLKPSVDGKLGEICGSLRKCGPENS
MCTSGTCICQIGFIGRNGDCVRSLCPKPELMFQCFDVSKMPFCIALYDQC
NGLYECGDGSDELNCEDKSSGTRNNTVIRRNNDQSQQKNSHQVVYGNSAI
SQAHPKIQQNVDDHQIVDKNVSRFLPEIQDLKHLKPESSRRINPLAENQL
LVLKSKNKLPKYSNINHNHDKNSRQYTKPQRDTDSNNQIDDNRNYAKIKT
SSYPHLTKIDDYYQKSGPESSESRNRIKSSDSYLPDYDFSQPNINNRDPN
SDWYGDKSSNPYSDSIYQDSPTKYSNDRSGYADYSEPEEESYSKSRNPFL
IDNDYYNPNYYYRNPFEKSMYHGNQRKNKPEVNKILINPKSQSNLHENHP
TPNSKLKIKEDLDDAERRSSKEWSTAVIILSLGLLITATLLIAIGLKMRS
WRHRLRKGKKGKSLTTDEGDYLINGMYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR042484LRP11
IPR002172LDrepeatLR_classA_rpt
IPR011106MANSC_N
IPR023415LDLR_class-A_CS
IPR013980MANSC_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 174..217
e-value: 3.4E-7
score: 39.9
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 182..215
e-value: 6.8E-6
score: 26.2
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 174..216
score: 10.675
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 175..215
e-value: 1.3796E-5
score: 40.2678
IPR011106Seven cysteines, N-terminalSMARTSM00765manec2seq9dcoord: 16..102
e-value: 1.6E-15
score: 67.5
IPR011106Seven cysteines, N-terminalPFAMPF07502MANECcoord: 19..101
e-value: 4.6E-18
score: 65.3
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 172..221
e-value: 1.8E-6
score: 29.6
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 179..215
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 313..338
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..446
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..351
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..381
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 382..429
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.619
NoneNo IPR availableTMHMMTMhelixcoord: 524..546
IPR042484Low-density lipoprotein receptor-related protein 11PANTHERPTHR46876FAMILY NOT NAMEDcoord: 23..112
coord: 180..578
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 193..215
IPR013980MANSC domainPROSITEPS50986MANSCcoord: 27..102
score: 10.902