Tubulin beta chain

Overview
NameTubulin beta chain
Smed IDSMED30018979
Length (bp)709
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin beta chain (SMED30018979) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin beta chain (SMED30018979) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin beta chain (SMED30018979) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin beta chain (SMED30018979) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018979

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30018979SMESG000074579.1 SMESG000074423.1 dd_Smed_v4_13626_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30018979SMESG000074579.1 SMESG000074423.1 Contig5007_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30018979SMESG000074579.1 SMESG000074423.1 Contig5007_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30018979SMESG000074579.1 SMESG000074423.1 Contig5007_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30018979SMESG000048286.1 Contig3496_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30018979SMESG000074579.1 SMESG000074423.1 SMED_05331_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018979SMESG000074579.1 SMESG000074423.1 SMED_05331_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.417 bits (594), Expect = 3.244e-75
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  240 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.417 bits (594), Expect = 3.244e-75
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  240 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.417 bits (594), Expect = 3.244e-75
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  240 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.417 bits (594), Expect = 3.244e-75
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  240 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 233.417 bits (594), Expect = 3.244e-75
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  240 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 231.106 bits (588), Expect = 8.803e-74
Identity = 105/119 (88.24%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  312 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 230.335 bits (586), Expect = 1.633e-73
Identity = 103/119 (86.55%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL+SEYQQYQ+ATA
Sbjct:  312 TVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 230.335 bits (586), Expect = 1.633e-73
Identity = 103/119 (86.55%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL+SEYQQYQ+ATA
Sbjct:  312 TVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 230.335 bits (586), Expect = 1.633e-73
Identity = 103/119 (86.55%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL+SEYQQYQ+ATA
Sbjct:  312 TVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 230.335 bits (586), Expect = 1.633e-73
Identity = 103/119 (86.55%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL+SEYQQYQ+ATA
Sbjct:  312 TVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 230.335 bits (586), Expect = 2.328e-73
Identity = 104/118 (88.14%), Postives = 116/118 (98.31%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLN+QNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+AT
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 429          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086537)

HSP 1 Score: 229.95 bits (585), Expect = 3.302e-73
Identity = 104/118 (88.14%), Postives = 116/118 (98.31%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLN+QNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+AT
Sbjct:  321 TVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 438          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 228.024 bits (580), Expect = 1.645e-72
Identity = 102/119 (85.71%), Postives = 116/119 (97.48%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLN+QNKNSS+FVEWIP+N KTAVCDI PRG+KMS TFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 228.024 bits (580), Expect = 2.311e-72
Identity = 105/119 (88.24%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+ML VQNKNSSYFVEWIP+NVKTAVCDI P+G+KMS TFIGN TAIQE+FKRI+EQ+SAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  317 TVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 435          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0072270)

HSP 1 Score: 227.639 bits (579), Expect = 2.612e-72
Identity = 105/119 (88.24%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+ML VQNKNSSYFVEWIP+NVKTAVCDI P+G+KMS TFIGN TAIQE+FKRI+EQ+SAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  318 TVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 436          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb2b (tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-722])

HSP 1 Score: 233.417 bits (594), Expect = 1.620e-74
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:153426 (zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220])

HSP 1 Score: 233.417 bits (594), Expect = 1.648e-74
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 233.417 bits (594), Expect = 1.966e-74
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 233.417 bits (594), Expect = 1.966e-74
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 233.417 bits (594), Expect = 1.966e-74
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 234.572 bits (597), Expect = 3.577e-75
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  275 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 393          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 234.572 bits (597), Expect = 8.752e-75
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 234.187 bits (596), Expect = 1.086e-74
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 233.417 bits (594), Expect = 2.730e-74
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 228.024 bits (580), Expect = 3.020e-72
Identity = 103/116 (88.79%), Postives = 114/116 (98.28%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 350
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 234.572 bits (597), Expect = 6.487e-75
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2a (tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:MGI:107861])

HSP 1 Score: 234.572 bits (597), Expect = 6.700e-75
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 233.417 bits (594), Expect = 2.067e-74
Identity = 106/118 (89.83%), Postives = 117/118 (99.15%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 229.18 bits (583), Expect = 7.913e-73
Identity = 104/116 (89.66%), Postives = 114/116 (98.28%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 350
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb3 (tubulin, beta 3 class III [Source:MGI Symbol;Acc:MGI:107813])

HSP 1 Score: 224.942 bits (572), Expect = 4.868e-71
Identity = 102/119 (85.71%), Postives = 114/119 (95.80%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVA +FRGR+SMKEVDE+ML +Q+KNSSYFVEWIP+NVK AVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P02556|TBB_LYTPI (Tubulin beta chain (Fragment) OS=Lytechinus pictus OX=7653 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.147e-77
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:   43 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 161          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P18700|TBB_STRPU (Tubulin beta chain (Fragment) OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.964e-76
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  157 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 275          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P30883|TBB4_XENLA (Tubulin beta-4 chain OS=Xenopus laevis OX=8355 GN=tubb4 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.441e-74
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P32882|TBB2_CHICK (Tubulin beta-2 chain OS=Gallus gallus OX=9031 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.538e-74
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q3KRE8|TBB2B_RAT (Tubulin beta-2B chain OS=Rattus norvegicus OX=10116 GN=Tubb2b PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.538e-74
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A3P7NBH0 (Tubulin_C domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS18098 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.486e-76
Identity = 107/119 (89.92%), Postives = 118/119 (99.16%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTF+GN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:    2 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFVGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 120          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A9CTA5 (Beta-tubulin (Fragment) OS=Pinctada fucata OX=50426 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.650e-75
Identity = 107/119 (89.92%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:   41 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 159          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A3S5FFD8 (Tubulin_C domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS24608 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.035e-75
Identity = 107/119 (89.92%), Postives = 118/119 (99.16%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:   46 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 164          
BLAST of Tubulin beta chain vs. TrEMBL
Match: Q5BYA7 (Tubulin_C domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.644e-75
Identity = 107/119 (89.92%), Postives = 118/119 (99.16%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:   46 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 164          
BLAST of Tubulin beta chain vs. TrEMBL
Match: Q5BXV9 (Tubulin_C domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 3.026e-75
Identity = 107/119 (89.92%), Postives = 118/119 (99.16%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:   20 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 138          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 233.417 bits (594), Expect = 1.562e-74
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.72 bits (587), Expect = 1.615e-74
Identity = 104/116 (89.66%), Postives = 115/116 (99.14%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 350
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Sbjct:  231 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 346          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 232.646 bits (592), Expect = 2.348e-73
Identity = 105/119 (88.24%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+ML+VQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+F+RI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  389 TVAAIFRGRMSMKEVDEQMLSVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 507          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 215.312 bits (547), Expect = 1.477e-67
Identity = 95/119 (79.83%), Postives = 109/119 (91.60%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVA +FRGR+S KEVDE+ML +Q KNS+YFV+WIP NVK AVCDI PRG+KM+ TFIGNNTAIQEIF+R+ EQ++ MFRRKAFLHWYTGEGMDEMEFTEAE+N+NDLVSEYQQYQDATA
Sbjct:  286 TVAGIFRGRMSTKEVDEQMLAIQQKNSNYFVDWIPHNVKVAVCDIPPRGLKMASTFIGNNTAIQEIFRRVGEQFAMMFRRKAFLHWYTGEGMDEMEFTEAENNLNDLVSEYQQYQDATA 404          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019222.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 85.1149 bits (209), Expect = 7.882e-19
Identity = 39/117 (33.33%), Postives = 69/117 (58.97%), Query Frame = 3
Query:   15 MFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAV----CDIAPRG----MKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 341
            ++RG V  K+V+  + N++ K S  FV+W P+  K  +      + P G    ++ +V  + N TAI E + R+  ++  M+ ++AF+HWY GEGM+E EF+EA  ++  L  +Y++
Sbjct:  318 LYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEE 434          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 153.68 bits (387), Expect = 3.087e-45
Identity = 69/81 (85.19%), Postives = 79/81 (97.53%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRK 245
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRK
Sbjct:  295 TVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 5.918e-18
Identity = 42/113 (37.17%), Postives = 64/113 (56.64%), Query Frame = 3
Query:    6 VAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTG-EGMDEMEFTEAESNMNDLVSEYQQ 341
             A M RG V + +V   +  +  K S +FV+W     KT +C + P G   S+  + NNT ++  F  I E+++ ++RRKA LH YT  EGM+   FTEA S++  ++ EY Q
Sbjct:  346 CALMVRGNVQLSDVRRNIERL--KPSLHFVDWNEEGWKTGLCSVPPVGYPHSLLALANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQ 456          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 56.6102 bits (135), Expect = 1.014e-9
Identity = 29/117 (24.79%), Postives = 61/117 (52.14%), Query Frame = 3
Query:    6 VAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAP---RGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGM---DEMEFTEAESNMNDLVSEYQ 338
            +  + +G V   +V + +  ++ +  + F+ W P++++ A+   +P      ++S   + N+T+I  +F R  +QY  + +R+AFL  +  E M   D  EF ++   +  L+ EYQ
Sbjct:  315 ILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLTSAHRVSGLMMANHTSISSLFDRTCKQYDKLRKREAFLDQFRKEDMFKEDLSEFDDSREVVQQLIDEYQ 431          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubd1 (tubulin, delta 1 [Source:ZFIN;Acc:ZDB-GENE-040625-73])

HSP 1 Score: 46.595 bits (109), Expect = 2.084e-6
Identity = 24/104 (23.08%), Postives = 49/104 (47.12%), Query Frame = 3
Query:   36 MKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCD--IAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 341
            ++  D     +  + +   + W+P     AV     AP G   S T + N+TA+    +    +   MF  +A++H YT  G+ E +F ++ + +  +++ Y+Q
Sbjct:  345 LRGPDAHATPLGFQRTPMALPWVPPEAALAVWSERRAPTGYGKSATLLANDTAVISPVEHAVSKAWRMFVSRAYVHQYTHHGVSEEDFLDSFTLLEQVIASYRQ 448          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubd1 (tubulin, delta 1 [Source:ZFIN;Acc:ZDB-GENE-040625-73])

HSP 1 Score: 45.8246 bits (107), Expect = 3.251e-6
Identity = 23/86 (26.74%), Postives = 42/86 (48.84%), Query Frame = 3
Query:   90 FVEWIPSNVKTAVCD--IAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 341
               W+P     AV     AP G   S T + N+TA+    +    +   MF  +A++H YT  G+ E +F ++ + +  +++ Y+Q
Sbjct:  349 LCRWVPPEAALAVWSERRAPTGYGKSATLLANDTAVISPVEHAVSKAWRMFVSRAYVHQYTHHGVSEEDFLDSFTLLEQVIASYRQ 434          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 197.978 bits (502), Expect = 1.142e-61
Identity = 87/118 (73.73%), Postives = 108/118 (91.53%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAA FRG+VS+KEV++EM  VQ+KNS YFVEWIP+NV+TAVC +AP+G+ M+ TFI N+T+IQE+FKR+ +Q+SAMF+RKAFLHWYT EGMDE+EF+EAESNMNDLVSEYQQYQ+AT
Sbjct:  312 TVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEAT 429          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 84.7297 bits (208), Expect = 1.320e-19
Identity = 40/115 (34.78%), Postives = 65/115 (56.52%), Query Frame = 3
Query:   15 MFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMS--------VTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEY 335
            ++RG V  ++V   +  V+NK +   V+W P+  K  +C   P  +  S        V  + N TAI + +KRI +++  M+ ++AF+HWY GEGM+E EFTEA  ++  L  +Y
Sbjct:  319 LYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDY 433          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 84.7297 bits (208), Expect = 1.408e-19
Identity = 40/115 (34.78%), Postives = 63/115 (54.78%), Query Frame = 3
Query:   15 MFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMS--------VTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEY 335
            ++RG V  ++V   +  V+NK +   V+W P+  K  +C   P     S        V  + N T+I E +KRI  ++  M+ ++AF+HWY GEGM+E EFTEA  ++  L  +Y
Sbjct:  319 LYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDY 433          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO36734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY4])

HSP 1 Score: 234.958 bits (598), Expect = 1.073e-76
Identity = 107/118 (90.68%), Postives = 116/118 (98.31%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  222 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 339          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 236.113 bits (601), Expect = 5.296e-76
Identity = 108/119 (90.76%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 234.572 bits (597), Expect = 2.318e-75
Identity = 107/118 (90.68%), Postives = 116/118 (98.31%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  312 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 233.417 bits (594), Expect = 4.251e-75
Identity = 106/118 (89.83%), Postives = 116/118 (98.31%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAAMFRGR+SMKE+DE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  308 TVAAMFRGRMSMKELDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 425          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJY0])

HSP 1 Score: 225.328 bits (573), Expect = 1.427e-73
Identity = 104/118 (88.14%), Postives = 113/118 (95.76%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAAMFRGR+SMKEV E+MLNVQNKNSSYFVEWIP+NVKTAVCDI P  +KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  166 TVAAMFRGRMSMKEVFEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPLVLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 283          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 232.646 bits (592), Expect = 4.149e-74
Identity = 105/119 (88.24%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+F+RI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAIFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 229.95 bits (585), Expect = 3.667e-73
Identity = 104/116 (89.66%), Postives = 115/116 (99.14%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 350
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Sbjct:  312 TVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 212.231 bits (539), Expect = 5.178e-66
Identity = 93/119 (78.15%), Postives = 109/119 (91.60%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVA +FRG++S KEVDE+ML +Q KNS+YFV+WIP NVK AVCDI P+G++M+ TFIGNNTAIQEIF+R+ EQ+S MFRRKAFLHWYTGEGMDEMEFTEAESN+NDLVSEYQQYQ+ATA
Sbjct:  312 TVAGIFRGKMSTKEVDEQMLAIQQKNSTYFVDWIPHNVKVAVCDIPPKGLRMASTFIGNNTAIQEIFRRVGEQFSLMFRRKAFLHWYTGEGMDEMEFTEAESNLNDLVSEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000020049.2 (tubulin alpha-1B chain [Source:NCBI gene;Acc:101159587])

HSP 1 Score: 85.5001 bits (210), Expect = 4.957e-19
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 3
Query:   15 MFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAV----CDIAPRG----MKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 341
            ++RG V  K+V+  +  ++ K S  FV+W P+  K  +      + P G    +K +V  + N TAI E + R+  ++  M+ ++AF+HWY GEGM+E EF+EA  +M  L  +Y++
Sbjct:  283 LYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVKRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEE 399          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 84.7297 bits (208), Expect = 5.690e-19
Identity = 39/117 (33.33%), Postives = 68/117 (58.12%), Query Frame = 3
Query:   15 MFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAV----CDIAPRG----MKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 341
            +FRG V  K+V+  +  ++ K +  FV+W P+  K  +      + P G    ++ +V  + N TAI E + R+  ++  M+ ++AF+HWY GEGM+E EF+EA  +M  L  +Y++
Sbjct:  193 LFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEE 309          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000062548.1 (SMESG000062548.1)

HSP 1 Score: 234.958 bits (598), Expect = 7.594e-76
Identity = 107/118 (90.68%), Postives = 116/118 (98.31%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 356
            TVAAMFRGR+S+KEVDEEMLNVQNKNS+YFVEWIPSNVKTAVCDI PRGMKM+VTFIGNNTAIQEIFKRIAEQY+AM+RRKAFLHWYTGEGMDEMEFTEAESN+NDL+SEYQQ+QD T
Sbjct:  281 TVAAMFRGRLSVKEVDEEMLNVQNKNSAYFVEWIPSNVKTAVCDIPPRGMKMAVTFIGNNTAIQEIFKRIAEQYAAMYRRKAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDTT 398          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000047291.1 (SMESG000047291.1)

HSP 1 Score: 234.572 bits (597), Expect = 4.127e-75
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000044888.1 (SMESG000044888.1)

HSP 1 Score: 234.572 bits (597), Expect = 4.127e-75
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAALFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074579.1 (SMESG000074579.1)

HSP 1 Score: 234.572 bits (597), Expect = 4.396e-75
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+N KTAVCDI PRG+KMSVTFIGN+T+IQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNAKTAVCDIPPRGLKMSVTFIGNSTSIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074423.1 (SMESG000074423.1)

HSP 1 Score: 234.572 bits (597), Expect = 4.396e-75
Identity = 106/119 (89.08%), Postives = 117/119 (98.32%), Query Frame = 3
Query:    3 TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 359
            TVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+N KTAVCDI PRG+KMSVTFIGN+T+IQE+FKR++EQ++AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 TVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNAKTAVCDIPPRGLKMSVTFIGNSTSIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of Tubulin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB3.244e-7589.83tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB3.244e-7589.83tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB3.244e-7589.83tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB3.244e-7589.83tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB3.244e-7589.83tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbb-48.803e-7488.24Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.633e-7386.55Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.633e-7386.55Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.633e-7386.55Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.633e-7386.55Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub56D2.328e-7388.14gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub56D3.302e-7388.14gene:FBgn0284243 transcript:FBtr0086537[more]
betaTub85D1.645e-7285.71gene:FBgn0003889 transcript:FBtr0082046[more]
betaTub60D2.311e-7288.24gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub60D2.612e-7288.24gene:FBgn0003888 transcript:FBtr0072270[more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb2b1.620e-7489.08tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
zgc:1534261.648e-7489.08zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220][more]
zgc:554611.966e-7489.08zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554611.966e-7489.08zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554611.966e-7489.08zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reps23.577e-7589.92RALBP1 associated Eps domain containing 2 [Source:... [more]
znf3308.752e-7589.92zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
reps21.086e-7489.92RALBP1 associated Eps domain containing 2 [Source:... [more]
tubb2.730e-7489.83tubulin beta class I [Source:NCBI gene;Acc:448742][more]
ubxn113.020e-7288.79UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb2b6.487e-7589.92tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb2a6.700e-7589.92tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:... [more]
Tubb52.067e-7489.83tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb4b7.913e-7389.66tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb34.868e-7185.71tubulin, beta 3 class III [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02556|TBB_LYTPI1.147e-7789.92Tubulin beta chain (Fragment) OS=Lytechinus pictus... [more]
sp|P18700|TBB_STRPU1.964e-7689.92Tubulin beta chain (Fragment) OS=Strongylocentrotu... [more]
sp|P30883|TBB4_XENLA4.441e-7489.92Tubulin beta-4 chain OS=Xenopus laevis OX=8355 GN=... [more]
sp|P32882|TBB2_CHICK4.538e-7489.92Tubulin beta-2 chain OS=Gallus gallus OX=9031 PE=1... [more]
sp|Q3KRE8|TBB2B_RAT4.538e-7489.92Tubulin beta-2B chain OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of Tubulin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7NBH04.486e-7689.92Tubulin_C domain-containing protein OS=Dibothrioce... [more]
A9CTA51.650e-7589.92Beta-tubulin (Fragment) OS=Pinctada fucata OX=5042... [more]
A0A3S5FFD82.035e-7589.92Tubulin_C domain-containing protein OS=Protopolyst... [more]
Q5BYA72.644e-7589.92Tubulin_C domain-containing protein OS=Schistosoma... [more]
Q5BXV93.026e-7589.92Tubulin_C domain-containing protein OS=Schistosoma... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:554611.562e-7489.08tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
ENSAMXT00000019550.21.615e-7489.66pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
TUBB2A2.348e-7388.24tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
TUBB11.477e-6779.83tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000019222.27.882e-1933.33tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb23.087e-4585.19tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001368.15.918e-1837.17pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubg11.014e-924.79tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
tubd12.084e-623.08tubulin, delta 1 [Source:ZFIN;Acc:ZDB-GENE-040625-... [more]
tubd13.251e-626.74tubulin, delta 1 [Source:ZFIN;Acc:ZDB-GENE-040625-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TUB21.142e-6173.73Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB31.320e-1934.78Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB11.408e-1934.78Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367341.073e-7690.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399455.296e-7690.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359582.318e-7590.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428904.251e-7589.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359591.427e-7388.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb24.149e-7488.24tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
tubb53.667e-7389.66tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
ENSORLT00000045809.15.178e-6678.15tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
ENSORLT00000020049.24.957e-1934.19tubulin alpha-1B chain [Source:NCBI gene;Acc:10115... [more]
tuba1c5.690e-1933.33tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062548.17.594e-7690.68SMESG000062548.1[more]
SMESG000047291.14.127e-7589.08SMESG000047291.1[more]
SMESG000044888.14.127e-7589.08SMESG000044888.1[more]
SMESG000074579.14.396e-7589.08SMESG000074579.1[more]
SMESG000074423.14.396e-7589.08SMESG000074423.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018979 ID=SMED30018979|Name=Tubulin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=709bp
TAACAGTCGCCGCAATGTTCAGAGGGAGAGTATCAATGAAAGAGGTCGAC
GAAGAAATGCTCAATGTTCAAAACAAAAACAGCTCTTACTTTGTCGAATG
GATACCAAGCAATGTGAAAACTGCAGTCTGTGACATTGCTCCAAGAGGAA
TGAAGATGTCTGTGACATTTATTGGAAATAACACGGCAATTCAGGAAATA
TTCAAACGAATCGCTGAACAATACAGTGCGATGTTTCGTCGAAAAGCCTT
TCTTCATTGGTACACTGGTGAAGGAATGGACGAAATGGAATTCACCGAAG
CAGAATCAAACATGAATGATTTGGTTAGTGAGTATCAACAGTATCAAGAC
GCCACTGCTGAAGAAGAAGTGGAGTTTGAAGAAGAGGAAGAAGGCGAACA
AATGTAAATCCTTTTATGAGTAAGGAACTGTTTACAATTAAATGTGTTAT
GATCAATGTGAAATTGTTGTACTTTTTCTTGCTGTATGTGTTATATTCTT
AGATATTTTTCAAATTGTCTCTCTACTTCACATGATAAAAGTATTTATTG
CAAATATTATATCCTGCCAACCGATGAAAAAGTTCAAATTGTAATAATAT
GAATAATTACTGTCAACTATTATTGGCAATATTATATGTATTGAATATTT
GTTGCTTGTCTTATTAAATGAGGCCGGTCATGTTGTGGTTGAGTGTCAAT
TTAAATGTA
back to top

protein sequence of SMED30018979-orf-1

>SMED30018979-orf-1 ID=SMED30018979-orf-1|Name=SMED30018979-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
TVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGM
KMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEMEFTEA
ESNMNDLVSEYQQYQDATAEEEVEFEEEEEGEQM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR002453Beta_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0000166nucleotide binding
GO:0003924GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 66..77
score: 56.95
coord: 36..59
score: 69.69
coord: 18..32
score: 83.16
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 2..71
e-value: 6.4E-21
score: 74.8
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 63..87
e-value: 1.6E-10
score: 42.5
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 1..62
e-value: 1.7E-25
score: 91.3
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..87
NoneNo IPR availablePANTHERPTHR11588:SF61TUBULIN BETA CHAINcoord: 1..87
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 2..87