Synaptosomal-associated protein

Overview
NameSynaptosomal-associated protein
Smed IDSMED30018982
Length (bp)1172
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptosomal-associated protein (SMED30018982) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptosomal-associated protein (SMED30018982) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptosomal-associated protein (SMED30018982) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptosomal-associated protein (SMED30018982) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018982

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30018982h1SMcG0020909 dd_Smed_v4_2355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018982h1SMcG0020909 dd_Smed_v4_2355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018982h1SMcG0020909 dd_Smed_v4_2355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018982h1SMcG0020909 Contig39120uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018982h1SMcG0020909 Contig39120newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30018982h1SMcG0020909 dd_Smed_v6_10519_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: AL159141.1 (Ras and Rab interactor 3 [Source:NCBI gene;Acc:79890])

HSP 1 Score: 57.3806 bits (137), Expect = 3.382e-8
Identity = 36/133 (27.07%), Postives = 67/133 (50.38%), Query Frame = 2
Query:  296 VSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNF------GKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFW 676
            +S +++L KT  VW Q    + +   IL     G+F+VR +S +  +VL  +F        +V+   IK + K   +++GS  +F++I  L+  Y ++    P   L+LP+ ++E +  +  +   NL   FW
Sbjct:   50 ISILEKLIKTCPVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIK-EEKSILYLEGSALVFEDIFRLIAFYCVSRDLLP-FTLRLPQAILEASSFTDLETIANLGLGFW 180          
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Match: AL159141.1 (Ras and Rab interactor 3 [Source:NCBI gene;Acc:79890])

HSP 1 Score: 56.6102 bits (135), Expect = 5.211e-8
Identity = 36/133 (27.07%), Postives = 67/133 (50.38%), Query Frame = 2
Query:  296 VSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNF------GKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFW 676
            +S +++L KT  VW Q    + +   IL     G+F+VR +S +  +VL  +F        +V+   IK + K   +++GS  +F++I  L+  Y ++    P   L+LP+ ++E +  +  +   NL   FW
Sbjct:   50 ISILEKLIKTCPVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIK-EEKSILYLEGSALVFEDIFRLIAFYCVSRDLLP-FTLRLPQAILEASSFTDLETIANLGLGFW 180          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: rin3 (Ras and Rab interactor 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8871])

HSP 1 Score: 54.6842 bits (130), Expect = 1.329e-7
Identity = 36/133 (27.07%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  290 PPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKV----DHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFW 676
            P +S +++L KT  VW Q      +   IL     GIF+VR ++   TMVL+     ++    +K     + K   +++GS  +F+NI  L+  Y ++    P   LKLP+++ ++      +   ++ S+FW
Sbjct:  145 PGISILEKLIKTCPVWLQLGMNLDKAMHILSKEFPGIFLVRRDATQKTMVLAVRLPDQLGEPHVKELPVKEEKSLLYLEGSVLVFENIFKLIAFYCVSRDILP-FPLKLPQVIQKVAKYEDMEVISSIGSEFW 276          
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Match: si:ch211-112g6.4 (si:ch211-112g6.4 [Source:ZFIN;Acc:ZDB-GENE-160728-119])

HSP 1 Score: 50.0618 bits (118), Expect = 2.753e-6
Identity = 23/81 (28.40%), Postives = 42/81 (51.85%), Query Frame = 2
Query:  335 WFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPI 577
            WFQ   +R + ED L++ ++G F++R++   I  +LSY    +  H  I       F + G +    ++  L+D++ I PI
Sbjct:   60 WFQGFISRQEAEDQLRDRDVGCFLIRLSEKAIGYILSYKGQDRCRHFVINQTKTGLFVVSGDSTTHNSLAELIDHFKITPI 140          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 51.9878 bits (123), Expect = 1.482e-6
Identity = 39/132 (29.55%), Postives = 61/132 (46.21%), Query Frame = 2
Query:  296 VSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVL-----SYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFW 676
            +S +DRL KT  VW Q      Q  DILK    G+F++  + +   MVL     S      V+   IK + K   +++ S  +F++I  L+  Y ++    P   LKLP+ +         + F NL + FW
Sbjct:   40 ISVLDRLIKTCPVWLQLCMNPEQAVDILKKEGPGVFLITRDVERKCMVLWVHVTSNKEQADVLRYNIK-EEKTMMYLESSVLVFEDIFKLVAFYCVSRDVLP-FPLKLPQAIAAAQTYKELETFSNLGTGFW 169          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: rpn2 (ribophorin II [Source:Xenbase;Acc:XB-GENE-941830])

HSP 1 Score: 51.9878 bits (123), Expect = 1.625e-6
Identity = 39/132 (29.55%), Postives = 61/132 (46.21%), Query Frame = 2
Query:  296 VSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVL-----SYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFW 676
            +S +DRL KT  VW Q      Q  DILK    G+F++  + +   MVL     S      V+   IK + K   +++ S  +F++I  L+  Y ++    P   LKLP+ +         + F NL + FW
Sbjct:   38 ISVLDRLIKTCPVWLQLCMNPEQAVDILKKEGPGVFLITRDVERKCMVLWVHVTSNKEQADVLRYNIK-EEKTMMYLESSVLVFEDIFKLVAFYCVSRDVLP-FPLKLPQAIAAAQTYKELETFSNLGTGFW 167          
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Match: HSH2D (hematopoietic SH2 domain containing [Source:NCBI gene;Acc:105945618])

HSP 1 Score: 49.6766 bits (117), Expect = 4.641e-6
Identity = 28/88 (31.82%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  314 LRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPI 577
            LR     WF    TR   ED+LK+  +G F++R+    I   LSY    +  H  I V + +   + G T+I + +  L+  Y +NPI
Sbjct:   20 LRNGIPDWFHGIITRKDAEDLLKDTVLGCFLIRVGESRIGYSLSYKAPDRYRHFMIDVLNGQNCNMVGDTRIHRTLEDLVMFYSVNPI 107          
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Match: sp|Q8TB24|RIN3_HUMAN (Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4)

HSP 1 Score: 56.6102 bits (135), Expect = 2.503e-7
Identity = 36/133 (27.07%), Postives = 67/133 (50.38%), Query Frame = 2
Query:  296 VSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNF------GKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFW 676
            +S +++L KT  VW Q    + +   IL     G+F+VR +S +  +VL  +F        +V+   IK + K   +++GS  +F++I  L+  Y ++    P   L+LP+ ++E +  +  +   NL   FW
Sbjct:   50 ISILEKLIKTCPVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIK-EEKSILYLEGSALVFEDIFRLIAFYCVSRDLLP-FTLRLPQAILEASSFTDLETIANLGLGFW 180          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A1S3HR45 (LOW QUALITY PROTEIN: uncharacterized protein LOC106156692 OS=Lingula unguis OX=7574 GN=LOC106156692 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.431e-8
Identity = 41/132 (31.06%), Postives = 67/132 (50.76%), Query Frame = 2
Query:  305 VDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNF----GKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQI 688
            ++RL KT  +W+ P  +R  T  +L++ ++G FIVR +S   TM LS       G+ + H  I+    +G  ++GS   F  I VL++ Y+ N + +   KL LP++L   T          L  DFW + +
Sbjct:  192 LERLIKTHPIWYLPNISRAGTIHLLQHRDVGSFIVRKSSQQATMALSVRLPEGCGQHIEHFLIQTT-DQGLQLEGSNYFFPAIPVLVE-YYSNTLDELPCKLVLPKVLSAATTHQELASLALLGQDFWSSSL 321          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A060XQG6 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030780001 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.842e-8
Identity = 43/143 (30.07%), Postives = 74/143 (51.75%), Query Frame = 2
Query:  272 QTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIK----VDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQI 688
            Q  +  P +S +++L KT  VW Q    + +T  +LK    GIF+VR + D  +MVLS     K   L+++     + K   +++GS  +F NI  L+  Y ++    P   L+LP+++++ T     +    L SDFW +Q+
Sbjct:  414 QATAPRPSISILEKLIKTCPVWLQLGMAQERTTLMLKKEIPGIFLVRKSHDQKSMVLSVCVSDKQEELQVQDILIKEEKSLMYLEGSVLVFDNIFKLMAFYCVSRDILP-FTLRLPQVIVQATKYEDIEMISTLGSDFWGSQL 555          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A4W5QZT3 (Ras and Rab interactor 3 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.540e-8
Identity = 44/143 (30.77%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  272 QTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIK---VDHKKGF-FIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQI 688
            Q  +  P ++ +++L KT  VW Q    + +T  ILK    GIF+VR + D  +MVLS     K   L+++   V  +K   +++GS  +F NI  L+  Y ++    P   L+LP+++++ T     +    L SDFW +Q+
Sbjct:  380 QATAPRPSINILEKLIKTCPVWLQLGMAQERTTLILKKENPGIFLVRKSPDQKSMVLSVCVSDKQEELQVQDVLVKAEKSLIYLEGSVLVFDNIFKLIAFYSVSRDILP-FTLRLPQVIVQATKYKDIEMISTLGSDFWGSQL 521          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A1S3SR17 (ras and Rab interactor 3-like isoform X1 OS=Salmo salar OX=8030 GN=LOC106611275 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.835e-8
Identity = 43/143 (30.07%), Postives = 73/143 (51.05%), Query Frame = 2
Query:  272 QTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIK----VDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQI 688
            Q  +    +S +++L KT  VW Q    + +T  ILK    GIF+VR + D  +MVLS     K   L+++     + K   +++GS  +F NI  L+  Y ++    P   L+LP+++++ T     +    L SDFW +Q+
Sbjct:  378 QATAPRASISILEKLIKTCPVWLQLGMAQERTTLILKKEIPGIFLVRKSPDQKSMVLSVGVSDKQEELQVQDVLIKEEKSLIYLEGSVLVFDNIFKLIAFYCVSRDILP-FTLRLPQVIVQATKYEDIEMISTLGSDFWGSQL 519          
BLAST of Synaptosomal-associated protein vs. TrEMBL
Match: A0A1S3SR23 (ras and Rab interactor 3-like isoform X2 OS=Salmo salar OX=8030 GN=LOC106611275 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 7.220e-8
Identity = 43/143 (30.07%), Postives = 73/143 (51.05%), Query Frame = 2
Query:  272 QTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIK----VDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQI 688
            Q  +    +S +++L KT  VW Q    + +T  ILK    GIF+VR + D  +MVLS     K   L+++     + K   +++GS  +F NI  L+  Y ++    P   L+LP+++++ T     +    L SDFW +Q+
Sbjct:  324 QATAPRASISILEKLIKTCPVWLQLGMAQERTTLILKKEIPGIFLVRKSPDQKSMVLSVGVSDKQEELQVQDVLIKEEKSLIYLEGSVLVFDNIFKLIAFYCVSRDILP-FTLRLPQVIVQATKYEDIEMISTLGSDFWGSQL 465          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: ENSAMXT00000044707.1 (SH2 domain containing 7 [Source:NCBI gene;Acc:103027007])

HSP 1 Score: 50.8322 bits (120), Expect = 1.385e-6
Identity = 23/82 (28.05%), Postives = 41/82 (50.00%), Query Frame = 2
Query:  332 VWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPI 577
             WFQ   +R   ED L++ E+G F++R++      +LSY   ++  H  I  + +  F + G T++   +  L+  Y   PI
Sbjct:  142 AWFQGFISRKDAEDHLRDKEVGCFLIRLSDKATGYILSYKGRERCRHFVINQNKEGQFIVTGDTEMHDTLTSLIQYYKTRPI 223          
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Match: ENSAMXT00000018457.2 (SH2 domain containing 7 [Source:NCBI gene;Acc:103027007])

HSP 1 Score: 50.8322 bits (120), Expect = 1.401e-6
Identity = 23/82 (28.05%), Postives = 41/82 (50.00%), Query Frame = 2
Query:  332 VWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPI 577
             WFQ   +R   ED L++ E+G F++R++      +LSY   ++  H  I  + +  F + G T++   +  L+  Y   PI
Sbjct:  142 AWFQGFISRKDAEDHLRDKEVGCFLIRLSDKATGYILSYKGRERCRHFVINQNKEGQFIVTGDTEMHDTLTSLIQYYKTRPI 223          
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Match: ENSORLT00000033324.1 (SH2 domain-containing protein 7-like [Source:NCBI gene;Acc:105358849])

HSP 1 Score: 57.3806 bits (137), Expect = 1.326e-8
Identity = 23/82 (28.05%), Postives = 45/82 (54.88%), Query Frame = 2
Query:  332 VWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPI 577
             WFQ    R   ED+L++  +G F++R++   I  ++SY    +  H  I  +    F + G  ++F +++ L+D+Y ++PI
Sbjct:   88 AWFQGLAPRQHAEDLLRDKGVGSFLIRLSDKAIGYIVSYKGHDRCRHFVITQNQHGQFVVAGDCELFGSLNELIDHYRVSPI 169          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000016905.1 (SMESG000016905.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 312/315 (99.05%), Postives = 314/315 (99.68%), Query Frame = 2
Query:  101 MDDLFAKTIKALASDIDRKWNVKKGYDDDDIFLTHAHDLPKRLLXXXXXXXXXXXXQQTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQICQLKLNEIFVDSLIDVNYDSKLQKKDYQESTLSLPGLKLRKNQNTEQAYKYENKRKLNIFKKMKSKICKDSTSSTEACGTNPNARRKSFSLFSVHPPESKNLKYVSGLACDLDDYDYDE 1045
            MDDLFAKTIKALASDIDRKWNVKKGYDDDDIFLTHAHDLPKRLLPPIPVEKPNPIPQQTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQICQLKLNEIFVDSLIDVNYDSKLQKKDYQESTLSLPGLKLRK QNTEQAYKYENKRKLNIFKK+KSKICKDSTSSTEACGTNPNARRKSFSLFSVHPPESKNLKYVSG+ACDLDDYDYDE
Sbjct:    1 MDDLFAKTIKALASDIDRKWNVKKGYDDDDIFLTHAHDLPKRLLPPIPVEKPNPIPQQTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQICQLKLNEIFVDSLIDVNYDSKLQKKDYQESTLSLPGLKLRKKQNTEQAYKYENKRKLNIFKKVKSKICKDSTSSTEACGTNPNARRKSFSLFSVHPPESKNLKYVSGIACDLDDYDYDE 315          
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Match: SMESG000016903.1 (SMESG000016903.1)

HSP 1 Score: 173.711 bits (439), Expect = 1.972e-47
Identity = 90/209 (43.06%), Postives = 132/209 (63.16%), Query Frame = 2
Query:  101 MDDLFAKTIKALASDIDRKWNVKKGYDDDDIFL--THAHDLPKRLLXXXXXXXXXXXXQQTASYSPP-VSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGIFIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVLLDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQICQLKLNEIFV 718
            MD ++A+TI + ASD+D  W  K  +   +I+   T  +    R L     +          S++P  ++N  RL KT+S+W QP +TR   E IL  FE GIFI+R+NSD+ TMVLSY    +V H+KIKVD ++GF++DGS+ IFK+++ ++ +Y ++ I  PD+ LKLPR L E +  +HFKFFENLKSDFW T +    ++EIF+
Sbjct:    1 MDAIYAETINSFASDLDHIWKDKNKFKHQNIYQERTDGNCSLNRFLLSASSKFTAQ-----KSHNPEMINNTQRLTKTSSIWIQPDFTRYDVEKILNEFETGIFIIRVNSDSKTMVLSYKTEDRVQHVKIKVDLRRGFYMDGSSNIFKSVNEMIAHYMVHTIQSPDLLLKLPRALREASDATHFKFFENLKSDFWKTSLPNKSIDEIFI 204          
The following BLAST results are available for this feature:
BLAST of Synaptosomal-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL159141.13.382e-827.07Ras and Rab interactor 3 [Source:NCBI gene;Acc:798... [more]
AL159141.15.211e-827.07Ras and Rab interactor 3 [Source:NCBI gene;Acc:798... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rin31.329e-727.07Ras and Rab interactor 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch211-112g6.42.753e-628.40si:ch211-112g6.4 [Source:ZFIN;Acc:ZDB-GENE-160728-... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpn21.482e-629.55ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
rpn21.625e-629.55ribophorin II [Source:Xenbase;Acc:XB-GENE-941830][more]
HSH2D4.641e-631.82hematopoietic SH2 domain containing [Source:NCBI g... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8TB24|RIN3_HUMAN2.503e-727.07Ras and Rab interactor 3 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Synaptosomal-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HR451.431e-831.06LOW QUALITY PROTEIN: uncharacterized protein LOC10... [more]
A0A060XQG61.842e-830.07Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
A0A4W5QZT33.540e-830.77Ras and Rab interactor 3 OS=Hucho hucho OX=62062 P... [more]
A0A1S3SR175.835e-830.07ras and Rab interactor 3-like isoform X1 OS=Salmo ... [more]
A0A1S3SR237.220e-830.07ras and Rab interactor 3-like isoform X2 OS=Salmo ... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000044707.11.385e-628.05SH2 domain containing 7 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000018457.21.401e-628.05SH2 domain containing 7 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000033324.11.326e-828.05SH2 domain-containing protein 7-like [Source:NCBI ... [more]
back to top
BLAST of Synaptosomal-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016905.10.000e+099.05SMESG000016905.1[more]
SMESG000016903.11.972e-4743.06SMESG000016903.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018982 ID=SMED30018982|Name=Synaptosomal-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1172bp
TAGAATTATATTACTAATTGAATTATGTTTAATTTAAATTGAATGTTTTT
TAGAGTTGTTTTGATTGCATTATATAGTGAAAAGTAATTAGACAATCTTA
ATGGATGATTTATTTGCTAAAACAATTAAAGCACTGGCATCAGATATTGA
TAGGAAATGGAATGTTAAAAAAGGTTACGATGATGACGATATTTTCTTAA
CACATGCTCATGACTTACCAAAACGACTTTTACCTCCAATTCCTGTAGAA
AAACCTAATCCGATTCCTCAACAGACTGCTTCCTACTCACCTCCCGTTAG
CAACGTAGACCGGTTACGCAAGACGGCGTCAGTATGGTTTCAGCCAAAAT
ATACAAGACTTCAAACTGAAGATATCCTTAAAAATTTCGAGATTGGAATT
TTCATAGTCAGAATGAATTCGGATAATATAACAATGGTGCTCTCGTATAA
TTTTGGGAAAAAAGTGGTACACCTTAAAATTAAAGTAGACCATAAAAAAG
GATTTTTTATTGATGGATCAACAAAAATTTTTAAAAATATTCATGTTTTG
CTCGATAATTATTTTATTAACCCAATTTTTGACCCTGACATAAAACTTAA
ACTTCCAAGAATCTTGATGGAATTGACGCATCCAAGTCATTTCAAGTTCT
TTGAAAATTTGAAATCAGATTTTTGGGTTACACAAATTTGTCAATTGAAA
TTGAATGAAATCTTTGTGGACTCTCTCATTGATGTTAATTATGATTCAAA
ATTGCAAAAAAAGGATTACCAAGAGTCAACGTTGAGTCTTCCGGGTCTTA
AATTAAGAAAAAACCAAAATACAGAGCAAGCATATAAATATGAAAATAAA
AGGAAATTAAATATCTTTAAAAAAATGAAATCAAAAATATGTAAAGATTC
TACATCATCGACAGAAGCATGTGGAACAAATCCGAATGCAAGAAGAAAAT
CCTTTTCCTTGTTTTCAGTGCACCCTCCAGAGTCGAAAAATTTAAAATAT
GTATCCGGATTAGCCTGTGACTTGGATGATTATGATTACGATGAATAATT
TCAAAATTTTAATTTTTTTAAATTGCTAAATTTTGTTAGATTTTTGTGAA
GTTTAAGACAAAAATTTCAAAATGAAAATTATTTTTATTATCTTTTTTCA
ATAGAATTTTGTCTAATTTAAA
back to top

protein sequence of SMED30018982-orf-1

>SMED30018982-orf-1 ID=SMED30018982-orf-1|Name=SMED30018982-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MDDLFAKTIKALASDIDRKWNVKKGYDDDDIFLTHAHDLPKRLLPPIPVE
KPNPIPQQTASYSPPVSNVDRLRKTASVWFQPKYTRLQTEDILKNFEIGI
FIVRMNSDNITMVLSYNFGKKVVHLKIKVDHKKGFFIDGSTKIFKNIHVL
LDNYFINPIFDPDIKLKLPRILMELTHPSHFKFFENLKSDFWVTQICQLK
LNEIFVDSLIDVNYDSKLQKKDYQESTLSLPGLKLRKNQNTEQAYKYENK
RKLNIFKKMKSKICKDSTSSTEACGTNPNARRKSFSLFSVHPPESKNLKY
VSGLACDLDDYDYDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000980SH2 domainSMARTSM00252SH2_5coord: 77..160
e-value: 7.9E-7
score: 38.7
IPR000980SH2 domainPFAMPF00017SH2coord: 79..154
e-value: 4.1E-6
score: 26.8
IPR000980SH2 domainPROSITEPS50001SH2coord: 79..170
score: 11.635
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 73..179
e-value: 1.2E-13
score: 52.9
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 57..162
NoneNo IPR availablePANTHERPTHR23101RAB GDP/GTP EXCHANGE FACTORcoord: 45..196
NoneNo IPR availablePANTHERPTHR23101:SF58RAS AND RAB INTERACTOR 3coord: 45..196
NoneNo IPR availableCDDcd00173SH2coord: 79..154
e-value: 9.72297E-12
score: 57.8507