Nuclear prelamin A recognition factor-like

Overview
NameNuclear prelamin A recognition factor-like
Smed IDSMED30018973
Length (bp)1543
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear prelamin A recognition factor-like (SMED30018973) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear prelamin A recognition factor-like (SMED30018973) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear prelamin A recognition factor-like (SMED30018973) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear prelamin A recognition factor-like (SMED30018973) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018973

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018973h1SMcG0018267 SmedASXL_012715SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018973h1SMcG0018267 SmedASXL_012715SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30018973h1SMcG0018267 dd_Smed_v4_10598_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Human
Match: CIAO3 (cytosolic iron-sulfur assembly component 3 [Source:HGNC Symbol;Acc:HGNC:14179])

HSP 1 Score: 356.295 bits (913), Expect = 1.230e-117
Identity = 199/488 (40.78%), Postives = 287/488 (58.81%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLD-NSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSL-NDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI---KDKNC----LMTSYNIIPK 1493
            FS  +++T+LDDFI P+QECIKPVK++  +    +KI I DDGS+  I ++G    +EK  +++NDCLACSGC+T+AET+LI +  H   +       +       LVVVS+SPQS+ASL+ +F L N  +T +KL +FF+ + V  V DT F R FSLLE+  E   +   Q + + + P+L+S CPGW+CYAEK  +   I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E            D E   + SL +  +  +  +H G GSGGYLE   R+ A++L+ I +       + V YK  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQR++  +C Y ++E+MACP GCLNGGGQ++   +   ++LL+ V   Y  +  + P      + +Y       D  C    L T Y+ + K
Sbjct:    5 FSGALQLTDLDDFIGPSQECIKPVKVEKRAGSGVAKIRIEDDGSYFQINQDGGTRRLEKAKVSLNDCLACSGCITSAETVLITQQSHEELKKVLDANKMAAPSQQRLVVVSVSPQSRASLAARFQL-NPTDTARKLTSFFKKIGVHFVFDTAFSRHFSLLESQREFVRRFRGQADCRQALPLLASACPGWICYAEK-THGSFILPHISTARSPQQVMGSLVKDFF-AQQQHLTPDKIYHVTVMPCYDKKLEASRPDFFNQEHQT----RDVDCVLTTGEVFRLLEEEGVSL------PDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHV-------AEVTYKPLRNKDFQEVTL--EKEGQV--LLHFAMAYGFRNIQNLVQRLKRGRCPYHYVEVMACPSGCLNGGGQLQAPDRPS-RELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTDSECAGRLLHTQYHAVEK 467          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Human
Match: CIAO3 (cytosolic iron-sulfur assembly component 3 [Source:HGNC Symbol;Acc:HGNC:14179])

HSP 1 Score: 271.166 bits (692), Expect = 7.305e-86
Identity = 155/382 (40.58%), Postives = 222/382 (58.12%), Query Frame = 3
Query:  381 LVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSL-NDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI---KDKNC----LMTSYNIIPK 1493
            LVVVS+SPQS+ASL+ +F L N  +T +KL +FF+ + V  V DT F R FSLLE+  E   +   Q + + + P+L+S CPGW+CYAEK  +   I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E         +  D E   + SL +  +  +  +H G GSGGYLE   R+ A++L+ I +       + V YK  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQR++  +C Y ++E+MACP GCLNGGGQ++   +   ++LL+ V   Y  +  + P      + +Y       D  C    L T Y+ + K
Sbjct:    9 LVVVSVSPQSRASLAARFQL-NPTDTARKLTSFFKKIGVHFVFDTAFSRHFSLLESQREFVRRFRGQADCRQALPLLASACPGWICYAEK-THGSFILPHISTARSPQQVMGSLVKDFF-AQQQHLTPDKIYHVTVMPCYDKKLEASRPDFFNQEHQT----RDVDCVLTTGEVFRLLEEEG------VSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHV-------AEVTYKPLRNKDFQEVTL--EKEGQV--LLHFAMAYGFRNIQNLVQRLKRGRCPYHYVEVMACPSGCLNGGGQLQAPDRPS-RELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTDSECAGRLLHTQYHAVEK 365          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Human
Match: CIAO3 (cytosolic iron-sulfur assembly component 3 [Source:HGNC Symbol;Acc:HGNC:14179])

HSP 1 Score: 271.166 bits (692), Expect = 7.305e-86
Identity = 155/382 (40.58%), Postives = 222/382 (58.12%), Query Frame = 3
Query:  381 LVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSL-NDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI---KDKNC----LMTSYNIIPK 1493
            LVVVS+SPQS+ASL+ +F L N  +T +KL +FF+ + V  V DT F R FSLLE+  E   +   Q + + + P+L+S CPGW+CYAEK  +   I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E         +  D E   + SL +  +  +  +H G GSGGYLE   R+ A++L+ I +       + V YK  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQR++  +C Y ++E+MACP GCLNGGGQ++   +   ++LL+ V   Y  +  + P      + +Y       D  C    L T Y+ + K
Sbjct:    9 LVVVSVSPQSRASLAARFQL-NPTDTARKLTSFFKKIGVHFVFDTAFSRHFSLLESQREFVRRFRGQADCRQALPLLASACPGWICYAEK-THGSFILPHISTARSPQQVMGSLVKDFF-AQQQHLTPDKIYHVTVMPCYDKKLEASRPDFFNQEHQT----RDVDCVLTTGEVFRLLEEEG------VSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHV-------AEVTYKPLRNKDFQEVTL--EKEGQV--LLHFAMAYGFRNIQNLVQRLKRGRCPYHYVEVMACPSGCLNGGGQLQAPDRPS-RELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTDSECAGRLLHTQYHAVEK 365          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Human
Match: NARF (nuclear prelamin A recognition factor [Source:HGNC Symbol;Acc:HGNC:29916])

HSP 1 Score: 228.024 bits (580), Expect = 2.578e-68
Identity = 148/468 (31.62%), Postives = 242/468 (51.71%), Query Frame = 3
Query:  123 QECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDK---YSMEKVNITINDCLACSGCVTTAETILINEHSSXX--XXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNI---KNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY-------NGIKDKNCLMTSYN 1481
            +EC K  K D+ +  ++        + +  +ENG+K   + +    I ++DCLAC  C+T  E + +++ ++++      +    +     ++VVS+ PQS    + KFNL +  +  ++L  F ++L V  V DTT   +FS+LE+  E   + + +    +  P+L+S CPGWV YAE+     +   L +  KSPQQ+MG LVK +     N     KIFHV V PC+DKKLEA +   +   +  G R    D VL++ EI QI  +     R      D  ++ +F   D   +K   H+G+ S G+L    R+ AK+L+N D+         V Y+  RN DFQEV+L    E++ E +L F+ AYGFRN+Q ++ +++  K  + F+E++AC  GCLNG GQ +T      K LL ++   Y  + ++ P  + + + +Y       N  K +  L T+Y 
Sbjct:    9 KECSKKTKTDDQENVSAD-------APSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNL-SVTDASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCT-AKSPQQVMGSLVKDYFARQQN-LSPEKIFHVIVAPCYDKKLEALQE--SLPPALHGSR--GADCVLTSGEIAQIMEQGDLSVR------DAAVDTLF--GDLKEDKVTRHDGASSDGHLAHIFRHAAKELFNEDVEE-------VTYRALRNKDFQEVTL----EKNGEVVLRFAAAYGFRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINSPKAREVLHTTYQ 443          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Human
Match: NARF (nuclear prelamin A recognition factor [Source:HGNC Symbol;Acc:HGNC:29916])

HSP 1 Score: 212.231 bits (539), Expect = 7.962e-63
Identity = 130/377 (34.48%), Postives = 200/377 (53.05%), Query Frame = 3
Query:  381 LVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNI---KNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY-------NGIKDKNCLMTSYN 1481
            ++VVS+ PQS    + KFNL +  +  ++L  F ++L V  V DTT   +FS+LE+  E   + + +    +  P+L+S CPGWV YAE+     +   L +  KSPQQ+MG LVK +     N     KIFHV V PC+DKKLEA +   +   +  G R    D VL++ EI QI  +     R      D  ++ +F   D   +K   H+G+ S G+L    R+ AK+L+N D+         V Y+  RN DFQEV+L    E++ E +L F+ AYGFRN+Q ++ +++  K  + F+E++AC  GCLNG GQ +T      K LL ++   Y  + ++ P  + + + +Y       N  K +  L T+Y 
Sbjct:   45 VLVVSVCPQSLPYFAAKFNL-SVTDASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCT-AKSPQQVMGSLVKDYFARQQN-LSPEKIFHVIVAPCYDKKLEALQE--SLPPALHGSR--GADCVLTSGEIAQIMEQGDLSVR------DAAVDTLF--GDLKEDKVTRHDGASSDGHLAHIFRHAAKELFNEDVEE-------VTYRALRNKDFQEVTL----EKNGEVVLRFAAAYGFRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINSPKAREVLHTTYQ 395          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Celegans
Match: oxy-4 (Probable cytosolic Fe-S cluster assembly factor oxy-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9N392])

HSP 1 Score: 229.18 bits (583), Expect = 3.513e-69
Identity = 150/452 (33.19%), Postives = 237/452 (52.43%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFS---LLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLE-----FTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQ 1403
            FS  +R++ + DFI P  +CI P++    ++K  +  +         +E+      + V I++ DCLACSGC+T+AET+L+ E S    ++ I       +  L VV++SPQ+  S++ K    +  E  K + +FF+ L V  V+D++F R+F+   + E  + T         + P+LSS CPG+VCYAEK  + +L++P IS+ +SPQ I G ++K FL A         +FH +VMPCFDKKLEA+R +F       G   ++ D V+ST E+ +   + + D   E    +N  E    L+  +       +G  SGGY +     F L      +    LN+N+       + T   S+  E+            LL  +  YGFRN+Q +V++++ KK    ++EIMACP GC NGGGQIR E+ +E+++ L KV   Y+ L  Q
Sbjct:    6 FSGVVRLSNVSDFIAPNLDCIIPLETRTVEKKKEESQVNIRTKKPKDKESSKTEEKKSVKISLADCLACSGCITSAETVLVEEQSFGRVYEGI------QNSKLSVVTVSPQAITSIAVKIG-KSTNEVAKIIASFFRRLGVKYVIDSSFARKFAHSLIYEELSTTPST------SRPLLSSACPGFVCYAEKS-HGELLIPKISKIRSPQAISGAIIKGFL-AKREGLSPCDVFHAAVMPCFDKKLEASREQFKV----DGTDVRETDCVISTAELLEEIIKLEND---EAGDVENRSEEEQWLSALSKGSVIGDDGGASGGYADRIVRDFVLENGGGIVKTSKLNKNM-------FSTTVESEAGEI------------LLRVAKVYGFRNVQNLVRKMKTKKEKTDYVEIMACPGGCANGGGQIRYETMDEREEKLIKVEALYEDLPRQ 416          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Fly
Match: CG17683 (gene:FBgn0262115 transcript:FBtr0111298)

HSP 1 Score: 296.975 bits (759), Expect = 5.693e-95
Identity = 181/485 (37.32%), Postives = 289/485 (59.59%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDD------TLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATE-----RQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKC-NYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKNCLMTSYNII 1487
             S  +++T++DDFITP+Q CIKPV++D +  KT +KI I  DG F    E+G+   + KV+I++ DCLACSGC+T+AE +LI + S EE  K ++   +N           +V +++ Q   SL+ ++ +G   +  + L  +F++L  D VL T    + +LLE   E  ++ + N +N  +LSS CPGWVCYAEK   N  ++P +S T+SPQQIMG LVKQ L A+     A++I+HV+VMPC+DKKLEA+R +F F+ + +    +DVD V++++E+EQ+ +E      QYD   + +   + +   F +        + HE + SGGY E   +Y AK ++N DL   L      ++K  +N DF+E+ L    +++ + +L F+ A GFRN+Q +VQ+++ +K  NY F+E+MACP GC+NGG QIR  + +  ++L  K+   Y++L    P  N   + +YN   D      SY+++
Sbjct:    4 LSRALQLTDIDDFITPSQICIKPVQIDKARSKTGAKIKIKGDGCFEE-SESGN-LKLNKVDISLQDCLACSGCITSAEEVLITQQSREELLKVLQENSKNKASEDWDNVRTIVFTLATQPILSLAYRYQIG-VEDAARHLNGYFRSLGADYVLSTKVADDIALLECRQEFVDRYREN-ENLTMLSSSCPGWVCYAEKTHGN-FLLPYVSTTRSPQQIMGVLVKQIL-ADKMNVPASRIYHVTVMPCYDKKLEASREDF-FSKANNS---RDVDCVITSVEVEQLLSEAQQPLSQYDL-LDLDWPWSNVRPEFMV--------WAHEKTLSGGYAEHIFKYAAKHIFNEDLKTEL------EFKQLKNRDFREIIL----KQNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGAQIRPTTGQHVRELTRKLEELYQNLPRSEP-ENSLTKHIYNDFLDGFQSDKSYDVL 458          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Fly
Match: CG17683 (gene:FBgn0262115 transcript:FBtr0111299)

HSP 1 Score: 286.189 bits (731), Expect = 7.479e-91
Identity = 178/485 (36.70%), Postives = 286/485 (58.97%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDD------TLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATE-----RQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKC-NYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKNCLMTSYNII 1487
             S  +++T++DDFITP+Q    PV++D +  KT +KI I  DG F    E+G+   + KV+I++ DCLACSGC+T+AE +LI + S EE  K ++   +N           +V +++ Q   SL+ ++ +G   +  + L  +F++L  D VL T    + +LLE   E  ++ + N +N  +LSS CPGWVCYAEK   N  ++P +S T+SPQQIMG LVKQ L A+     A++I+HV+VMPC+DKKLEA+R +F F+ + +    +DVD V++++E+EQ+ +E      QYD   + +   + +   F +        + HE + SGGY E   +Y AK ++N DL   L      ++K  +N DF+E+ L    +++ + +L F+ A GFRN+Q +VQ+++ +K  NY F+E+MACP GC+NGG QIR  + +  ++L  K+   Y++L    P  N   + +YN   D      SY+++
Sbjct:    4 LSRALQLTDIDDFITPSQ----PVQIDKARSKTGAKIKIKGDGCFEE-SESGN-LKLNKVDISLQDCLACSGCITSAEEVLITQQSREELLKVLQENSKNKASEDWDNVRTIVFTLATQPILSLAYRYQIG-VEDAARHLNGYFRSLGADYVLSTKVADDIALLECRQEFVDRYREN-ENLTMLSSSCPGWVCYAEKTHGN-FLLPYVSTTRSPQQIMGVLVKQIL-ADKMNVPASRIYHVTVMPCYDKKLEASREDF-FSKANNS---RDVDCVITSVEVEQLLSEAQQPLSQYDL-LDLDWPWSNVRPEFMV--------WAHEKTLSGGYAEHIFKYAAKHIFNEDLKTEL------EFKQLKNRDFREIIL----KQNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGAQIRPTTGQHVRELTRKLEELYQNLPRSEP-ENSLTKHIYNDFLDGFQSDKSYDVL 454          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Fly
Match: CG17683 (gene:FBgn0262115 transcript:FBtr0111300)

HSP 1 Score: 258.07 bits (658), Expect = 1.818e-80
Identity = 156/429 (36.36%), Postives = 252/429 (58.74%), Query Frame = 3
Query:  237 MEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDD------TLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATE-----RQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKC-NYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKNCLMTSYNII 1487
            + KV+I++ DCLACSGC+T+AE +LI + S EE  K ++   +N           +V +++ Q   SL+ ++ +G   +  + L  +F++L  D VL T    + +LLE   E  ++ + N +N  +LSS CPGWVCYAEK   N  ++P +S T+SPQQIMG LVKQ L A+     A++I+HV+VMPC+DKKLEA+R +F F+ + +    +DVD V++++E+EQ+ +E      QYD   + +   + +   F +        + HE + SGGY E   +Y AK ++N DL   L      ++K  +N DF+E+ L    +++ + +L F+ A GFRN+Q +VQ+++ +K  NY F+E+MACP GC+NGG QIR  + +  ++L  K+   Y++L    P  N   + +YN   D      SY+++
Sbjct:   11 LNKVDISLQDCLACSGCITSAEEVLITQQSREELLKVLQENSKNKASEDWDNVRTIVFTLATQPILSLAYRYQIG-VEDAARHLNGYFRSLGADYVLSTKVADDIALLECRQEFVDRYREN-ENLTMLSSSCPGWVCYAEKTHGN-FLLPYVSTTRSPQQIMGVLVKQIL-ADKMNVPASRIYHVTVMPCYDKKLEASREDF-FSKANNS---RDVDCVITSVEVEQLLSEAQQPLSQYDL-LDLDWPWSNVRPEFMV--------WAHEKTLSGGYAEHIFKYAAKHIFNEDLKTEL------EFKQLKNRDFREIIL----KQNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGAQIRPTTGQHVRELTRKLEELYQNLPRSEP-ENSLTKHIYNDFLDGFQSDKSYDVL 411          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Fly
Match: CG17683 (gene:FBgn0262115 transcript:FBtr0111301)

HSP 1 Score: 204.142 bits (518), Expect = 1.708e-61
Identity = 117/303 (38.61%), Postives = 183/303 (60.40%), Query Frame = 3
Query:  597 VLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATE-----RQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKC-NYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKNCLMTSYNII 1487
            +LSS CPGWVCYAEK   N  ++P +S T+SPQQIMG LVKQ L A+     A++I+HV+VMPC+DKKLEA+R +F F+ + +    +DVD V++++E+EQ+ +E      QYD   + +   + +   F +        + HE + SGGY E   +Y AK ++N DL   L      ++K  +N DF+E+ L    +++ + +L F+ A GFRN+Q +VQ+++ +K  NY F+E+MACP GC+NGG QIR  + +  ++L  K+   Y++L    P  N   + +YN   D      SY+++
Sbjct:    1 MLSSSCPGWVCYAEKTHGN-FLLPYVSTTRSPQQIMGVLVKQIL-ADKMNVPASRIYHVTVMPCYDKKLEASREDF-FSKANNS---RDVDCVITSVEVEQLLSEAQQPLSQYDL-LDLDWPWSNVRPEFMV--------WAHEKTLSGGYAEHIFKYAAKHIFNEDLKTEL------EFKQLKNRDFREIIL----KQNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGAQIRPTTGQHVRELTRKLEELYQNLPRSEP-ENSLTKHIYNDFLDGFQSDKSYDVL 277          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Zebrafish
Match: narfl (nuclear prelamin A recognition factor-like [Source:NCBI gene;Acc:560541])

HSP 1 Score: 357.451 bits (916), Expect = 2.740e-118
Identity = 195/498 (39.16%), Postives = 303/498 (60.84%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSD-RKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI---QLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI-------KDKNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK++    R  +KI I DDGS+  + ++G +  +EK  IT+NDCLACSGC+T+AE++LI +  H       +      + +  +VVVS+SPQS+ASL+  + +G++ E  +KL +F + L V  V DT F R FSL+E+  E  ++    + + K  P+L+S CPGW+CYAEK  + + I+P IS T+SPQQIMG LVK +  A+        I+HV+VMPC+DKKLEA+R +F  +  ++    ++VD V+++ E+ ++  E +   R   + +   ++ MFS  +  G +   H GSGSGGYL    ++ AK+L+ +D++        + YKT +N DFQEV+L    E+  + LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  + +  K+LL++V   Y+S    +P  +     +Y          K +  L T Y+ + K    N  S+KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVEKKQGRSVAKIQIEDDGSYFQVHQDGQRQKLEKAKITLNDCLACSGCITSAESVLITQQSHEELYRVLRHNKQVSSTEQKVVVVSVSPQSRASLAAHYGIGSS-EVARKLTSFLKHLGVHHVFDTAFSRSFSLIESQREFLQRFSQREADKKALPMLASACPGWICYAEK-THGEFILPYISTTRSPQQIMGSLVKGYF-ASQKGVSPQMIYHVTVMPCYDKKLEASRPDFYLSEHET----REVDCVITSGEVLKMLEEEKVSLR---DVQPAPLDTMFS--NVCGEELLGHAGSGSGGYLHHIYKHAAKQLFGVDVDE-------LTYKTMKNKDFQEVTL----EKDGQVLLKFAAVYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQLKPSADQSNKELLQQVEEVYRSEHPSVPEDDSQVAELYQSWLESVGEEKARQLLHTQYHAVEKTA--NGLSIKW 477          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Zebrafish
Match: narf (nuclear prelamin A recognition factor [Source:NCBI gene;Acc:436614])

HSP 1 Score: 232.261 bits (591), Expect = 4.968e-70
Identity = 136/409 (33.25%), Postives = 220/409 (53.79%), Query Frame = 3
Query:  249 NITINDCLACSGCVTTAETILINEHS--SXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKN 1460
             + ++ CL+C GC++  E   I++ +         +    +     ++VVS+ PQS    + KF L  +A   +KL  F +++ V  V DTT    FS+LE+  E  ++ +    ++   P+ +S CPGW+ YAE+   + ++ P I   +SPQQIMG LVK F  A   +    ++FHV V PCFDKKLEA R+EF  +  +S    +DVD VL++ EI  +  + +         +   ++++     ++G     H+G GS G+LE   ++ AK+++ +D+         + YKT RN DFQEV+L    E   E LL F+  YGFRN+QT+V R++  K  YQ IE+++CP GCL+G GQ   E     + L++++   Y SL ++LP  N   + +Y    D +
Sbjct:   50 QVLLSACLSCDGCISEDEGKRISQQNLDEINHVLALNKKCDTSKHKILVVSVCPQSVPFFAVKFQLDVSAAA-QKLCGFLKSVGVHYVFDTTIAASFSILESQREFVQRYRRKHHDANAMPMFTSSCPGWIRYAERVLGS-VVTPHICTARSPQQIMGSLVKNFF-ARQQKLTPEQVFHVVVAPCFDKKLEAVRDEFYNSILES----RDVDCVLTSGEILHLMEQSKVTVE---EVDSAPLDHVIGEISDSG--LTRHDGRGSEGFLEHIFKHAAKEIFGLDVQD-------IVYKTLRNRDFQEVAL----ERDGETLLQFAAVYGFRNIQTLVHRMRKGKVPYQLIEVLSCPGGCLSGRGQAEGEGGRPDRTLVQQMEEHYSSLPVRLPETNPEVQRLYQDWLDGH 435          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Zebrafish
Match: narf (nuclear prelamin A recognition factor [Source:NCBI gene;Acc:436614])

HSP 1 Score: 232.261 bits (591), Expect = 4.968e-70
Identity = 136/409 (33.25%), Postives = 220/409 (53.79%), Query Frame = 3
Query:  249 NITINDCLACSGCVTTAETILINEHS--SXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKN 1460
             + ++ CL+C GC++  E   I++ +         +    +     ++VVS+ PQS    + KF L  +A   +KL  F +++ V  V DTT    FS+LE+  E  ++ +    ++   P+ +S CPGW+ YAE+   + ++ P I   +SPQQIMG LVK F  A   +    ++FHV V PCFDKKLEA R+EF  +  +S    +DVD VL++ EI  +  + +         +   ++++     ++G     H+G GS G+LE   ++ AK+++ +D+         + YKT RN DFQEV+L    E   E LL F+  YGFRN+QT+V R++  K  YQ IE+++CP GCL+G GQ   E     + L++++   Y SL ++LP  N   + +Y    D +
Sbjct:   50 QVLLSACLSCDGCISEDEGKRISQQNLDEINHVLALNKKCDTSKHKILVVSVCPQSVPFFAVKFQLDVSAAA-QKLCGFLKSVGVHYVFDTTIAASFSILESQREFVQRYRRKHHDANAMPMFTSSCPGWIRYAERVLGS-VVTPHICTARSPQQIMGSLVKNFF-ARQQKLTPEQVFHVVVAPCFDKKLEAVRDEFYNSILES----RDVDCVLTSGEILHLMEQSKVTVE---EVDSAPLDHVIGEISDSG--LTRHDGRGSEGFLEHIFKHAAKEIFGLDVQD-------IVYKTLRNRDFQEVAL----ERDGETLLQFAAVYGFRNIQTLVHRMRKGKVPYQLIEVLSCPGGCLSGRGQAEGEGGRPDRTLVQQMEEHYSSLPVRLPETNPEVQRLYQDWLDGH 435          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Zebrafish
Match: narfl (nuclear prelamin A recognition factor-like [Source:NCBI gene;Acc:560541])

HSP 1 Score: 55.0694 bits (131), Expect = 1.242e-9
Identity = 25/50 (50.00%), Postives = 37/50 (74.00%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSD-RKTSKIIIGDDGSFTGIRE 218
            FS  +++T+LDDFITP+QEC+KPVK++    R  +KI I DDGS+  + +
Sbjct:    4 FSGVLQLTDLDDFITPSQECVKPVKVEKKQGRSVAKIQIEDDGSYFQVHQ 53          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Xenopus
Match: ciao3 (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:100127749])

HSP 1 Score: 311.612 bits (797), Expect = 3.778e-100
Identity = 202/511 (39.53%), Postives = 305/511 (59.69%), Query Frame = 3
Query:   69 SFSTGIRITELDDFITPAQECIKPVKLDN-SDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNH---DDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQL---NIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRY-----------QATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY-------NGIKDKNCLMTSYNIIPKLEFLNPSSLKW 1526
            SFS  +++T+LDDFI P+QECIKP+K++  + R  +KI I DDGS+  I   G    +EK  IT+NDCLACSGCVT+AETILI + S EE +K +K  K +    +  +VVVS+SPQS ASL+ +FNL +  +T +KL  FF+ L V  V DT F R FSLLE+  E  ++ +    + K+ P+L+S CPGW+CYAEK  +   I+P IS TKSPQQ+MG LVK     +   +           +  +I+HV+VMPC+DKKLEA+R +F     ++    +DV+ V++T E+ ++  +         + + + ++ +F        +   H+G GSGGYLE   R+ A++L+ + ++        V YK  +N DFQEV+L    E+    +L F+ AYGFRN+Q +VQ+++  +C Y ++E+MACP GCLNGGGQI+ E  E  KDLL++V   Y ++  + P   +    +Y       +  K +  L T Y+ + K+   +  ++KW
Sbjct:    4 SFSGVLQLTDLDDFIGPSQECIKPIKVEKKAGRAAAKIQIEDDGSYVQINPEGAARKLEKAKITLNDCLACSGCVTSAETILITQQSHEELYKILKQNKVSKNPLEHKVVVVSVSPQSWASLAARFNL-SMQDTAQKLTAFFKQLGVHHVFDTNFSRNFSLLESQREFIQRFKRQKEDKKSLPMLASACPGWICYAEK-THGSFILPYISSTKSPQQVMGSLVKMSKSHSGLMFSSLSLQCLQNLKPNQIYHVTVMPCYDKKLEASRPDFYNQEYET----RDVNCVITTGEVLRMLEQEGLSLS---DVDPSPLDTLF--GSAMQEEPVGHQGGGSGGYLEHVFRHAAQELFGVHVDT-------VVYKPLKNKDFQEVTL----EQDGNVVLHFALAYGFRNIQNLVQKLKRGRCPYHYVEVMACPSGCLNGGGQIKAEG-EGSKDLLQRVEELYNTVRTERPEEREEVAQLYGDWLEDKDSAKARQALHTQYHAVEKIN--SGLTIKW 489          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Xenopus
Match: tapbp (TAP binding protein (tapasin) [Source:Xenbase;Acc:XB-GENE-490289])

HSP 1 Score: 249.595 bits (636), Expect = 1.304e-76
Identity = 156/449 (34.74%), Postives = 244/449 (54.34%), Query Frame = 3
Query:  108 FITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAE--TILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY 1439
            FI P+  C+ P++L       S++I+     F         + + +  I ++DCLACS CVT+ E   I             +    ++    LVV S+SPQS    + KF+L +  E  KKL  F ++L V  VLDTT   +FS+LET  +  ++ +   ++    P+ +S CPGWV YAE+    D + P I   KSPQQIMG LVK +  ++ N     KIFH+ V PC+D+KLEA R+++ +T   +    +DVD VL++ E+ QI  ++    +     E+  +EN+F        +F  HEG+ S GYL    R+ AK+L+++D+         + YK  +N DF EVSL    E+  E +L F+ AYGFRN+Q +V +++  K +Y F+E++ACP GCLNG GQ ++   + ++ LL ++   Y  + IQ P  N + + +Y
Sbjct:   17 FICPSH-CLTPLRL-------SQLIMSISYEF---------HRLAEAKIFLSDCLACSNCVTSEEGAKIFAQNQKELFKVLNLNKKCDSSLHKLVVASVSPQSVPYFAVKFDL-SVCEAAKKLCGFLKSLGVHHVLDTTIAADFSILETQRDFIQRFRRQTQDEHAFPMFASACPGWVQYAER-VLGDSVTPHICTAKSPQQIMGSLVKGYFASSKN-LSPDKIFHLMVAPCYDRKLEALRDDY-YTELFNC---RDVDCVLTSGEVMQIMEQKNISVK---EMEEIPLENVFG---ETSFEFVRHEGTSSDGYLAHVFRHAAKELFDMDVQE-------ISYKALKNKDFLEVSL----EKDGETVLRFAAAYGFRNIQNMVLKLRKGKFHYHFVEVLACPGGCLNGKGQAQSTEGKVERALLHEMEEVYTRVPIQKPESNPHIQALY 424          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Xenopus
Match: tapbp (TAP binding protein (tapasin) [Source:Xenbase;Acc:XB-GENE-490289])

HSP 1 Score: 248.054 bits (632), Expect = 4.238e-76
Identity = 150/424 (35.38%), Postives = 233/424 (54.95%), Query Frame = 3
Query:  183 IGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAE--TILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY 1439
            I D  +     E  + + + +  I ++DCLACS CVT+ E   I             +    ++    LVV S+SPQS    + KF+L +  E  KKL  F ++L V  VLDTT   +FS+LET  +  ++ +   ++    P+ +S CPGWV YAE+    D + P I   KSPQQIMG LVK +  ++ N     KIFH+ V PC+D+KLEA R+++ +T   +    +DVD VL++ E+ QI  ++    +     E+  +EN+F        +F  HEG+ S GYL    R+ AK+L+++D+         + YK  +N DF EVSL    E+  E +L F+ AYGFRN+Q +V +++  K +Y F+E++ACP GCLNG GQ ++   + ++ LL ++   Y  + IQ P  N + + +Y
Sbjct:   23 ILDAPALADGEEKSEFHRLAEAKIFLSDCLACSNCVTSEEGAKIFAQNQKELFKVLNLNKKCDSSLHKLVVASVSPQSVPYFAVKFDL-SVCEAAKKLCGFLKSLGVHHVLDTTIAADFSILETQRDFIQRFRRQTQDEHAFPMFASACPGWVQYAER-VLGDSVTPHICTAKSPQQIMGSLVKGYFASSKN-LSPDKIFHLMVAPCYDRKLEALRDDY-YTELFNC---RDVDCVLTSGEVMQIMEQKNISVK---EMEEIPLENVFG---ETSFEFVRHEGTSSDGYLAHVFRHAAKELFDMDVQE-------ISYKALKNKDFLEVSL----EKDGETVLRFAAAYGFRNIQNMVLKLRKGKFHYHFVEVLACPGGCLNGKGQAQSTEGKVERALLHEMEEVYTRVPIQKPESNPHIQALY 422          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Xenopus
Match: tapbp (TAP binding protein (tapasin) [Source:Xenbase;Acc:XB-GENE-490289])

HSP 1 Score: 246.514 bits (628), Expect = 1.291e-75
Identity = 147/408 (36.03%), Postives = 228/408 (55.88%), Query Frame = 3
Query:  231 YSMEKVNITINDCLACSGCVTTAE--TILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY 1439
            + + +  I ++DCLACS CVT+ E   I             +    ++    LVV S+SPQS    + KF+L +  E  KKL  F ++L V  VLDTT   +FS+LET  +  ++ +   ++    P+ +S CPGWV YAE+    D + P I   KSPQQIMG LVK +  ++ N     KIFH+ V PC+D+KLEA R+++ +T   +    +DVD VL++ E+ QI  ++    +     E+  +EN+F        +F  HEG+ S GYL    R+ AK+L+++D+         + YK  +N DF EVSL    E+  E +L F+ AYGFRN+Q +V +++  K +Y F+E++ACP GCLNG GQ ++   + ++ LL ++   Y  + IQ P  N + + +Y
Sbjct:   22 HRLAEAKIFLSDCLACSNCVTSEEGAKIFAQNQKELFKVLNLNKKCDSSLHKLVVASVSPQSVPYFAVKFDL-SVCEAAKKLCGFLKSLGVHHVLDTTIAADFSILETQRDFIQRFRRQTQDEHAFPMFASACPGWVQYAER-VLGDSVTPHICTAKSPQQIMGSLVKGYFASSKN-LSPDKIFHLMVAPCYDRKLEALRDDY-YTELFNC---RDVDCVLTSGEVMQIMEQKNISVK---EMEEIPLENVFG---ETSFEFVRHEGTSSDGYLAHVFRHAAKELFDMDVQE-------ISYKALKNKDFLEVSL----EKDGETVLRFAAAYGFRNIQNMVLKLRKGKFHYHFVEVLACPGGCLNGKGQAQSTEGKVERALLHEMEEVYTRVPIQKPESNPHIQALY 405          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Xenopus
Match: tapbp (TAP binding protein (tapasin) [Source:Xenbase;Acc:XB-GENE-490289])

HSP 1 Score: 241.506 bits (615), Expect = 2.032e-73
Identity = 156/459 (33.99%), Postives = 241/459 (52.51%), Query Frame = 3
Query:  120 AQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAE--TILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFL---------PANNNRY-----QATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY 1439
            +QEC K  K + +        I D  +     E  + + + +  I ++DCLACS CVT+ E   I             +    ++    LVV S+SPQS    + KF+L +  E  KKL  F ++L V  VLDTT   +FS+LET  +  ++ +   ++    P+ +S CPGWV YAE+    D + P I   KSPQQIMG LVK +          P N   +        KIFH+ V PC+D+KLEA R+++ +T   +    +DVD VL++ E+ QI  ++    +     E+  +EN+F        +F  HEG+ S GYL    R+ AK+L+++D+         + YK  +N DF EVSL    E+  E +L F+ AYGFRN+Q +V +++  K +Y F+E++ACP GCLNG GQ ++   + ++ LL ++   Y  + IQ P  N + + +Y
Sbjct:    8 SQECSKKKKTEENGE------ILDAPALADGEEKSEFHRLAEAKIFLSDCLACSNCVTSEEGAKIFAQNQKELFKVLNLNKKCDSSLHKLVVASVSPQSVPYFAVKFDL-SVCEAAKKLCGFLKSLGVHHVLDTTIAADFSILETQRDFIQRFRRQTQDEHAFPMFASACPGWVQYAER-VLGDSVTPHICTAKSPQQIMGSLVKGYFASSKVGRTSPCNWAVHCLRNLSPDKIFHLMVAPCYDRKLEALRDDY-YTELFNC---RDVDCVLTSGEVMQIMEQKNISVK---EMEEIPLENVFG---ETSFEFVRHEGTSSDGYLAHVFRHAAKELFDMDVQE-------ISYKALKNKDFLEVSL----EKDGETVLRFAAAYGFRNIQNMVLKLRKGKFHYHFVEVLACPGGCLNGKGQAQSTEGKVERALLHEMEEVYTRVPIQKPESNPHIQALY 437          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Mouse
Match: Ciao3 (cytosolic iron-sulfur assembly component 3 [Source:MGI Symbol;Acc:MGI:1914813])

HSP 1 Score: 328.176 bits (840), Expect = 7.355e-107
Identity = 199/501 (39.72%), Postives = 287/501 (57.29%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKL-DNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI-------KDKNCLMTSYNIIPKLEFLNPS---SLKW 1526
            FS  +++T+LDDFI P+Q CIKPVK+        +KI I DDGS+  + ++G    +EK  +++NDCLACSGCVT+AET+LI +  H                   LVVVSISPQS+ASL+ +F L +  +T +KL +FF+ + V  V DT F R FSLLE+  E  ++   Q N + + PVL+S CPGW+CYAEK   N  I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E           E   ++ + S    +  +  +H G GSGGYLE   R+ A++L+ I +       + V Y+  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQ+++  +C Y ++E+MACP GCLNGGGQ++     E  +LL+++   Y  +  + P      + +Y          +    L T Y+ + K     PS   S++W
Sbjct:    5 FSGALQLTDLDDFIGPSQNCIKPVKVAKKPGSGIAKIHIEDDGSYFQVNQDGRTQKLEKAKVSLNDCLACSGCVTSAETVLITQQSHEELRKVLDANKEAAPGQQRLVVVSISPQSRASLAARFRL-DPTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEFVQRFREQANSREALPVLASACPGWICYAEKTHGN-FILPYISTARSPQQVMGSLVKDFF-AQQQLLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQT----RDVDCVLTTGEVFRLLEEEGVSL---TELEPAPLDGLTS--SVSAEEPSSHRGGGSGGYLEHVFRHAAQELFGIHV-------AEVTYQPLRNKDFQEVTL--EREGQV--LLRFAVAYGFRNIQNLVQKLKRGRCPYHYVEVMACPSGCLNGGGQLKAPDT-EGSELLQQLERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASRLLHTQYHAVEK-----PSSGLSIRW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Mouse
Match: Ciao3 (cytosolic iron-sulfur assembly component 3 [Source:MGI Symbol;Acc:MGI:1914813])

HSP 1 Score: 324.709 bits (831), Expect = 2.870e-105
Identity = 196/513 (38.21%), Postives = 283/513 (55.17%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKL-DNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSG------------GYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI-------KDKNCLMTSYNIIPKLEFLNPS---SLKW 1526
            FS  +++T+LDDFI P+Q CIKPVK+        +KI I DDGS+  + ++G    +EK  +++NDCLACSGCVT+AET+LI +  H                   LVVVSISPQS+ASL+ +F L +  +T +KL +FF+ + V  V DT F R FSLLE+  E  ++   Q N + + PVL+S CPGW+CYAEK   N  I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E      TE      +  ++  +      +      S S             GYLE   R+ A++L+ I +       + V Y+  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQ+++  +C Y ++E+MACP GCLNGGGQ++     E  +LL+++   Y  +  + P      + +Y          +    L T Y+ + K     PS   S++W
Sbjct:    5 FSGALQLTDLDDFIGPSQNCIKPVKVAKKPGSGIAKIHIEDDGSYFQVNQDGRTQKLEKAKVSLNDCLACSGCVTSAETVLITQQSHEELRKVLDANKEAAPGQQRLVVVSISPQSRASLAARFRL-DPTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEFVQRFREQANSREALPVLASACPGWICYAEKTHGN-FILPYISTARSPQQVMGSLVKDFF-AQQQLLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQT----RDVDCVLTTGEVFRLLEEEGVSL-TELEPAPLDGLDLSCVAPPALTRPSPRTSSVSAEEPSSHRGGGSGGYLEHVFRHAAQELFGIHV-------AEVTYQPLRNKDFQEVTL--EREGQV--LLRFAVAYGFRNIQNLVQKLKRGRCPYHYVEVMACPSGCLNGGGQLKAPDT-EGSELLQQLERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASRLLHTQYHAVEK-----PSSGLSIRW 492          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Mouse
Match: Ciao3 (cytosolic iron-sulfur assembly component 3 [Source:MGI Symbol;Acc:MGI:1914813])

HSP 1 Score: 254.603 bits (649), Expect = 1.160e-79
Identity = 153/386 (39.64%), Postives = 216/386 (55.96%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKL-DNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSG------------GYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESE 1175
            FS  +++T+LDDFI P+Q CIKPVK+        +KI I DDGS+  + ++G    +EK  +++NDCLACSGCVT+AET+LI +  H                   LVVVSISPQS+ASL+ +F L +  +T +KL +FF+ + V  V DT F R FSLLE+  E  ++   Q N + + PVL+S CPGW+CYAEK   N  I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E      TE      +  ++  +      +      S S             GYLE   R+ A++L+ I +       + V Y+  RN DFQEV+L  E +
Sbjct:    5 FSGALQLTDLDDFIGPSQNCIKPVKVAKKPGSGIAKIHIEDDGSYFQVNQDGRTQKLEKAKVSLNDCLACSGCVTSAETVLITQQSHEELRKVLDANKEAAPGQQRLVVVSISPQSRASLAARFRL-DPTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEFVQRFREQANSREALPVLASACPGWICYAEKTHGN-FILPYISTARSPQQVMGSLVKDFF-AQQQLLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQT----RDVDCVLTTGEVFRLLEEEGVSL-TELEPAPLDGLDLSCVAPPALTRPSPRTSSVSAEEPSSHRGGGSGGYLEHVFRHAAQELFGIHV-------AEVTYQPLRNKDFQEVTLEREGQ 375          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Mouse
Match: Narf (nuclear prelamin A recognition factor [Source:MGI Symbol;Acc:MGI:1914858])

HSP 1 Score: 240.736 bits (613), Expect = 3.127e-73
Identity = 158/483 (32.71%), Postives = 252/483 (52.17%), Query Frame = 3
Query:  123 QECIKPVKLDNSDRKTSKIIIGDDGSFTG--IRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXX--NHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYN-------GIKDKNCLMTSYNII-PKLEFLNPSSLKW 1526
            +EC K  K D+ +  +S      DG+       E G+ + +    I ++DCLAC  CVT  E + +++ S+++F   + L K        ++VVS+ PQS    + KFNL +  +  ++L  F ++L V  V DTT   +FS+LE+  E   +   + +     P+L+S CPGWV YAE+      I+P +   KSPQQ+MG LVK +     N     KIFHV V PC+DKKLEA R     + + +G R    D VL++ EI QI  +      ++ + +D  ++ +F   D        H+G  S G+L    R+ AK+L+   +         + Y+  RN DF EV+L    E++ E LL F+ AYGFRN+Q ++Q+++  K  Y F+E++ACP+GCLNG GQ +TE     + LL+++   Y  + ++ P  + + + +Y          K +  L TSY  + P  + L+   +KW
Sbjct:    9 KECSKKSKTDDQENVSSDGAQPSDGASPAKESEEKGEFHKLADAKIFLSDCLACDSCVTVEEGVQLSQQSAKDFLHVLNLNKRCDTSKHRVLVVSVCPQSLPYFAAKFNL-SVTDASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRRYHQHSEEQRELPMLTSACPGWVRYAERVLGRP-IIPYLCTAKSPQQVMGSLVKDYFARQQN-LSPEKIFHVVVAPCYDKKLEALRE--GLSTTLNGAR--GTDCVLTSGEIAQIMEQ------SDLSVKDIAVDTLF--GDMKEVAVQRHDGVSSDGHLAHVFRHAAKELFGEHVEE-------ITYRALRNKDFHEVTL----EKNGEVLLRFAAAYGFRNIQNMIQKLKKGKLPYHFVEVLACPRGCLNGRGQAQTEDGHTDRALLQQMEGIYSGIPVRPPESSTHVQELYQEWLEGTESPKVQEVLHTSYQSLEPCTDGLD---IKW 462          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Mouse
Match: Ciao3 (cytosolic iron-sulfur assembly component 3 [Source:MGI Symbol;Acc:MGI:1914813])

HSP 1 Score: 47.3654 bits (111), Expect = 9.595e-7
Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKL-DNSDRKTSKIIIGDDGSFTGIRE 218
            FS  +++T+LDDFI P+Q CIKPVK+        +KI I DDGS+  + +
Sbjct:    5 FSGALQLTDLDDFIGPSQNCIKPVKVAKKPGSGIAKIHIEDDGSYFQVNQ 54          
BLAST of Nuclear prelamin A recognition factor-like vs. UniProt/SwissProt
Match: sp|Q9H6Q4|CIAO3_HUMAN (Cytosolic iron-sulfur assembly component 3 OS=Homo sapiens OX=9606 GN=CIAO3 PE=1 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 5.906e-117
Identity = 199/488 (40.78%), Postives = 287/488 (58.81%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLD-NSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSL-NDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI---KDKNC----LMTSYNIIPK 1493
            FS  +++T+LDDFI P+QECIKPVK++  +    +KI I DDGS+  I ++G    +EK  +++NDCLACSGC+T+AET+LI +  H   +       +       LVVVS+SPQS+ASL+ +F L N  +T +KL +FF+ + V  V DT F R FSLLE+  E   +   Q + + + P+L+S CPGW+CYAEK  +   I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E            D E   + SL +  +  +  +H G GSGGYLE   R+ A++L+ I +       + V YK  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQR++  +C Y ++E+MACP GCLNGGGQ++   +   ++LL+ V   Y  +  + P      + +Y       D  C    L T Y+ + K
Sbjct:    5 FSGALQLTDLDDFIGPSQECIKPVKVEKRAGSGVAKIRIEDDGSYFQINQDGGTRRLEKAKVSLNDCLACSGCITSAETVLITQQSHEELKKVLDANKMAAPSQQRLVVVSVSPQSRASLAARFQL-NPTDTARKLTSFFKKIGVHFVFDTAFSRHFSLLESQREFVRRFRGQADCRQALPLLASACPGWICYAEK-THGSFILPHISTARSPQQVMGSLVKDFF-AQQQHLTPDKIYHVTVMPCYDKKLEASRPDFFNQEHQT----RDVDCVLTTGEVFRLLEEEGVSL------PDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHV-------AEVTYKPLRNKDFQEVTL--EKEGQV--LLHFAMAYGFRNIQNLVQRLKRGRCPYHYVEVMACPSGCLNGGGQLQAPDRPS-RELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTDSECAGRLLHTQYHAVEK 467          
BLAST of Nuclear prelamin A recognition factor-like vs. UniProt/SwissProt
Match: sp|Q5RF36|CIAO3_PONAB (Cytosolic iron-sulfur assembly component 3 OS=Pongo abelii OX=9601 GN=CIAO3 PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 4.085e-116
Identity = 199/488 (40.78%), Postives = 286/488 (58.61%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLD-NSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSL-NDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGI---KDKNC----LMTSYNIIPK 1493
            FS  +++T+LDDFI P+QECIKPVK++  +    +KI I DDGS+  I ++G    +EK  +++NDCLACSGC+T+AET+LI +  H   +       +       LVVVS+SPQS+ASL+ +F L N  +T +KL +FF+ + V  V DT F R FSLLE+  E   +   Q + K + P+L+S CPGW+CYAEK  +   I+P IS  +SPQQ+MG LVK F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E            D E   + SL +  +  +  +H G GSGGYLE   R+ A++L+ I +       + V YK  RN DFQEV+L  E E  V  LL  + AYGFRN+Q +VQR++  +C Y ++E+MACP GCLNGGGQ++   +   ++LL+ V   Y  +  + P      + +Y       D  C    L T Y+ + K
Sbjct:    5 FSGALQLTDLDDFIGPSQECIKPVKVEKRAGSGVAKIRIEDDGSYFQINQDGGTRRLEKAKVSLNDCLACSGCITSAETVLITQQSHEELKKVLDANKMVAPSQQRLVVVSVSPQSRASLAARFQL-NPTDTARKLTSFFKKIGVHFVFDTAFSRHFSLLESQREFVRRFRGQADCKQALPLLASACPGWICYAEK-THGSFILPHISTARSPQQVMGSLVKDFF-AQQQHLTPDKIYHVTVMPCYDKKLEASRPDFFNQEHQT----RDVDCVLTTGEVFRLLEEEGVSL------PDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHV-------AEVTYKPLRNKDFQEVTL--EKEGQV--LLHLAMAYGFRNIQNLVQRLKRGRCPYHYVEVMACPSGCLNGGGQLQAPDRPS-RELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTDSECAGRLLHTQYHAVEK 467          
BLAST of Nuclear prelamin A recognition factor-like vs. UniProt/SwissProt
Match: sp|Q5BK18|CIAO3_RAT (Cytosolic iron-sulfur assembly component 3 OS=Rattus norvegicus OX=10116 GN=Ciao3 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 2.538e-112
Identity = 194/498 (38.96%), Postives = 287/498 (57.63%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKL-DNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY-------NGIKDKNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFI P+Q CIKPV +        +KI I DDGS+  +  +G    +EK  +++NDCLACSGCVT+AETILI +  H           +       LVVVS+SPQS+ASL+ +F L ++ +T +KL +FF+ + V  V DT F R FSLLE+  E  ++   Q N + + P+L+S CPGW+CYAEK   N  I+P IS  +SPQQ+MG L+K F  A        KI+HV+VMPC+DKKLEA+R +F     ++    +DVD VL+T E+ ++  E             + +    S  +       +H G GSGGYLE   R+ A++L+ I +       + V Y+  RN DFQEV+L  E E  V  LL F+ AYGFRN+Q +VQ+++  +C Y ++E+MACP GCLNGGGQ++     E ++LL++V   Y  +  + P      + +Y       +  +  + L T Y+ + K+   +  S++W
Sbjct:    5 FSGALQLTDLDDFIGPSQSCIKPVTVAKKPGSGIAKIHIEDDGSYFQVNPDGRSQKLEKAKVSLNDCLACSGCVTSAETILITQQSHEELRKVLDANKVAAPGQQRLVVVSVSPQSRASLAARFQL-DSTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEFVQRFREQANSREALPMLASACPGWICYAEKTHGN-FILPYISTARSPQQVMGSLIKDFF-AQQQLLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQT----RDVDCVLTTGEVFRLLEEEGVSLSELEPVPLDGLTRSVSAEEPT-----SHRGGGSGGYLEHVFRHAAQELFGIHV-------ADVTYQPMRNKDFQEVTL--EREGQV--LLRFAVAYGFRNIQNLVQKLKRGRCPYHYVEVMACPSGCLNGGGQLKAPDT-EGRELLQQVERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASHLLHTQYHAVEKIN--SGLSIRW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. UniProt/SwissProt
Match: sp|Q16ML2|NARF_AEDAE (Probable cytosolic Fe-S cluster assembly factor AAEL012261 OS=Aedes aegypti OX=7159 GN=AAEL012261 PE=3 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 9.850e-112
Identity = 206/501 (41.12%), Postives = 305/501 (60.88%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXX----XXXXXNHDDTL--VVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKF-YTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKD--------KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QECIKPVK++ +  KT SKI I DDGS+     +G +  +EKV IT+ DCLACSGC+T+AE +LI + S EE  K +         N  D++  +V +++ Q   SL+ ++NLG   ET +++  +F+ L  D+V+DT    + SL+E+ NE  E+   N ++ P+++S CPGWVCYAEK   N  I+P I+ T+SPQQIMG LVK++L A        +I+HV+VMPC+DKKLEA+R +F F++  +    +DVD V++++EIEQ+       F      E + I+  +       + F + HE SGSGGY E+  +Y A+KL+NI++++        ++K  RN+D +E  L    E + E LL F+ A GFRN+Q +VQ+++  KCNY FIEIMACP GCLNGG Q+R  S +  ++L  ++   YK L    P  N+  E+VY    D        K  L TSY+ I K+      ++KW
Sbjct:    4 FSGALQLTDLDDFITPSQECIKPVKIETNKSKTGSKITIQDDGSYMQATSSGLQ-KLEKVEITLADCLACSGCITSAEGVLITQQSQEELLKVMNENNLAKLNNQLDSVRYIVFTVAQQPILSLAKRYNLG-PEETFERVAGYFKKLGADMVVDTKIADDLSLIESRNEFVERFNTNRQSMPMMASSCPGWVCYAEKTHGN-FILPFIATTRSPQQIMGVLVKKYL-AKILGVPGDRIYHVTVMPCYDKKLEASREDF-FSDVDNC---RDVDCVITSIEIEQMLDGTGIQFLQ--TVEPSPID--WPWPTPRPSAFVWAHESSGSGGYSEYIFKYAARKLFNINIDQ-------AEFKILRNNDLREAIL----EINGEVLLRFAIANGFRNIQNMVQKLKRGKCNYHFIEIMACPSGCLNGGAQVRPNSGQTPRELTAELEAMYKMLPQSNP-ENEAVEMVYTTFLDNAGDNNKRKEFLHTSYHQIEKMN--TALNIKW 478          
BLAST of Nuclear prelamin A recognition factor-like vs. UniProt/SwissProt
Match: sp|A4FV58|CIAO3_BOVIN (Cytosolic iron-sulfur assembly component 3 OS=Bos taurus OX=9913 GN=CIAO3 PE=2 SV=2)

HSP 1 Score: 340.502 bits (872), Expect = 7.431e-111
Identity = 197/498 (39.56%), Postives = 292/498 (58.63%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDN-SDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDDT--LVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI--QLNIKNS-PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY-------NGIKDKNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFI P+Q+CIKP+K+D       +KI I DDGS+  + ++G    +EK  I+++DCLACSGCVT+AET+LI + S EE  K +   K    D   LVV+S+SPQS+ASL+ +F L N  +T +KL  FF+ +    V DT F R FSLLE+  E   +   Q + + + PVL+S CPGW+CYAEK   + L+ P IS  +SPQQ+MG LVK F  A        K++H +VMPC+DKKLEA+R +F F+      + +DVD V++T E+ ++  E           E   ++++ S    +  +  +H+G GSGGYLE   R+ A++L+ I +       + V Y+  RN D QEV  I E E  V  LL F+ AYGFRN+Q +VQ+++  +C Y ++E+MACP GCLNGGGQ++       K+LL++V   Y  +  + P      + +Y          +    L TSY+ + K    +  S++W
Sbjct:    5 FSGALQLTDLDDFIAPSQDCIKPMKVDRRPGSGVAKIHIEDDGSYFQVSQDGGMKKLEKAKISLDDCLACSGCVTSAETVLITQQSHEELRKVLGANKTAAPDQQKLVVISVSPQSRASLAVRFQL-NPTDTARKLTAFFKKIGAHYVFDTAFSRNFSLLESQREFVRRFRGQADPEQALPVLTSACPGWICYAEKTHGSTLL-PHISTARSPQQVMGSLVKDFF-AQQQHLTPDKVYHATVMPCYDKKLEASRPDF-FSQE---HQTRDVDCVITTGEVFKLLEEEGVSL---SELEPAPLDSLCS--SASAQEPTSHQGGGSGGYLEHVFRHAAQELFGIHV-------TEVTYRPLRNKDLQEV--ILEREGQV--LLHFAAAYGFRNIQNLVQKLKRGRCPYHYVEVMACPAGCLNGGGQLKAPDM-PGKELLQQVERLYGLVRTEAPEDAPGIQELYERWLQGAGSERAGRLLHTSYHAVEKAG--SGLSIRW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. TrEMBL
Match: I3KKP8 (Nuclear prelamin A recognition factor-like OS=Oreochromis niloticus OX=8128 GN=ciao3 PE=3 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.078e-125
Identity = 217/497 (43.66%), Postives = 319/497 (64.19%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNH-DDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY----NGIKD---KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK++    K+ +KI I DDGS+  + ++G K  +EK  IT+NDCLACSGC+T+AE++LI + S EE FK ++  K N  +   VVVS+SPQ++ASL+  +NL +++E  ++L +FF+ L V  V DT+F R FSLLE+  E  E+ Q   ++S   P+L+S CPGW+CYAEK  + + I+P IS T+SPQQ+MG LVK +  A        +I+HV+VMPCFDKKLEA+R++F  TN+++    ++VD V+++ E+ ++  E         + E    + MFS     G++F +H GSGSGGYL     Y AK L+  ++ +NL+      YKT RN DFQEVSL    E+    LL F+ AYGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  + + QK+LL+KV + YK+    LP  +     +Y    N + D   K  L T Y+ + K+   N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVEKKQGKSVAKIQIEDDGSYVQVNKDGGKQKLEKAKITLNDCLACSGCITSAESVLITQQSHEELFKVLRRNKANETEQKTVVVSVSPQARASLAAHYNL-SSSEAGRRLTSFFKGLGVHHVFDTSFSRTFSLLESQREFVERFQRKQQDSKALPMLTSACPGWICYAEK-THGEYILPYISTTRSPQQMMGSLVKSYF-AGQQGLSPQQIYHVAVMPCFDKKLEASRSDFYLTNAET----REVDCVITSGEVLKMLEEENVSLN---DLESAAPDTMFS--SFCGDEFLSHAGSGSGGYLHHVFTYAAKHLFGEEV-KNLT------YKTLRNKDFQEVSL----EKDGVVLLCFASAYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQVKPSTGQNQKELLQKVEDLYKAERPLLPEDDARVAELYQSWLNSVGDERAKELLHTQYHTVEKM--TNGLTMKW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. TrEMBL
Match: A0A3P8RKR1 (Nuclear prelamin A recognition factor-like OS=Astatotilapia calliptera OX=8154 PE=3 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 4.086e-125
Identity = 215/497 (43.26%), Postives = 320/497 (64.39%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNH-DDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY----NGIKD---KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK++    K+ +KI I DDGS+  + ++G K  +EK  IT+NDCLACSGC+T+AE++LI + S EE FK ++  K N  +  +VVVS+SPQ++ASL+  +NL +++E  ++L +FF+ L V  V DT+F R FSLLE+  E  E+ Q   ++S   P+L+S CPGW+CYAEK  + + I+P IS T+SPQQ+MG LVK +  A   +    +I+HV+VMPCFDKKLEA+R++F   N+++    ++VD V+++ E+ ++  E         + E    + MFS     G++F +H GSGSGGYL     + AK L+  ++ +NL+      YKT RN DFQEVSL    E+    LL F+ AYGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  + + QK+LL+KV + YK+    LP  +     +Y    N + D   K  L T Y+ + K+   N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVEKKQGKSVAKIQIEDDGSYVQVNKDGGKQKLEKAKITLNDCLACSGCITSAESVLITQQSHEELFKVLRRNKANETEQKIVVVSVSPQARASLAAHYNL-SSSEAGRRLTSFFKDLGVHHVFDTSFSRTFSLLESQREFVERFQRKEQDSKALPMLTSACPGWICYAEK-THGEYILPFISTTRSPQQMMGSLVKSYF-AERQKLSPQQIYHVAVMPCFDKKLEASRSDFYMPNAET----REVDCVITSGEVLKMLEEENVSLN---DLESAAPDTMFS--SFCGDEFLSHAGSGSGGYLHHVFTHAAKHLFGEEV-KNLT------YKTLRNKDFQEVSL----EKDGVVLLCFASAYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQVKPSTGQNQKELLQKVEDLYKAERPLLPEDDARVAELYQSWLNSVGDERAKELLHTQYHTVEKM--TNGLAMKW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. TrEMBL
Match: A0A3P9B139 (Nuclear prelamin A recognition factor-like OS=Maylandia zebra OX=106582 PE=3 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 4.086e-125
Identity = 215/497 (43.26%), Postives = 320/497 (64.39%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNH-DDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY----NGIKD---KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK++    K+ +KI I DDGS+  + ++G K  +EK  IT+NDCLACSGC+T+AE++LI + S EE FK ++  K N  +  +VVVS+SPQ++ASL+  +NL +++E  ++L +FF+ L V  V DT+F R FSLLE+  E  E+ Q   ++S   P+L+S CPGW+CYAEK  + + I+P IS T+SPQQ+MG LVK +  A   +    +I+HV+VMPCFDKKLEA+R++F   N+++    ++VD V+++ E+ ++  E         + E    + MFS     G++F +H GSGSGGYL     + AK L+  ++ +NL+      YKT RN DFQEVSL    E+    LL F+ AYGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  + + QK+LL+KV + YK+    LP  +     +Y    N + D   K  L T Y+ + K+   N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVEKKQGKSVAKIQIEDDGSYVQVNKDGGKQKLEKAKITLNDCLACSGCITSAESVLITQQSHEELFKVLRRNKANETEQKIVVVSVSPQARASLAAHYNL-SSSEAGRRLTSFFKDLGVHHVFDTSFSRTFSLLESQREFVERFQRKEQDSKALPMLTSACPGWICYAEK-THGEYILPFISTTRSPQQMMGSLVKSYF-AERQKLSPQQIYHVAVMPCFDKKLEASRSDFYMPNAET----REVDCVITSGEVLKMLEEENVSLN---DLESAAPDTMFS--SFCGDEFLSHAGSGSGGYLHHVFTHAAKHLFGEEV-KNLT------YKTLRNKDFQEVSL----EKDGVVLLCFASAYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQVKPSTGQNQKELLQKVEDLYKAERPLLPEDDARVAELYQSWLNSVGDERAKELLHTQYHTVEKM--TNGLAMKW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. TrEMBL
Match: A0A3B4GJW4 (Nuclear prelamin A recognition factor-like OS=Pundamilia nyererei OX=303518 PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 9.107e-125
Identity = 215/497 (43.26%), Postives = 319/497 (64.19%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNH-DDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY----NGIKD---KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK++    K+ +KI I DDGS+  + ++G K  +EK  IT+NDCLACSGC+T+AE++LI + S EE FK ++  K N  +  +VVVS+SPQ++ASL+  +NL +++E  ++L +FF+ L V  V DT+F R FSLLE+  E  E+ Q   ++S   P+L+S CPGW+CYAEK  + + I+P IS T+SPQQ+MG LVK +  A        +I+HV+VMPCFDKKLEA+R++F   N+++    ++VD V+++ E+ ++  E         + E    + MFS     G++F +H GSGSGGYL     + AK L+  ++ +NL+      YKT RN DFQEVSL    E+    LL F+ AYGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  + + QK+LL+KV + YK+    LP  +     +Y    N + D   K  L T Y+ + K+   N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVEKKQGKSVAKIQIEDDGSYVQVNKDGGKQKLEKAKITLNDCLACSGCITSAESVLITQQSHEELFKVLRRNKANETEQKIVVVSVSPQARASLAAHYNL-SSSEAGRRLTSFFKDLGVHHVFDTSFSRTFSLLESQREFVERFQRKEQDSKALPMLTSACPGWICYAEK-THGEYILPFISTTRSPQQMMGSLVKSYF-AERQELSPQQIYHVAVMPCFDKKLEASRSDFYMPNAET----REVDCVITSGEVLKMLEEENVSLN---DLESAAPDTMFS--SFCGDEFLSHAGSGSGGYLHHVFTHAAKHLFGEEV-KNLT------YKTLRNKDFQEVSL----EKDGVVLLCFASAYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQVKPSTGQNQKELLQKVEDLYKAERPLLPEDDARVAELYQSWLNSVGDERAKELLHTQYHTVEKM--TNGLAMKW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. TrEMBL
Match: A0A3Q4GJQ8 (Nuclear prelamin A recognition factor-like OS=Neolamprologus brichardi OX=32507 PE=3 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 3.096e-124
Identity = 215/497 (43.26%), Postives = 317/497 (63.78%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNH-DDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY----NGIKD---KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVKL+    K+ +KI I DDGS+  + ++G K  +EK  IT+NDCLACSGC+T+AE++LI + S EE FK ++  K N  +  +VVVS+SPQ++ASL+  +NL +++E  ++L +F + L V  V DT+F R FSLLE+  E  E+ Q   ++S   P+L+S CPGW+CYAEK  + + I+P IS T+SPQQ+MG LVK +  A        +I+HV+VMPCFDKKLEA+R++F   N+++    ++VD V+++ E+ ++  E         + E    + MFS     G++F +H G GSGGYL     Y AK L+  ++ +NL+      YKT RN DFQEVSL    E+    LL F+ AYGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  + + QK+LL+KV + YK+    LP  +     +Y    N + D   K  L T Y+ + K+   N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKLEKKQGKSVAKIQIEDDGSYVQVNKDGGKQKLEKAKITLNDCLACSGCITSAESVLITQQSHEELFKVLRRNKANETEQKIVVVSVSPQARASLAAHYNL-SSSEAGRRLTSFLKGLGVHHVFDTSFSRTFSLLESQREFVERFQRKEQDSKALPMLTSACPGWICYAEK-THGEYILPFISTTRSPQQMMGSLVKSYF-AQRQELSPQQIYHVAVMPCFDKKLEASRSDFYLPNAET----REVDCVITSGEVLKMLEEENVSLN---DLESAAPDAMFS--SFCGDEFLSHAGGGSGGYLHHVFTYAAKHLFGEEV-KNLT------YKTLRNKDFQEVSL----EKDGVVLLCFASAYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQVKPSNGQNQKELLQKVKDLYKAERPLLPEDDTRVAELYQSWLNSVGDERAKELLHTQYHTVEKM--TNGLAMKW 476          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Cavefish
Match: narfl (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:103027467])

HSP 1 Score: 351.288 bits (900), Expect = 6.953e-116
Identity = 202/499 (40.48%), Postives = 306/499 (61.32%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSD-RKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXX---XXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI---QLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVN-KNAEIVYNGIKD------KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK+D    R  +KI I DDGS+  + ++G +  +EK  IT+NDCLACSGC+T+AE+ILI + S EE ++ +   +         +VVVS+SPQS+ASL+ ++ L +++ET ++L  FF+ L V  V DT F R FSLLE+  E  E+    + + K  P+L+S CPGW+CYAEK  + D I+P IS T+SPQQ+MG LVK F  A     +  KI+HV+VMPC+DKKLEA+R +F     ++    ++VD V+++ E+ ++  E         + E   ++ MFS     G +   H GSGSGGYL     + AK+L+ +++         + YKT +N DFQEV+L    E+    LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  ++   KDLL++V + Y++     P  + + AE+ +  ++       +  L T Y+ + K    N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVDKKQGRSVAKIQIEDDGSYFQVNQDGQRQKLEKAKITLNDCLACSGCITSAESILITQQSHEELYRVLRLNQQSSGGEQKVVVVVSVSPQSRASLAARYGL-SSSETARRLTAFFKNLGVQYVFDTGFSRTFSLLESQREFLERFARKEEDKKALPMLASACPGWICYAEK-THGDFILPYISSTRSPQQMMGSLVKNFF-ARQQGVEPQKIYHVTVMPCYDKKLEASRPDFYLNEFET----REVDCVITSGEVLKMLEEEGVSLN---DVEPAPLDTMFS--SVCGEELLCHAGSGSGGYLHHVYTHAAKQLFGMEVGE-------LTYKTLKNKDFQEVTL----EKDGTVLLRFAATYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQLKPVTELSNKDLLQQVEDLYRAEQPSAPEEDTRVAELYHTWLESVGAESARQLLHTQYHAVEK--STNGLTIKW 478          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Cavefish
Match: narfl (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:103027467])

HSP 1 Score: 351.288 bits (900), Expect = 6.953e-116
Identity = 202/499 (40.48%), Postives = 306/499 (61.32%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSD-RKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXX---XXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI---QLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVN-KNAEIVYNGIKD------KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK+D    R  +KI I DDGS+  + ++G +  +EK  IT+NDCLACSGC+T+AE+ILI + S EE ++ +   +         +VVVS+SPQS+ASL+ ++ L +++ET ++L  FF+ L V  V DT F R FSLLE+  E  E+    + + K  P+L+S CPGW+CYAEK  + D I+P IS T+SPQQ+MG LVK F  A     +  KI+HV+VMPC+DKKLEA+R +F     ++    ++VD V+++ E+ ++  E         + E   ++ MFS     G +   H GSGSGGYL     + AK+L+ +++         + YKT +N DFQEV+L    E+    LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  ++   KDLL++V + Y++     P  + + AE+ +  ++       +  L T Y+ + K    N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVDKKQGRSVAKIQIEDDGSYFQVNQDGQRQKLEKAKITLNDCLACSGCITSAESILITQQSHEELYRVLRLNQQSSGGEQKVVVVVSVSPQSRASLAARYGL-SSSETARRLTAFFKNLGVQYVFDTGFSRTFSLLESQREFLERFARKEEDKKALPMLASACPGWICYAEK-THGDFILPYISSTRSPQQMMGSLVKNFF-ARQQGVEPQKIYHVTVMPCYDKKLEASRPDFYLNEFET----REVDCVITSGEVLKMLEEEGVSLN---DVEPAPLDTMFS--SVCGEELLCHAGSGSGGYLHHVYTHAAKQLFGMEVGE-------LTYKTLKNKDFQEVTL----EKDGTVLLRFAATYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQLKPVTELSNKDLLQQVEDLYRAEQPSAPEEDTRVAELYHTWLESVGAESARQLLHTQYHAVEK--STNGLTIKW 478          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Cavefish
Match: narfl (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:103027467])

HSP 1 Score: 351.288 bits (900), Expect = 6.953e-116
Identity = 202/499 (40.48%), Postives = 306/499 (61.32%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSD-RKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXX---XXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI---QLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVN-KNAEIVYNGIKD------KNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KPVK+D    R  +KI I DDGS+  + ++G +  +EK  IT+NDCLACSGC+T+AE+ILI + S EE ++ +   +         +VVVS+SPQS+ASL+ ++ L +++ET ++L  FF+ L V  V DT F R FSLLE+  E  E+    + + K  P+L+S CPGW+CYAEK  + D I+P IS T+SPQQ+MG LVK F  A     +  KI+HV+VMPC+DKKLEA+R +F     ++    ++VD V+++ E+ ++  E         + E   ++ MFS     G +   H GSGSGGYL     + AK+L+ +++         + YKT +N DFQEV+L    E+    LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  ++   KDLL++V + Y++     P  + + AE+ +  ++       +  L T Y+ + K    N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPVKVDKKQGRSVAKIQIEDDGSYFQVNQDGQRQKLEKAKITLNDCLACSGCITSAESILITQQSHEELYRVLRLNQQSSGGEQKVVVVVSVSPQSRASLAARYGL-SSSETARRLTAFFKNLGVQYVFDTGFSRTFSLLESQREFLERFARKEEDKKALPMLASACPGWICYAEK-THGDFILPYISSTRSPQQMMGSLVKNFF-ARQQGVEPQKIYHVTVMPCYDKKLEASRPDFYLNEFET----REVDCVITSGEVLKMLEEEGVSLN---DVEPAPLDTMFS--SVCGEELLCHAGSGSGGYLHHVYTHAAKQLFGMEVGE-------LTYKTLKNKDFQEVTL----EKDGTVLLRFAATYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQLKPVTELSNKDLLQQVEDLYRAEQPSAPEEDTRVAELYHTWLESVGAESARQLLHTQYHAVEK--STNGLTIKW 478          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Cavefish
Match: narfl (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:103027467])

HSP 1 Score: 307.375 bits (786), Expect = 3.700e-99
Identity = 183/473 (38.69%), Postives = 282/473 (59.62%), Query Frame = 3
Query:  162 RKTSKIIIG-----DDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXX---XXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI---QLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVN-KNAEIVYNGIKD------KNCLMTSYNIIPKLEFLNPSSLKW 1526
            R+ ++ I G     DDGS+  + ++G +  +EK  IT+NDCLACSGC+T+AE+ILI + S EE ++ +   +         +VVVS+SPQS+ASL+ ++ L +++ET ++L  FF+ L V  V DT F R FSLLE+  E  E+    + + K  P+L+S CPGW+CYAEK  + D I+P IS T+SPQQ+MG LVK F  A     +  KI+HV+VMPC+DKKLEA+R +F     ++    ++VD V+++ E+ ++  E         + E   ++ MFS     G +   H GSGSGGYL     + AK+L+ +++         + YKT +N DFQEV+L    E+    LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  ++   KDLL++V + Y++     P  + + AE+ +  ++       +  L T Y+ + K    N  ++KW
Sbjct:    8 RQEARKICGQNPNRDDGSYFQVNQDGQRQKLEKAKITLNDCLACSGCITSAESILITQQSHEELYRVLRLNQQSSGGEQKVVVVVSVSPQSRASLAARYGL-SSSETARRLTAFFKNLGVQYVFDTGFSRTFSLLESQREFLERFARKEEDKKALPMLASACPGWICYAEK-THGDFILPYISSTRSPQQMMGSLVKNFF-ARQQGVEPQKIYHVTVMPCYDKKLEASRPDFYLNEFET----REVDCVITSGEVLKMLEEEGVSLN---DVEPAPLDTMFS--SVCGEELLCHAGSGSGGYLHHVYTHAAKQLFGMEVGE-------LTYKTLKNKDFQEVTL----EKDGTVLLRFAATYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQLKPVTELSNKDLLQQVEDLYRAEQPSAPEEDTRVAELYHTWLESVGAESARQLLHTQYHAVEK--STNGLTIKW 455          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Cavefish
Match: narfl (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:103027467])

HSP 1 Score: 298.901 bits (764), Expect = 4.994e-96
Identity = 174/448 (38.84%), Postives = 267/448 (59.60%), Query Frame = 3
Query:  219 NGDKYSMEKVNITINDCLACSGCVTTAETILINE--HSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKI---QLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVN-KNAEIVYNGIKD------KNCLMTSYNIIPKLEFLNPSSLKW 1526
            +G +  +EK  IT+NDCLACSGC+T+AE+ILI +  H       ++  +  +    +VVVS+SPQS+ASL+ ++ L +++ET ++L  FF+ L V  V DT F R FSLLE+  E  E+    + + K  P+L+S CPGW+CYAEK  + D I+P IS T+SPQQ+MG LVK F  A     +  KI+HV+VMPC+DKKLEA+R +F     ++    ++VD V+++ E+ ++  E         + E   ++ MFS     G +   H GSGSGGYL     + AK+L+ +++         + YKT +N DFQEV+L    E+    LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQ++  ++   KDLL++V + Y++     P  + + AE+ +  ++       +  L T Y+ + K    N  ++KW
Sbjct:   21 DGQRQKLEKAKITLNDCLACSGCITSAESILITQQSHEELYRVLRLNQVLLSGQKVVVVVSVSPQSRASLAARYGL-SSSETARRLTAFFKNLGVQYVFDTGFSRTFSLLESQREFLERFARKEEDKKALPMLASACPGWICYAEK-THGDFILPYISSTRSPQQMMGSLVKNFF-ARQQGVEPQKIYHVTVMPCYDKKLEASRPDFYLNEFET----REVDCVITSGEVLKMLEEEGVSLN---DVEPAPLDTMFS--SVCGEELLCHAGSGSGGYLHHVYTHAAKQLFGMEVGE-------LTYKTLKNKDFQEVTL----EKDGTVLLRFAATYGFRNIQNLVQKLKRGKSPYHFVEVMACPSGCLNGGGQLKPVTELSNKDLLQQVEDLYRAEQPSAPEEDTRVAELYHTWLESVGAESARQLLHTQYHAVEK--STNGLTIKW 443          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Yeast
Match: NAR1 (Subunit of the cytosolic iron-sulfur (FeS) protein assembly machinery; required for maturation of cytosolic and nuclear FeS proteins and for normal resistance to oxidative stress; deficiency results in shortened lifespan and sensitivity to paraquat; homologous to human Narf [Source:SGD;Acc:S000005184])

HSP 1 Score: 158.688 bits (400), Expect = 2.616e-43
Identity = 134/470 (28.51%), Postives = 214/470 (45.53%), Query Frame = 3
Query:   93 TELDDFITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRE-NGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANET----KEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYN-IDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRI-------------QLKK----------------------CNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTN 1379
            ++L+DFI+PA  C+KP ++    +        D+ +  G  E + +   +EKV+IT++DCLACSGC+T++E IL++  S   F K    + +  D  LVV S+SPQ + SL+  + L   A     +  F +      ++ T  GR  S+ +T  +     K+K        P+LS+ CPG++ Y EK K    +VP++   KSPQQI G L++    +     ++   +H+S+MPCFDKKLEA+R E           +  +D V++  EI  +  E   DF++   TED  +    S     G     H  S  GG        C    Y  +   + L   S++     RNSD  E  L+ +       +   S   GFRN+Q +V+++              L+K                       +  +IE+ ACP  C+NGGG +  E    ++  L +  N
Sbjct:    8 SDLNDFISPALACVKPTQVSGGKK--------DNVNMNGEYEVSTEPDQLEKVSITLSDCLACSGCITSSEEILLSSQSHSVFLKNWGKLSQQQDKFLVV-SVSPQCRLSLAQYYGLTLEAADLCLMNFFQKHFQCKYMVGTEMGRIISISKTVEKIIAHKKQKENTGADRKPLLSAVCPGFLIYTEKTKPQ--LVPMLLNVKSPQQITGSLIRATFESLAIARES--FYHLSLMPCFDKKLEASRPE---------SLDDGIDCVITPREIVTMLQELNLDFKSFL-TEDTSLYGRLS---PPGWDPRVHWASNLGGT-------CGGYAYQYVTAVQRLHPGSQMIVLEGRNSDIVEYRLLHDDRI----IAAASELSGFRNIQNLVRKLTSGSGSERKRNITALRKRRTGPKANSREMAAATAATADPYHSDYIEVNACPGACMNGGGLLNGEQNSLKRKQLVQTLN 440          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Nematostella
Match: EDO38275 (Probable cytosolic Fe-S cluster assembly factor v1g210509 [Source:UniProtKB/Swiss-Prot;Acc:A7SDA8])

HSP 1 Score: 300.056 bits (767), Expect = 7.196e-97
Identity = 178/423 (42.08%), Postives = 264/423 (62.41%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDN--SDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSS------XXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKN----SPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKG 1304
            FS  +++T LDDFITP+QECIKPVK++     +  +KI I  DGS+  + E+G K  ++K  IT+NDCLACSGC+TTAE++LI + S        +  +K+    +     LVV+SISPQS+AS++ KFNL    +  KKL  FF+ L V  V DTTF R+FSL E+  E   + +   +     +P+L+S CPGW+CYAEK  + D I+P IS TKSPQQIMG LVK  L +   +     ++HV VMPCFDKKLEA+R++F + +  S    +DVD V+ST+E+E +  +   DF +    +  E++ ++  +D+       H G GSGG+LE   +Y +++L++  ++        + YKT RN DF+EV+L  + ++    +L F+ AYGFRN+Q +VQ+++  K  Y F+E+MACP G
Sbjct:    5 FSGALQLTNLDDFITPSQECIKPVKIEKKPGAKGLAKIKIESDGSYVQLSEDGGKSKLQKAEITLNDCLACSGCITTAESVLITQQSQDELFKILDSNRKLVKEGKGDVQKLVVISISPQSRASIAAKFNL-TINDAAKKLSAFFKQLGVHYVFDTTFARDFSLAESQREFVRRFRAYQQGDEGCTPMLASACPGWMCYAEK-THGDYILPYISSTKSPQQIMGSLVKDHLASVVGK-SPDSVYHVCVMPCFDKKLEASRDDF-YNDMYS---TRDVDCVISTVEVETMIQDHCPDFNS---IDPVELDKLYCSSDSGDFF--GHSGGGSGGFLEHIFKYASRELFDEKVD-------VLTYKTLRNKDFREVTLQVDGKD----VLKFAAAYGFRNIQNLVQKLKRGKSPYHFVEVMACPSG 404          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Medaka
Match: narfl (cytosolic iron-sulfur assembly component 3 [Source:NCBI gene;Acc:101162368])

HSP 1 Score: 373.629 bits (958), Expect = 1.256e-124
Identity = 204/496 (41.13%), Postives = 309/496 (62.30%), Query Frame = 3
Query:   72 FSTGIRITELDDFITPAQECIKPVKLDNSDRKT-SKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY----NGI---KDKNCLMTSYNIIPKLEFLNPSSLKW 1526
            FS  +++T+LDDFITP+QEC+KP+K++    K+ ++I I DDGS+  + ++G K  +EK  I++NDCLACSGC+T+AE++LI + S EE  K ++  K   +   VVVS+SPQS+ASL+  F + +++E  ++L +F + L V  V DT+F R FSLLE+  E  E+ Q   +++   P+L+S CPGW+CYAEK  + + I+P IS T+SPQQ+MG LVK    A        +I+HV+VMPCFDKKLEA+R++F    +++    ++VD V+++ E++++  E         + E   +++MFS     G++  +H GSGSGGYL     Y AK+L+         E   + YKT RN DFQEV L    E+  E LL F+  YGFRN+Q +VQ+++  K  Y F+E+MACP GCLNGGGQI+  + + QK+LL+KV   YK     LP  +     +Y    +G+   + +  L T Y+ + K+   N  ++KW
Sbjct:    5 FSGVLQLTDLDDFITPSQECVKPIKVEKKQGKSVARIQIEDDGSYVQVNQDGGKEKLEKAKISLNDCLACSGCITSAESVLITQQSPEELLKVLRNNKGAAEQKTVVVSVSPQSRASLAAHFGI-SSSEAGRRLTSFLKNLGVHYVFDTSFSRTFSLLESQREFVERFQRKGQDNKALPMLTSACPGWICYAEK-THGEYILPYISTTRSPQQMMGSLVKSHF-AEKQGLSPQQIYHVAVMPCFDKKLEASRSDFFMNKAET----REVDCVITSGEVQKMLEEHHISLN---DVEPGTLDSMFS--SVCGDELLSHAGSGSGGYLHHVFTYAAKQLFG-------EEVKELTYKTLRNKDFQEVRL----EKDGEVLLCFAATYGFRNIQNLVQKLKRGKSLYHFVEVMACPSGCLNGGGQIKAAAGQNQKELLQKVEELYKEERPLLPEDDTRVAEIYQTWLHGVGEDRARELLRTQYHAVEKM--TNGLTIKW 475          
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Medaka
Match: narf (nuclear prelamin A recognition factor [Source:NCBI gene;Acc:101170486])

HSP 1 Score: 238.424 bits (607), Expect = 1.288e-72
Identity = 142/426 (33.33%), Postives = 232/426 (54.46%), Query Frame = 3
Query:  216 ENGDKYSMEKVNITINDCLACSGCVTTAETILINEHS--SXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNS---PVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVY-NGIKDKNCLMTS 1475
            E  ++ S     + ++ CL+C GCV+  E++ I++ S    E    +    +     ++V S+ PQS    + KF + +  E  +KL  F +++ V  V DTT    FS+LET  E  ++ +    +    P+ +S CPGW+ YAE+   + L+ P I   +SPQQIMG LVK F      +    K+FHV + PCFDKKLEA R EF  +  ++    +DVD VL++ EI ++  +R+       +   +++     L +        H+G GS G+LE   ++ AK+L+ +D+         V YKT RN DFQEV+L    E   E LL F+  YGFRN+QT+V R++  +  YQ +E+++CP GCL+G GQ   E+    + L++++   Y SL ++LP +N   +++Y + ++ ++ L TS
Sbjct:   37 EVNEQQSEAPAPLLLSACLSCEGCVSEQESLKISQQSLEEVEQVLALNKRCDASKHRVLVASVCPQSLPFFAVKFGV-DVPEAGQKLCGFLKSIGVQFVFDTTLAAGFSILETQKEFIQRYRRRHHDPHALPLFTSSCPGWIRYAERVLGS-LVTPHICTARSPQQIMGCLVKDFF-CQQQKLSPEKVFHVVLAPCFDKKLEAVREEFYSSLMET----RDVDCVLTSKEIYRLMEQRKVSVEELDSVPLDQV-----LGEAADAALTRHDGRGSEGFLEHVFKHAAKELFGLDVQE-------VTYKTLRNRDFQEVTL----ERDGETLLQFAAVYGFRNIQTLVHRMRKGRVPYQLVEVLSCPGGCLSGRGQ-SEEAGRVDRALVQQMEEVYSSLPVRLPELNPALKVLYQDWLQGQDSLQTS 438          
BLAST of Nuclear prelamin A recognition factor-like vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 483/486 (99.38%), Postives = 484/486 (99.59%), Query Frame = 3
Query:   66 MSFSTGIRITELDDFITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSXXXXXXXXXXXXNHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAEIVYNGIKDKNCLMTSYNIIPKLEFLNPSSLK 1523
            MSFSTGIRITELDDFITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSEEFFKKIKLIKEN+DDTLVVVSISPQSKASLSTKFNLGNA ETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAE VYNGIKDKNCLMTSYNIIPKLEFLNPSSLK
Sbjct:    1 MSFSTGIRITELDDFITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIRENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSEEFFKKIKLIKENYDDTLVVVSISPQSKASLSTKFNLGNAVETHKKLKTFFQTLSVDVVLDTTFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIVPLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATRNEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIENMFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRVKYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKCNYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLVNKNAETVYNGIKDKNCLMTSYNIIPKLEFLNPSSLK 486          
The following BLAST results are available for this feature:
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CIAO31.230e-11740.78cytosolic iron-sulfur assembly component 3 [Source... [more]
CIAO37.305e-8640.58cytosolic iron-sulfur assembly component 3 [Source... [more]
CIAO37.305e-8640.58cytosolic iron-sulfur assembly component 3 [Source... [more]
NARF2.578e-6831.62nuclear prelamin A recognition factor [Source:HGNC... [more]
NARF7.962e-6334.48nuclear prelamin A recognition factor [Source:HGNC... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxy-43.513e-6933.19Probable cytosolic Fe-S cluster assembly factor ox... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG176835.693e-9537.32gene:FBgn0262115 transcript:FBtr0111298[more]
CG176837.479e-9136.70gene:FBgn0262115 transcript:FBtr0111299[more]
CG176831.818e-8036.36gene:FBgn0262115 transcript:FBtr0111300[more]
CG176831.708e-6138.61gene:FBgn0262115 transcript:FBtr0111301[more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
narfl2.740e-11839.16nuclear prelamin A recognition factor-like [Source... [more]
narf4.968e-7033.25nuclear prelamin A recognition factor [Source:NCBI... [more]
narf4.968e-7033.25nuclear prelamin A recognition factor [Source:NCBI... [more]
narfl1.242e-950.00nuclear prelamin A recognition factor-like [Source... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ciao33.778e-10039.53cytosolic iron-sulfur assembly component 3 [Source... [more]
tapbp1.304e-7634.74TAP binding protein (tapasin) [Source:Xenbase;Acc:... [more]
tapbp4.238e-7635.38TAP binding protein (tapasin) [Source:Xenbase;Acc:... [more]
tapbp1.291e-7536.03TAP binding protein (tapasin) [Source:Xenbase;Acc:... [more]
tapbp2.032e-7333.99TAP binding protein (tapasin) [Source:Xenbase;Acc:... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ciao37.355e-10739.72cytosolic iron-sulfur assembly component 3 [Source... [more]
Ciao32.870e-10538.21cytosolic iron-sulfur assembly component 3 [Source... [more]
Ciao31.160e-7939.64cytosolic iron-sulfur assembly component 3 [Source... [more]
Narf3.127e-7332.71nuclear prelamin A recognition factor [Source:MGI ... [more]
Ciao39.595e-746.00cytosolic iron-sulfur assembly component 3 [Source... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H6Q4|CIAO3_HUMAN5.906e-11740.78Cytosolic iron-sulfur assembly component 3 OS=Homo... [more]
sp|Q5RF36|CIAO3_PONAB4.085e-11640.78Cytosolic iron-sulfur assembly component 3 OS=Pong... [more]
sp|Q5BK18|CIAO3_RAT2.538e-11238.96Cytosolic iron-sulfur assembly component 3 OS=Ratt... [more]
sp|Q16ML2|NARF_AEDAE9.850e-11241.12Probable cytosolic Fe-S cluster assembly factor AA... [more]
sp|A4FV58|CIAO3_BOVIN7.431e-11139.56Cytosolic iron-sulfur assembly component 3 OS=Bos ... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I3KKP81.078e-12543.66Nuclear prelamin A recognition factor-like OS=Oreo... [more]
A0A3P8RKR14.086e-12543.26Nuclear prelamin A recognition factor-like OS=Asta... [more]
A0A3P9B1394.086e-12543.26Nuclear prelamin A recognition factor-like OS=Mayl... [more]
A0A3B4GJW49.107e-12543.26Nuclear prelamin A recognition factor-like OS=Pund... [more]
A0A3Q4GJQ83.096e-12443.26Nuclear prelamin A recognition factor-like OS=Neol... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
narfl6.953e-11640.48cytosolic iron-sulfur assembly component 3 [Source... [more]
narfl6.953e-11640.48cytosolic iron-sulfur assembly component 3 [Source... [more]
narfl6.953e-11640.48cytosolic iron-sulfur assembly component 3 [Source... [more]
narfl3.700e-9938.69cytosolic iron-sulfur assembly component 3 [Source... [more]
narfl4.994e-9638.84cytosolic iron-sulfur assembly component 3 [Source... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAR12.616e-4328.51Subunit of the cytosolic iron-sulfur (FeS) protein... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO382757.196e-9742.08Probable cytosolic Fe-S cluster assembly factor v1... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
narfl1.256e-12441.13cytosolic iron-sulfur assembly component 3 [Source... [more]
narf1.288e-7233.33nuclear prelamin A recognition factor [Source:NCBI... [more]
back to top
BLAST of Nuclear prelamin A recognition factor-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028508.10.000e+099.38SMESG000028508.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018973 ID=SMED30018973|Name=Nuclear prelamin A recognition factor-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1543bp
TGAAGATGTGACATTTTAATATTGTTTAAATACTATGTATCGTATTTTAT
AAAATTTTAAATATAATGAGTTTTAGTACTGGAATAAGAATCACAGAATT
AGATGACTTTATTACACCAGCTCAAGAATGTATTAAGCCTGTTAAATTGG
ATAATTCAGATAGAAAAACTTCTAAAATAATTATTGGAGACGATGGTTCA
TTTACCGGAATTAGAGAAAATGGTGATAAATACAGCATGGAAAAAGTTAA
CATTACAATAAATGACTGTTTAGCTTGTAGTGGCTGTGTTACTACAGCTG
AAACCATATTAATAAATGAACATTCTAGCGAAGAGTTTTTTAAGAAAATA
AAACTCATCAAAGAAAATCACGATGACACACTAGTAGTGGTTTCAATATC
ACCACAATCGAAAGCCAGCTTATCAACTAAATTCAATTTAGGAAATGCTG
CTGAAACGCATAAAAAATTGAAAACGTTTTTTCAAACACTTTCCGTCGAT
GTCGTTTTAGATACAACTTTCGGACGAGAATTTAGTTTATTAGAAACAGC
AAATGAGACCAAAGAGAAAATTCAGTTAAACATAAAAAATTCTCCTGTCC
TTTCCAGCTGTTGTCCTGGCTGGGTTTGTTATGCAGAAAAGCATAAAAAT
AACGATCTCATTGTACCTCTCATAAGCCGAACAAAATCTCCACAGCAAAT
CATGGGATATTTAGTGAAACAGTTTCTCCCAGCAAATAACAACCGCTACC
AAGCAACCAAAATATTTCACGTTTCCGTTATGCCGTGCTTCGATAAAAAA
CTGGAAGCGACTCGAAACGAGTTTGCATTCACGAACAGTAAATCCGGAGA
AAGAGAAAAAGATGTAGATCTCGTTCTATCGACAATGGAGATCGAACAGA
TCGCTACCGAGCGGCAATATGATTTCCGCACCGAGTGCAACACAGAGGAT
AATGAGATTGAGAATATGTTTTCTTTGAATGATAACAACGGAAATAAGTT
CTATACTCACGAAGGATCTGGATCCGGAGGATATTTAGAATTCACTTTAA
GATATTGCGCAAAAAAATTATACAACATCGATTTAAACAGAAATCTCTCA
GAGGATTCCCGAGTTAAATATAAAACATTTAGAAACTCAGATTTCCAAGA
AGTCTCATTGATTTCCGAATCAGAAGAACATGTTGAACCTCTGTTGACAT
TTTCATTTGCCTATGGGTTTCGTAATCTCCAGACTATTGTTCAAAGGATT
CAACTCAAGAAATGCAACTATCAATTTATTGAGATTATGGCTTGTCCAAA
GGGATGTTTGAATGGAGGAGGACAAATAAGAACCGAATCTAAGGAAGAAC
AGAAAGATTTATTGGAGAAGGTTACAAATGCCTACAAGTCACTGGACATA
CAGCTACCTCTCGTTAATAAAAATGCAGAAATCGTTTATAACGGAATAAA
GGACAAGAATTGTTTAATGACCTCTTATAACATCATACCAAAACTTGAAT
TTTTAAACCCCTCATCTCTTAAATGGTAGAATAAATAGATCGG
back to top

protein sequence of SMED30018973-orf-1

>SMED30018973-orf-1 ID=SMED30018973-orf-1|Name=SMED30018973-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MSFSTGIRITELDDFITPAQECIKPVKLDNSDRKTSKIIIGDDGSFTGIR
ENGDKYSMEKVNITINDCLACSGCVTTAETILINEHSSEEFFKKIKLIKE
NHDDTLVVVSISPQSKASLSTKFNLGNAAETHKKLKTFFQTLSVDVVLDT
TFGREFSLLETANETKEKIQLNIKNSPVLSSCCPGWVCYAEKHKNNDLIV
PLISRTKSPQQIMGYLVKQFLPANNNRYQATKIFHVSVMPCFDKKLEATR
NEFAFTNSKSGEREKDVDLVLSTMEIEQIATERQYDFRTECNTEDNEIEN
MFSLNDNNGNKFYTHEGSGSGGYLEFTLRYCAKKLYNIDLNRNLSEDSRV
KYKTFRNSDFQEVSLISESEEHVEPLLTFSFAYGFRNLQTIVQRIQLKKC
NYQFIEIMACPKGCLNGGGQIRTESKEEQKDLLEKVTNAYKSLDIQLPLV
NKNAEIVYNGIKDKNCLMTSYNIIPKLEFLNPSSLKW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0097361CIA complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004108Fe_hydrogenase_lsu_C
IPR009016Fe_hydrogenase
Vocabulary: biological process
TermDefinition
GO:0016226iron-sulfur cluster assembly
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 426..446
NoneNo IPR availableGENE3DG3DSA:3.40.50.1780coord: 106..444
e-value: 6.0E-84
score: 284.6
NoneNo IPR availableGENE3DG3DSA:3.40.950.20coord: 151..461
e-value: 6.0E-84
score: 284.6
NoneNo IPR availablePANTHERPTHR11615NITRATE, FROMATE, IRON DEHYDROGENASEcoord: 8..450
NoneNo IPR availablePANTHERPTHR11615:SF258CYTOSOLIC FE-S CLUSTER ASSEMBLY FACTOR NARFLcoord: 8..450
IPR004108Iron hydrogenase, large subunit, C-terminalPFAMPF02906Fe_hyd_lg_Ccoord: 107..418
e-value: 7.3E-66
score: 222.3
IPR009016Iron hydrogenaseSUPERFAMILYSSF53920Fe-only hydrogenasecoord: 67..464