ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30018972
Length (bp)4561
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30018972) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30018972) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30018972) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30018972) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018972

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018972SMESG000022931.1 SmedASXL_016768SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30018972SMESG000022931.1 Contig13646newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018972SMESG000022931.1 Contig13646uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018972SMESG000074552.1 SMESG000072701.1 SMESG000070601.1 SMESG000054104.1 SMESG000046807.1 SMESG000045951.1 SMESG000037636.1 SMESG000031066.1 SMESG000022931.1 SMESG000014571.1 SMESG000005372.1 Contig30920newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018972SMESG000074552.1 SMESG000072701.1 SMESG000070601.1 SMESG000054104.1 SMESG000046807.1 SMESG000045951.1 SMESG000037636.1 SMESG000031066.1 SMESG000022931.1 SMESG000014571.1 SMESG000005372.1 Contig30920uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018972SMESG000022931.1 Contig47661newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018972SMESG000022931.1 Contig47661uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30018972SMESG000022931.1 dd_Smed_v6_11187_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018972SMESG000022931.1 dd_Smed_v6_11187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30018972SMESG000022931.1 Contig13646newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018972SMESG000022931.1 Contig13646uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018972SMESG000074552.1 SMESG000072701.1 SMESG000070601.1 SMESG000054104.1 SMESG000046807.1 SMESG000045951.1 SMESG000037636.1 SMESG000031066.1 SMESG000022931.1 SMESG000014571.1 SMESG000005372.1 Contig30920newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018972SMESG000074552.1 SMESG000072701.1 SMESG000070601.1 SMESG000054104.1 SMESG000046807.1 SMESG000045951.1 SMESG000037636.1 SMESG000031066.1 SMESG000022931.1 SMESG000014571.1 SMESG000005372.1 Contig30920uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018972SMESG000022931.1 Contig47661newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018972SMESG000022931.1 Contig47661uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30018972SMESG000022931.1 dd_Smed_v4_11187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: RAI14 (retinoic acid induced 14 [Source:HGNC Symbol;Acc:HGNC:14873])

HSP 1 Score: 102.064 bits (253), Expect = 5.100e-21
Identity = 67/236 (28.39%), Postives = 114/236 (48.31%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTL 882
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E ++ +I++  +  +   D    + L  A +    E ++ + +        D  G + +H A        +Q L E +   N  + D N PL +A +    E    L+++  DV+++NK G+T L+LA E G+ NA++ L+   AD ++ D+ G+ ALHY+   +    + LL         +  P +P  L
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLRVMITHGVD--VTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKPKQL 256          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: RAI14 (retinoic acid induced 14 [Source:HGNC Symbol;Acc:HGNC:14873])

HSP 1 Score: 101.679 bits (252), Expect = 7.059e-21
Identity = 66/233 (28.33%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E ++ +I++  +  +   D    + L  A +    E ++ + +        D  G + +H A        +Q L E +   N  + D N PL +A +    E    L+++  DV+++NK G+T L+LA E G+ NA++ L+   AD ++ D+ G+ ALHY+   +    + LL         +  P +P
Sbjct:   15 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLRVMITHGVD--VTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKP 245          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: RAI14 (retinoic acid induced 14 [Source:HGNC Symbol;Acc:HGNC:14873])

HSP 1 Score: 101.679 bits (252), Expect = 7.168e-21
Identity = 66/233 (28.33%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E ++ +I++  +  +   D    + L  A +    E ++ + +        D  G + +H A        +Q L E +   N  + D N PL +A +    E    L+++  DV+++NK G+T L+LA E G+ NA++ L+   AD ++ D+ G+ ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLRVMITHGVD--VTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: RAI14 (retinoic acid induced 14 [Source:HGNC Symbol;Acc:HGNC:14873])

HSP 1 Score: 101.679 bits (252), Expect = 7.168e-21
Identity = 66/233 (28.33%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E ++ +I++  +  +   D    + L  A +    E ++ + +        D  G + +H A        +Q L E +   N  + D N PL +A +    E    L+++  DV+++NK G+T L+LA E G+ NA++ L+   AD ++ D+ G+ ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLRVMITHGVD--VTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: RAI14 (retinoic acid induced 14 [Source:HGNC Symbol;Acc:HGNC:14873])

HSP 1 Score: 101.679 bits (252), Expect = 7.168e-21
Identity = 66/233 (28.33%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E ++ +I++  +  +   D    + L  A +    E ++ + +        D  G + +H A        +Q L E +   N  + D N PL +A +    E    L+++  DV+++NK G+T L+LA E G+ NA++ L+   AD ++ D+ G+ ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLRVMITHGVD--VTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 83.9593 bits (206), Expect = 9.714e-16
Identity = 68/248 (27.42%), Postives = 107/248 (43.15%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNE-------------------------LLEK------PDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTP-LHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            FL+A    DL KV +L++     NT +    ++ HLAS  GH E+++ELI   +                           L+E         VN  T L+ A ++   E V+Y+ + GA   +  + G + +  A++  H  ++  LLE     ND    V  P LH+A + D      LL+    + D  +K G TPL +A+  G+EN  Q+LL   A+ + +       LH A+   R     LL
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLL 279          

HSP 2 Score: 80.1073 bits (196), Expect = 1.529e-14
Identity = 56/219 (25.57%), Postives = 106/219 (48.40%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            L+P   A     +   K L+ +S   N+      +  H+A     ++++ EL+  Y    +E    +  T L  A   G +  V Y+ ++GA  +V+  +G++ +H A R   + +++ L+      +    ++ TPLH+A  L   + + LL+    + +A  +   +PL +A++ G E    ILL +NAD+ +   +GF  LH AS +  +E  +LL
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 3 Score: 78.5666 bits (192), Expect = 4.794e-14
Identity = 49/195 (25.13%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            N   ++  S  H+A+  G  E+   L+ + +++ L    + KK  T L  A + G LE V+ + E+G   +++     + +H A  + +  +   LLE   +      +  TPLH+A + + ME    L+ +  D +A+++ G TPL L+++ G++    +L+ N +D   K N G  A+H  +    +   ++L
Sbjct:  518 NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL----LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 72.7886 bits (177), Expect = 2.551e-12
Identity = 56/219 (25.57%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N +  V+ L+K   +     +   +  H+A+  G + I+  L+   +N  +E   V  +T L  A      + V+ +   GAK + +  +  + +H A R  ++ I+  LL+   N N    D  +PLH+A +    E   +L++++ D     K G TPL LAS+ GN   +++LL      DI+       LH A+ +   +   LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 5 Score: 66.2402 bits (160), Expect = 2.484e-10
Identity = 58/230 (25.22%), Postives = 98/230 (42.61%), Query Frame = 1
Query:  157 SVNEKQLSPFLKAVWRNDLSKVKKLIKKSYN----TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK---TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +  E  L+P   A +   ++ V  L+++  N    TV  E  +  HLA+ A   ++++ LI N +     K D   +   T L  A   G  + V  + + GA +N       S +H A +     +   LL+   +         TPLH+A +   +E ++LL+     VD + K   TPL +A+   N+    +LL N A        G+  LH A+   ++E    L
Sbjct:  420 ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGA-----KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 6 Score: 65.0846 bits (157), Expect = 5.753e-10
Identity = 48/197 (24.37%), Postives = 87/197 (44.16%), Query Frame = 1
Query:  172 QLSPF-LKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
            Q++P  + A + ND  KV  L+ ++  +     ++ +   H+A+    +EI   L+     +    P+   + G   L  + ++G  E    + E G+    K + G + +H   +  H  + Q L       N   N   TPLHVAC    +  ++ L+    DV  + +   TPL  A++ G+ N ++ LL N A
Sbjct:  590 QVTPLHVAAHYNND--KVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 7 Score: 64.3142 bits (155), Expect = 9.849e-10
Identity = 53/219 (24.20%), Postives = 89/219 (40.64%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A   N    VK L+K   N     ++  +   +A   GH  ++  L+ N S   +  P       L  A +K        + +     +V    G + +H A  + H ++ Q LLEK  N N       +PLHVA +        LL++    +D++ K   TPL  A+ SG++  + +L+   A    K   G   LH A+    ++  + L
Sbjct:  133 FTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 8 Score: 59.6918 bits (143), Expect = 2.628e-8
Identity = 53/188 (28.19%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  274 AFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENV-QYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A H+A+          L+ N  N     PDV  K+G   L  A   G  ENV Q + EKGA  N +     S +H A +   +++   LL +    +    D+ TPLH A      + + LL+     + A+ K G  PL +A++  + +A + LL + A  D    +    LH A+    +   KLL
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHN-----PDVTSKSGFTPLHIAAHYG-HENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 58.9214 bits (141), Expect = 4.242e-8
Identity = 49/191 (25.65%), Postives = 84/191 (43.98%), Query Frame = 1
Query:  229 LIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            L++K  N   Q +   S  H+A+  G   +   L+S  +  +++    +  T L  A   G  + V  +  +GA  + K   G + +H A +  H    + LL      +D   D  TPLHVA     +   +LL++ S D +++   G TPL +A +      +++LL   A  +     G   LH A+F
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA--IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 10 Score: 57.3806 bits (137), Expect = 1.114e-7
Identity = 55/226 (24.34%), Postives = 97/226 (42.92%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            P L    + D +    L+ ++ +  D   +S F   H+A+  GH         N    LLEK  +VN +     + L  A + G       +  +GA  + +     + +H A R  H  ++  L+ +    +    +   PLH+A + D ++  + L+ +   VD       TPL +A+  G+    ++LL  +AD + +   GF  LH A    RI+  +LL K
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          

HSP 11 Score: 55.0694 bits (131), Expect = 5.404e-7
Identity = 45/190 (23.68%), Postives = 80/190 (42.11%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQIL 726
            +P   A  +N +     L+  K   N   +   +  HL++  GH EI   LI N S       DV  K     T +    ++  +   Q ++  GA+ N K + G + +H A      ++++FL+E   +  +      TPLH A +      ++ L+      + Q   G+TPL +A   G  + ++ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-------DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 83.9593 bits (206), Expect = 9.714e-16
Identity = 68/248 (27.42%), Postives = 107/248 (43.15%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNE-------------------------LLEK------PDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTP-LHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            FL+A    DL KV +L++     NT +    ++ HLAS  GH E+++ELI   +                           L+E         VN  T L+ A ++   E V+Y+ + GA   +  + G + +  A++  H  ++  LLE     ND    V  P LH+A + D      LL+    + D  +K G TPL +A+  G+EN  Q+LL   A+ + +       LH A+   R     LL
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLL 279          

HSP 2 Score: 80.1073 bits (196), Expect = 1.529e-14
Identity = 56/219 (25.57%), Postives = 106/219 (48.40%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            L+P   A     +   K L+ +S   N+      +  H+A     ++++ EL+  Y    +E    +  T L  A   G +  V Y+ ++GA  +V+  +G++ +H A R   + +++ L+      +    ++ TPLH+A  L   + + LL+    + +A  +   +PL +A++ G E    ILL +NAD+ +   +GF  LH AS +  +E  +LL
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 3 Score: 78.5666 bits (192), Expect = 4.794e-14
Identity = 49/195 (25.13%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            N   ++  S  H+A+  G  E+   L+ + +++ L    + KK  T L  A + G LE V+ + E+G   +++     + +H A  + +  +   LLE   +      +  TPLH+A + + ME    L+ +  D +A+++ G TPL L+++ G++    +L+ N +D   K N G  A+H  +    +   ++L
Sbjct:  518 NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL----LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 72.7886 bits (177), Expect = 2.551e-12
Identity = 56/219 (25.57%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N +  V+ L+K   +     +   +  H+A+  G + I+  L+   +N  +E   V  +T L  A      + V+ +   GAK + +  +  + +H A R  ++ I+  LL+   N N    D  +PLH+A +    E   +L++++ D     K G TPL LAS+ GN   +++LL      DI+       LH A+ +   +   LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 5 Score: 66.2402 bits (160), Expect = 2.484e-10
Identity = 58/230 (25.22%), Postives = 98/230 (42.61%), Query Frame = 1
Query:  157 SVNEKQLSPFLKAVWRNDLSKVKKLIKKSYN----TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK---TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +  E  L+P   A +   ++ V  L+++  N    TV  E  +  HLA+ A   ++++ LI N +     K D   +   T L  A   G  + V  + + GA +N       S +H A +     +   LL+   +         TPLH+A +   +E ++LL+     VD + K   TPL +A+   N+    +LL N A        G+  LH A+   ++E    L
Sbjct:  420 ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGA-----KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTL 642          

HSP 6 Score: 65.0846 bits (157), Expect = 5.753e-10
Identity = 48/197 (24.37%), Postives = 87/197 (44.16%), Query Frame = 1
Query:  172 QLSPF-LKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
            Q++P  + A + ND  KV  L+ ++  +     ++ +   H+A+    +EI   L+     +    P+   + G   L  + ++G  E    + E G+    K + G + +H   +  H  + Q L       N   N   TPLHVAC    +  ++ L+    DV  + +   TPL  A++ G+ N ++ LL N A
Sbjct:  590 QVTPLHVAAHYNND--KVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 7 Score: 64.3142 bits (155), Expect = 9.849e-10
Identity = 53/219 (24.20%), Postives = 89/219 (40.64%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A   N    VK L+K   N     ++  +   +A   GH  ++  L+ N S   +  P       L  A +K        + +     +V    G + +H A  + H ++ Q LLEK  N N       +PLHVA +        LL++    +D++ K   TPL  A+ SG++  + +L+   A    K   G   LH A+    ++  + L
Sbjct:  133 FTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 8 Score: 59.6918 bits (143), Expect = 2.628e-8
Identity = 53/188 (28.19%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  274 AFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENV-QYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A H+A+          L+ N  N     PDV  K+G   L  A   G  ENV Q + EKGA  N +     S +H A +   +++   LL +    +    D+ TPLH A      + + LL+     + A+ K G  PL +A++  + +A + LL + A  D    +    LH A+    +   KLL
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHN-----PDVTSKSGFTPLHIAAHYG-HENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL 378          

HSP 9 Score: 58.9214 bits (141), Expect = 4.242e-8
Identity = 49/191 (25.65%), Postives = 84/191 (43.98%), Query Frame = 1
Query:  229 LIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            L++K  N   Q +   S  H+A+  G   +   L+S  +  +++    +  T L  A   G  + V  +  +GA  + K   G + +H A +  H    + LL      +D   D  TPLHVA     +   +LL++ S D +++   G TPL +A +      +++LL   A  +     G   LH A+F
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA--IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF 434          

HSP 10 Score: 57.3806 bits (137), Expect = 1.114e-7
Identity = 55/226 (24.34%), Postives = 97/226 (42.92%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            P L    + D +    L+ ++ +  D   +S F   H+A+  GH         N    LLEK  +VN +     + L  A + G       +  +GA  + +     + +H A R  H  ++  L+ +    +    +   PLH+A + D ++  + L+ +   VD       TPL +A+  G+    ++LL  +AD + +   GF  LH A    RI+  +LL K
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          

HSP 11 Score: 55.0694 bits (131), Expect = 5.404e-7
Identity = 45/190 (23.68%), Postives = 80/190 (42.11%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQIL 726
            +P   A  +N +     L+  K   N   +   +  HL++  GH EI   LI N S       DV  K     T +    ++  +   Q ++  GA+ N K + G + +H A      ++++FL+E   +  +      TPLH A +      ++ L+      + Q   G+TPL +A   G  + ++ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-------DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.8777 bits (198), Expect = 7.227e-15
Identity = 68/248 (27.42%), Postives = 107/248 (43.15%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNE-------------------------LLEKP------DVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTP-LHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            FL+A    DL KV +L++     NT +    ++ HLAS  GH E+++ELI   +                           L+E         VN  T L+ A ++   E V+Y+ + GA   +  + G + +  A++  H  ++  LLE     ND    V  P LH+A + D      LL+    + D  +K G TPL +A+  G+EN  Q+LL   A+ + +       LH A+   R     LL
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLL 279          

HSP 2 Score: 80.1073 bits (196), Expect = 1.349e-14
Identity = 56/219 (25.57%), Postives = 106/219 (48.40%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            L+P   A     +   K L+ +S   N+      +  H+A     ++++ EL+  Y    +E    +  T L  A   G +  V Y+ ++GA  +V+  +G++ +H A R   + +++ L+      +    ++ TPLH+A  L   + + LL+    + +A  +   +PL +A++ G E    ILL +NAD+ +   +GF  LH AS +  +E  +LL
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 3 Score: 75.0998 bits (183), Expect = 4.033e-13
Identity = 49/195 (25.13%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            N   ++  S  H+A+  G  E+   L+ + +++ L    + KK  T L  A + G LE V+ + E+G   +++     + +H A  + +  +   LLE   +      +  TPLH+A + + ME    L+ +  D +A+++ G TPL L+++ G++    +L+ N +D   K N G  A+H  +    +   ++L
Sbjct:  518 NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL----LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 71.633 bits (174), Expect = 4.688e-12
Identity = 56/219 (25.57%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N +  V+ L+K   +     +   +  H+A+  G + I+  L+   +N  +E   V  +T L  A      + V+ +   GAK + +  +  + +H A R  ++ I+  LL+   N N    D  +PLH+A +    E   +L++++ D     K G TPL LAS+ GN   +++LL      DI+       LH A+ +   +   LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 5 Score: 65.855 bits (159), Expect = 2.748e-10
Identity = 59/233 (25.32%), Postives = 102/233 (43.78%), Query Frame = 1
Query:  157 SVNEKQLSPFLKAVWRNDLSKVKKLIKKSYN----TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE-CKKLLQKTED 840
            +  E  L+P   A +   ++ V  L+++  N    TV  E  +  HLA+ A   ++++ LI N +    +  ++  +T L  A   G  + V  + + GA +N       S +H A +     +   LL+   +         TPLH+A +   +E ++LL+     VD + K   TPL +A+   N+    +LL N A        G+  LH A+   ++E    LLQ   D
Sbjct:  420 ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 6 Score: 62.003 bits (149), Expect = 3.778e-9
Identity = 50/206 (24.27%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  148 SPYSVNEK-QLSPF-LKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
            +P  +  K Q++P  + A + ND  KV  L+ ++  +     ++ +   H+A+    +EI   L+     +    P+   + G   L  + ++G  E    + E G+    K + G + +H   +  H  + Q L       N   N   TPLHVAC    +  ++ L+    DV  + +   TPL  A++ G+ N ++ LL N A
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNND--KVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 7 Score: 61.6178 bits (148), Expect = 4.865e-9
Identity = 53/219 (24.20%), Postives = 89/219 (40.64%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A   N    VK L+K   N     ++  +   +A   GH  ++  L+ N S   +  P       L  A +K        + +     +V    G + +H A  + H ++ Q LLEK  N N       +PLHVA +        LL++    +D++ K   TPL  A+ SG++  + +L+   A    K   G   LH A+    ++  + L
Sbjct:  133 FTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 8 Score: 58.9214 bits (141), Expect = 3.350e-8
Identity = 50/195 (25.64%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  229 LIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRI 807
            L++K  N   Q +   S  H+A+  G   +   L+S     +++    +  T L  A   G  + V  +  +GA  + K   G + +H A +  H    + LL      +D   D  TPLHVA     +   +LL++ S D +++   G TPL +A +      +++LL   A  +     G   LH A+F   I
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR--GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAI 438          

HSP 9 Score: 57.7658 bits (138), Expect = 7.212e-8
Identity = 53/188 (28.19%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  274 AFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENV-QYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A H+A+          L+ N  N     PDV  K+G   L  A   G  ENV Q + EKGA  N +     S +H A +   +++   LL +    +    D+ TPLH A      + + LL+     + A+ K G  PL +A++  + +A + LL + A  D    +    LH A+    +   KLL
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHN-----PDVTSKSGFTPLHIAAHYG-HENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 57.3806 bits (137), Expect = 1.216e-7
Identity = 56/230 (24.35%), Postives = 98/230 (42.61%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDA 843
            P L    + D +    L+ ++ +  D   +S F   H+A+  GH         N    LLEK  +VN +     + L  A + G       +  +GA  + +     + +H A R  H  ++  L+ +    +    +   PLH+A + D ++  + L+ +   VD       TPL +A+  G+    ++LL  +AD + +   GF  LH A    RI+  +LL K   A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA 417          

HSP 11 Score: 52.373 bits (124), Expect = 3.476e-6
Identity = 43/185 (23.24%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQIL 726
            +P   A  +N +     L+  K   N   +   +  HL++  GH EI   LI N S+  +     N  T +    ++  +   Q ++  GA+ N K + G + +H A      ++++FL+E   +  +      TPLH A +      ++ L+      + Q   G+TPL +A   G  + ++ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.8777 bits (198), Expect = 7.227e-15
Identity = 68/248 (27.42%), Postives = 107/248 (43.15%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNE-------------------------LLEKP------DVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTP-LHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            FL+A    DL KV +L++     NT +    ++ HLAS  GH E+++ELI   +                           L+E         VN  T L+ A ++   E V+Y+ + GA   +  + G + +  A++  H  ++  LLE     ND    V  P LH+A + D      LL+    + D  +K G TPL +A+  G+EN  Q+LL   A+ + +       LH A+   R     LL
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLL 279          

HSP 2 Score: 80.1073 bits (196), Expect = 1.349e-14
Identity = 56/219 (25.57%), Postives = 106/219 (48.40%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            L+P   A     +   K L+ +S   N+      +  H+A     ++++ EL+  Y    +E    +  T L  A   G +  V Y+ ++GA  +V+  +G++ +H A R   + +++ L+      +    ++ TPLH+A  L   + + LL+    + +A  +   +PL +A++ G E    ILL +NAD+ +   +GF  LH AS +  +E  +LL
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 3 Score: 75.0998 bits (183), Expect = 4.033e-13
Identity = 49/195 (25.13%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            N   ++  S  H+A+  G  E+   L+ + +++ L    + KK  T L  A + G LE V+ + E+G   +++     + +H A  + +  +   LLE   +      +  TPLH+A + + ME    L+ +  D +A+++ G TPL L+++ G++    +L+ N +D   K N G  A+H  +    +   ++L
Sbjct:  518 NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL----LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 71.633 bits (174), Expect = 4.688e-12
Identity = 56/219 (25.57%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N +  V+ L+K   +     +   +  H+A+  G + I+  L+   +N  +E   V  +T L  A      + V+ +   GAK + +  +  + +H A R  ++ I+  LL+   N N    D  +PLH+A +    E   +L++++ D     K G TPL LAS+ GN   +++LL      DI+       LH A+ +   +   LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 5 Score: 65.855 bits (159), Expect = 2.748e-10
Identity = 59/233 (25.32%), Postives = 102/233 (43.78%), Query Frame = 1
Query:  157 SVNEKQLSPFLKAVWRNDLSKVKKLIKKSYN----TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE-CKKLLQKTED 840
            +  E  L+P   A +   ++ V  L+++  N    TV  E  +  HLA+ A   ++++ LI N +    +  ++  +T L  A   G  + V  + + GA +N       S +H A +     +   LL+   +         TPLH+A +   +E ++LL+     VD + K   TPL +A+   N+    +LL N A        G+  LH A+   ++E    LLQ   D
Sbjct:  420 ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 6 Score: 62.003 bits (149), Expect = 3.778e-9
Identity = 50/206 (24.27%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  148 SPYSVNEK-QLSPF-LKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
            +P  +  K Q++P  + A + ND  KV  L+ ++  +     ++ +   H+A+    +EI   L+     +    P+   + G   L  + ++G  E    + E G+    K + G + +H   +  H  + Q L       N   N   TPLHVAC    +  ++ L+    DV  + +   TPL  A++ G+ N ++ LL N A
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNND--KVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 7 Score: 61.6178 bits (148), Expect = 4.865e-9
Identity = 53/219 (24.20%), Postives = 89/219 (40.64%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A   N    VK L+K   N     ++  +   +A   GH  ++  L+ N S   +  P       L  A +K        + +     +V    G + +H A  + H ++ Q LLEK  N N       +PLHVA +        LL++    +D++ K   TPL  A+ SG++  + +L+   A    K   G   LH A+    ++  + L
Sbjct:  133 FTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 8 Score: 58.9214 bits (141), Expect = 3.350e-8
Identity = 50/195 (25.64%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  229 LIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRI 807
            L++K  N   Q +   S  H+A+  G   +   L+S     +++    +  T L  A   G  + V  +  +GA  + K   G + +H A +  H    + LL      +D   D  TPLHVA     +   +LL++ S D +++   G TPL +A +      +++LL   A  +     G   LH A+F   I
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR--GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAI 438          

HSP 9 Score: 57.7658 bits (138), Expect = 7.212e-8
Identity = 53/188 (28.19%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  274 AFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENV-QYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A H+A+          L+ N  N     PDV  K+G   L  A   G  ENV Q + EKGA  N +     S +H A +   +++   LL +    +    D+ TPLH A      + + LL+     + A+ K G  PL +A++  + +A + LL + A  D    +    LH A+    +   KLL
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHN-----PDVTSKSGFTPLHIAAHYG-HENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 57.3806 bits (137), Expect = 1.216e-7
Identity = 56/230 (24.35%), Postives = 98/230 (42.61%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDA 843
            P L    + D +    L+ ++ +  D   +S F   H+A+  GH         N    LLEK  +VN +     + L  A + G       +  +GA  + +     + +H A R  H  ++  L+ +    +    +   PLH+A + D ++  + L+ +   VD       TPL +A+  G+    ++LL  +AD + +   GF  LH A    RI+  +LL K   A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA 417          

HSP 11 Score: 52.373 bits (124), Expect = 3.476e-6
Identity = 43/185 (23.24%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQIL 726
            +P   A  +N +     L+  K   N   +   +  HL++  GH EI   LI N S+  +     N  T +    ++  +   Q ++  GA+ N K + G + +H A      ++++FL+E   +  +      TPLH A +      ++ L+      + Q   G+TPL +A   G  + ++ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.4925 bits (197), Expect = 9.247e-15
Identity = 68/248 (27.42%), Postives = 107/248 (43.15%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNE-------------------------LLEKP------DVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTP-LHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            FL+A    DL KV +L++     NT +    ++ HLAS  GH E+++ELI   +                           L+E         VN  T L+ A ++   E V+Y+ + GA   +  + G + +  A++  H  ++  LLE     ND    V  P LH+A + D      LL+    + D  +K G TPL +A+  G+EN  Q+LL   A+ + +       LH A+   R     LL
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLL 279          

HSP 2 Score: 79.7221 bits (195), Expect = 1.495e-14
Identity = 56/219 (25.57%), Postives = 106/219 (48.40%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            L+P   A     +   K L+ +S   N+      +  H+A     ++++ EL+  Y    +E    +  T L  A   G +  V Y+ ++GA  +V+  +G++ +H A R   + +++ L+      +    ++ TPLH+A  L   + + LL+    + +A  +   +PL +A++ G E    ILL +NAD+ +   +GF  LH AS +  +E  +LL
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 3 Score: 74.7146 bits (182), Expect = 5.163e-13
Identity = 49/195 (25.13%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            N   ++  S  H+A+  G  E+   L+ + +++ L    + KK  T L  A + G LE V+ + E+G   +++     + +H A  + +  +   LLE   +      +  TPLH+A + + ME    L+ +  D +A+++ G TPL L+++ G++    +L+ N +D   K N G  A+H  +    +   ++L
Sbjct:  518 NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL----LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 4 Score: 71.2478 bits (173), Expect = 5.660e-12
Identity = 56/219 (25.57%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N +  V+ L+K   +     +   +  H+A+  G + I+  L+   +N  +E   V  +T L  A      + V+ +   GAK + +  +  + +H A R  ++ I+  LL+   N N    D  +PLH+A +    E   +L++++ D     K G TPL LAS+ GN   +++LL      DI+       LH A+ +   +   LL
Sbjct:  393 FTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLL 609          

HSP 5 Score: 65.855 bits (159), Expect = 3.130e-10
Identity = 61/236 (25.85%), Postives = 101/236 (42.80%), Query Frame = 1
Query:  157 SVNEKQLSPFLKAVWRNDLSKVKKLIKKSYN----TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKK---TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE-CKKLLQKTED 840
            +  E  L+P   A +   ++ V  L+++  N    TV  E  +  HLA+ A   ++++ LI N +     K D   +   T L  A   G  + V  + + GA +N       S +H A +     +   LL+   +         TPLH+A +   +E ++LL+     VD + K   TPL +A+   N+    +LL N A        G+  LH A+   ++E    LLQ   D
Sbjct:  420 ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGA-----KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKAD 648          

HSP 6 Score: 62.003 bits (149), Expect = 4.527e-9
Identity = 50/206 (24.27%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  148 SPYSVNEK-QLSPF-LKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
            +P  +  K Q++P  + A + ND  KV  L+ ++  +     ++ +   H+A+    +EI   L+     +    P+   + G   L  + ++G  E    + E G+    K + G + +H   +  H  + Q L       N   N   TPLHVAC    +  ++ L+    DV  + +   TPL  A++ G+ N ++ LL N A
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNND--KVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-----QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGA 779          

HSP 7 Score: 61.6178 bits (148), Expect = 6.184e-9
Identity = 53/219 (24.20%), Postives = 89/219 (40.64%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A   N    VK L+K   N     ++  +   +A   GH  ++  L+ N S   +  P       L  A +K        + +     +V    G + +H A  + H ++ Q LLEK  N N       +PLHVA +        LL++    +D++ K   TPL  A+ SG++  + +L+   A    K   G   LH A+    ++  + L
Sbjct:  133 FTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL 345          

HSP 8 Score: 58.9214 bits (141), Expect = 3.630e-8
Identity = 50/195 (25.64%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  229 LIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRI 807
            L++K  N   Q +   S  H+A+  G   +   L+S     +++    +  T L  A   G  + V  +  +GA  + K   G + +H A +  H    + LL      +D   D  TPLHVA     +   +LL++ S D +++   G TPL +A +      +++LL   A  +     G   LH A+F   I
Sbjct:  246 LLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR--GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAI 438          

HSP 9 Score: 57.7658 bits (138), Expect = 8.289e-8
Identity = 53/188 (28.19%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  274 AFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENV-QYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A H+A+          L+ N  N     PDV  K+G   L  A   G  ENV Q + EKGA  N +     S +H A +   +++   LL +    +    D+ TPLH A      + + LL+     + A+ K G  PL +A++  + +A + LL + A  D    +    LH A+    +   KLL
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHN-----PDVTSKSGFTPLHIAAHYG-HENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL 378          

HSP 10 Score: 56.9954 bits (136), Expect = 1.351e-7
Identity = 56/230 (24.35%), Postives = 98/230 (42.61%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDA 843
            P L    + D +    L+ ++ +  D   +S F   H+A+  GH         N    LLEK  +VN +     + L  A + G       +  +GA  + +     + +H A R  H  ++  L+ +    +    +   PLH+A + D ++  + L+ +   VD       TPL +A+  G+    ++LL  +AD + +   GF  LH A    RI+  +LL K   A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA 417          

HSP 11 Score: 51.9878 bits (123), Expect = 4.349e-6
Identity = 43/185 (23.24%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQIL 726
            +P   A  +N +     L+  K   N   +   +  HL++  GH EI   LI N S+  +     N  T +    ++  +   Q ++  GA+ N K + G + +H A      ++++FL+E   +  +      TPLH A +      ++ L+      + Q   G+TPL +A   G  + ++ L
Sbjct:  625 TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD--VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG10011 (gene:FBgn0039590 transcript:FBtr0085319)

HSP 1 Score: 90.5077 bits (223), Expect = 1.271e-17
Identity = 60/218 (27.52%), Postives = 108/218 (49.54%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAV---EKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE-CKKLLQ 828
            A W      +K LI+     N+VD++ R++   AS  GH +I++ L+ N +N  +   D++ ++ L  A      G  + +  + + GA T+  D+ G S +  +    ++ + + LLE   +P+  +    TPL  AC       ++LL+ + C +D  +  G+T L + +  GN   ++ LL    D   +DN G+  LHYA+F    E C +LL+
Sbjct: 1357 AAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGAN--VNHLDLDGRSALCVAALCGSSGYSKVISTLLDHGANTDQLDNDGMSPLLVSSFEGNAEVCELLLENAADPDLADFMGRTPLWAACTAGHATVVKLLLFWGCGIDCMDSEGRTVLSIGAAQGNVETVRQLLDRGLDETHRDNAGWTPLHYAAFEGFHEVCLQLLE 1572          

HSP 2 Score: 67.781 bits (164), Expect = 1.067e-10
Identity = 58/247 (23.48%), Postives = 109/247 (44.13%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKKSYNTVDQ---EKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFE-KGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQ---KTEDAQP----------QVSPPKRPPTL 882
            A     L  V+ L+    + VDQ   + ++AF LA   GH++ ++ L+    +  +   D + +T L+    +  LE V+Y+ +      N+ D +G + +H A    H+ +++ L+E   + N  + +  TPLH        + + +L+ Y    D   K G T L ++++ G+E  +  LL   A+    D+ G   +  A+   R    K+ +   K E + P           +  P +PP L
Sbjct: 1591 AAQEGRLHCVQALLDIHSSFVDQKAHDGKTAFRLACLEGHMDTVEFLLKFCCD--VNSKDADSRTTLYILALENKLEIVKYLLDMTNVDVNIPDSEGRTALHVAAWQGHADMVKTLIEAGADVNSMDLEARTPLHSCAWQGNHDVMNILLYYGALADHACKQGATALGISAQEGHEKCVIALLQFGANPYKSDHCGRTPIKLAAKSSRTSILKIFESYTKNEASNPNEPKFHAHASMLRSPDQPPAL 1835          

HSP 3 Score: 54.6842 bits (130), Expect = 1.026e-6
Identity = 50/207 (24.15%), Postives = 93/207 (44.93%), Query Frame = 1
Query:  220 VKKLIKKSYNT--VDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLS-NNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            +  L+    NT  +D +  S   ++S  G+ E+ + L+ N ++  L   D   +T L+ A   G    V+ +   G   +  D +G +++       +   ++ LL++ L+    +N   TPLH A    F E    L+     +D  +  GKT L LA++ G  + +Q LL  +++  D K ++G  A   A     ++  + L K
Sbjct: 1435 ISTLLDHGANTDQLDNDGMSPLLVSSFEGNAEVCELLLENAADPDL--ADFMGRTPLWAACTAGHATVVKLLLFWGCGIDCMDSEGRTVLSIGAAQGNVETVRQLLDRGLDETHRDNAGWTPLHYAAFEGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHDGKTAFRLACLEGHMDTVEFLLK 1639          

HSP 4 Score: 53.5286 bits (127), Expect = 1.849e-6
Identity = 49/181 (27.07%), Postives = 85/181 (46.96%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPND-CNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            D   ++A ++A+  GHLE++K L+S        +P  N  TG  K V+                 N  D  G + + +A    HS +++ L+ +     D  + +  T L  A      + L+LL+    DV++ ++ G+T LI AS  G+ + ++ILL N A+ +  D +G  AL  A+ 
Sbjct: 1268 DYNGQTALNIAARNGHLEVVKLLLS------FSQP-CNDGTGRMKRVD----------------VNHADRDGWTPLRSASWGGHSEVVRLLIAQPACKIDLADKEGRTALRAAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENGANVNHLDLDGRSALCVAAL 1425          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303124)

HSP 1 Score: 77.0258 bits (188), Expect = 1.802e-13
Identity = 58/229 (25.33%), Postives = 108/229 (47.16%), Query Frame = 1
Query:  148 SPYSVNEKQ-LSPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +P S   K  L+P   A     +   + L+  +   + V  +  +A H+A+  GH+ + K L+    N       +N  T L  A +K  L+ V+ +   GA  +   + G + +H A      +I+ +LL+ + +P+       TPLH+A   +  + +++L+     VDA+ +  +TPL +AS  GN + + +LL + A  D    + + ALH A+   + E   +L
Sbjct:  445 APISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR--NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 671          

HSP 2 Score: 74.7146 bits (182), Expect = 8.187e-13
Identity = 50/193 (25.91%), Postives = 91/193 (47.15%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK-LLQKTEDAQPQ 852
             H+A     L++++ L+ + ++  +     +  T L  A   G +  V Y+ +  A  +V   +G++ +H A R   + I++ LL      +    +  TPLH+A  L  ++ + LL+ +   VDA  K   T L +A++ G +    +L+ N A  D    +GF  LH  + +  I+  + LLQK  D   Q
Sbjct:  524 LHIACKKNRLKVVELLLRHGAS--ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQ 714          

HSP 3 Score: 74.3294 bits (181), Expect = 1.090e-12
Identity = 61/224 (27.23%), Postives = 105/224 (46.88%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFH--QRIECKKLLQKTEDA 843
            FL+A    +L +V + +K +   NT +    +A HLAS  GH+ ++ EL+      +++       T L  A   G  E V+ + E  A  NV+   G + ++ A +  H ++++ LL    N +    D  TPL VA +    +G   ++    + D + K+    L +A++  +  A  +LL N+ + D+    GF  LH AS +  Q I    L+QK  D 
Sbjct:  165 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRR--GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQ----QGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNI-ANLLIQKGADV 381          

HSP 4 Score: 70.4774 bits (171), Expect = 1.553e-11
Identity = 46/187 (24.60%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            +A H+A+  G  E+   LI N     L+       T L    + G ++  Q + +K A  + +   G + +H A  + +  +   LLEK  +P+    + +TPLH+A   + M+    L+ Y    +A++K G TPL L+S+ G+     +L+ + A  +     G   +H  +    +   ++L+K
Sbjct:  654 TALHIAAKEGQDEVAAVLIEN--GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 838          

HSP 5 Score: 69.3218 bits (168), Expect = 3.422e-11
Identity = 53/219 (24.20%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N L  V+ L++   S +   +   +  H+A+  G + I+  L+ + ++   + P V  +T L  A      + ++ +   GA+ + +  +  + +H A R  +  I+  LL+     +    D+ T LH+A +    E   +L+     +DA  K G TPL L ++ G+    Q+LL   AD D +   G   LH A  +   +   LL
Sbjct:  521 FTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP--DVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLL 737          

HSP 6 Score: 67.781 bits (164), Expect = 1.101e-10
Identity = 59/226 (26.11%), Postives = 99/226 (43.81%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            P L    + D  K   L+  + +  D   +S F   H+AS  G+         N +N L++K  DVN       + L  A + G    V  + EKG     K   G + +H A R  H  ++  LLE+    +    +   PLH+A + + ++  ++L+ +   VD       T L +A+  G+    ++LL  NAD + +   GF  LH A    R++  +LL +
Sbjct:  324 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN--------QNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLR 541          

HSP 7 Score: 66.2402 bits (160), Expect = 3.019e-10
Identity = 51/200 (25.50%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELI--------------------SNYSNE-----LLEK---PDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALH 783
             HL +  GH+++ + L+                     +Y+N+     LLEK   P    K G   L  A  K  ++    + E GA  N +   G + +H + +  H+ I   L+E +   N    +  TP+H+  + D +   ++L     ++D   K G TPL +AS  G  N ++ LL N A+ D   + G+  LH
Sbjct:  689 LHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLH 888          

HSP 8 Score: 64.6994 bits (156), Expect = 9.630e-10
Identity = 53/199 (26.63%), Postives = 86/199 (43.22%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK----LLQKTEDAQPQV 855
            S  H+A+  G   ++  L+    N  +E    +  T L  A   G  + V  + E+GA  + K   G + +H A + +H    + LL      ++   D  T LHVA     +   +LL++ + D +A+   G TPL +A +      +++LL + A        G   LH A+F   + C      LLQ   DA P V
Sbjct:  390 SPLHVAAKWGKTNMVSLLLEKGGN--IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF---MGCMNIVIYLLQ--HDASPDV 581          

HSP 9 Score: 63.5438 bits (153), Expect = 2.176e-9
Identity = 58/224 (25.89%), Postives = 96/224 (42.86%), Query Frame = 1
Query:  163 NEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             E   +P   A+ +     V  L++   +T  + +  A H+A+    ++    L+ N  N     PDV  K+G   L  A   G       + +KGA  N       S +H A +   ++++  LLEK  N      D  TPLH A      + + +L+     + A+ K G  PL +A++  + +A +ILL + A  D    +   ALH A+    +   KLL
Sbjct:  290 TEDGFTPLAVAMQQGHDKVVAVLLES--DTRGKVRLPALHIAAKKDDVKAATLLLDNDHN-----PDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLL 506          

HSP 10 Score: 62.7734 bits (151), Expect = 3.313e-9
Identity = 37/138 (26.81%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  376 TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYA 789
            T   +A   G LE V    +     N  +  G + +H A +  H  ++  LL +    +      NT LH+A      E ++LL+ ++  V+ Q++ G TPL +A++  ++  +++LLSN A++ +   +GF  L  A
Sbjct:  163 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 300          

HSP 11 Score: 61.2326 bits (147), Expect = 9.798e-9
Identity = 56/233 (24.03%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  220 VKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNV----------KDD-------------------KGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            VK L++   S N   Q   +  ++A+   H  +++ L+SN +N+ L   D    T L  A+++G  + V  + E   +  V          KDD                    G + +H A  + + +I   L++K  + N       +PLHVA +      + LL+    +++A+ + G TPL  A+ SG+E  + +LL   A    K   G   LH A+  + ++  ++L
Sbjct:  243 VKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 473          

HSP 12 Score: 56.9954 bits (136), Expect = 2.019e-7
Identity = 44/185 (23.78%), Postives = 89/185 (48.11%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            ++F  A+ AG+LE + E + N  N  +   + N    L  A + G +  V  +  +GA  +    KG++ +H A       +++ LLE   + N  + +  TPL++A + +    ++LL++   +     + G TPL +A + G++  + +LL ++    ++      ALH A+    ++   LL
Sbjct:  163 TSFLRAARAGNLERVLEHLKN--NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLL 341          

HSP 13 Score: 55.0694 bits (131), Expect = 7.554e-7
Identity = 56/197 (28.43%), Postives = 92/197 (46.70%), Query Frame = 1
Query:  148 SPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTV-DQEKRSAF---HLASAAGHLEIIKELISNYSNELLE-KPDVN--KKTGL----FKAVEKGILENVQYIFEK-GAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESG 702
            SP++  +   +P   A  +N +     L++  Y  + + E ++ F   HL+S  GH EI        SN L+E K  VN   K GL      A E  +  NV  I EK GA  ++    G + +H A     +++++FLL+   N +   +   TPLH   +      + LL+ +  + +AQ   G+TPL +A + G
Sbjct:  743 SPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAGFTPLHLSSQEGHAEI--------SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV--NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 927          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 77.0258 bits (188), Expect = 1.812e-13
Identity = 58/229 (25.33%), Postives = 108/229 (47.16%), Query Frame = 1
Query:  148 SPYSVNEKQ-LSPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +P S   K  L+P   A     +   + L+  +   + V  +  +A H+A+  GH+ + K L+    N       +N  T L  A +K  L+ V+ +   GA  +   + G + +H A      +I+ +LL+ + +P+       TPLH+A   +  + +++L+     VDA+ +  +TPL +AS  GN + + +LL + A  D    + + ALH A+   + E   +L
Sbjct:  295 APISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR--NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 521          

HSP 2 Score: 75.0998 bits (183), Expect = 6.560e-13
Identity = 50/193 (25.91%), Postives = 91/193 (47.15%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK-LLQKTEDAQPQ 852
             H+A     L++++ L+ + ++  +     +  T L  A   G +  V Y+ +  A  +V   +G++ +H A R   + I++ LL      +    +  TPLH+A  L  ++ + LL+ +   VDA  K   T L +A++ G +    +L+ N A  D    +GF  LH  + +  I+  + LLQK  D   Q
Sbjct:  374 LHIACKKNRLKVVELLLRHGAS--ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQ 564          

HSP 3 Score: 70.4774 bits (171), Expect = 1.629e-11
Identity = 46/187 (24.60%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            +A H+A+  G  E+   LI N     L+       T L    + G ++  Q + +K A  + +   G + +H A  + +  +   LLEK  +P+    + +TPLH+A   + M+    L+ Y    +A++K G TPL L+S+ G+     +L+ + A  +     G   +H  +    +   ++L+K
Sbjct:  504 TALHIAAKEGQDEVAAVLIEN--GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 688          

HSP 4 Score: 69.3218 bits (168), Expect = 3.272e-11
Identity = 53/219 (24.20%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N L  V+ L++   S +   +   +  H+A+  G + I+  L+ + ++   + P V  +T L  A      + ++ +   GA+ + +  +  + +H A R  +  I+  LL+     +    D+ T LH+A +    E   +L+     +DA  K G TPL L ++ G+    Q+LL   AD D +   G   LH A  +   +   LL
Sbjct:  371 FTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP--DVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLL 587          

HSP 5 Score: 67.781 bits (164), Expect = 1.010e-10
Identity = 59/226 (26.11%), Postives = 99/226 (43.81%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            P L    + D  K   L+  + +  D   +S F   H+AS  G+         N +N L++K  DVN       + L  A + G    V  + EKG     K   G + +H A R  H  ++  LLE+    +    +   PLH+A + + ++  ++L+ +   VD       T L +A+  G+    ++LL  NAD + +   GF  LH A    R++  +LL +
Sbjct:  174 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN--------QNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLR 391          

HSP 6 Score: 66.2402 bits (160), Expect = 3.303e-10
Identity = 51/200 (25.50%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELI--------------------SNYSNE-----LLEK---PDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALH 783
             HL +  GH+++ + L+                     +Y+N+     LLEK   P    K G   L  A  K  ++    + E GA  N +   G + +H + +  H+ I   L+E +   N    +  TP+H+  + D +   ++L     ++D   K G TPL +AS  G  N ++ LL N A+ D   + G+  LH
Sbjct:  539 LHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLH 738          

HSP 7 Score: 64.6994 bits (156), Expect = 9.852e-10
Identity = 53/199 (26.63%), Postives = 86/199 (43.22%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK----LLQKTEDAQPQV 855
            S  H+A+  G   ++  L+    N  +E    +  T L  A   G  + V  + E+GA  + K   G + +H A + +H    + LL      ++   D  T LHVA     +   +LL++ + D +A+   G TPL +A +      +++LL + A        G   LH A+F   + C      LLQ   DA P V
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGN--IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF---MGCMNIVIYLLQ--HDASPDV 431          

HSP 8 Score: 62.7734 bits (151), Expect = 3.039e-9
Identity = 37/138 (26.81%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  376 TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYA 789
            T   +A   G LE V    +     N  +  G + +H A +  H  ++  LL +    +      NT LH+A      E ++LL+ ++  V+ Q++ G TPL +A++  ++  +++LLSN A++ +   +GF  L  A
Sbjct:   13 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 150          

HSP 9 Score: 61.2326 bits (147), Expect = 9.295e-9
Identity = 56/233 (24.03%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  220 VKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNV----------KDD-------------------KGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            VK L++   S N   Q   +  ++A+   H  +++ L+SN +N+ L   D    T L  A+++G  + V  + E   +  V          KDD                    G + +H A  + + +I   L++K  + N       +PLHVA +      + LL+    +++A+ + G TPL  A+ SG+E  + +LL   A    K   G   LH A+  + ++  ++L
Sbjct:   93 VKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 323          

HSP 10 Score: 57.3806 bits (137), Expect = 1.647e-7
Identity = 44/185 (23.78%), Postives = 89/185 (48.11%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            ++F  A+ AG+LE + E + N  N  +   + N    L  A + G +  V  +  +GA  +    KG++ +H A       +++ LLE   + N  + +  TPL++A + +    ++LL++   +     + G TPL +A + G++  + +LL ++    ++      ALH A+    ++   LL
Sbjct:   13 TSFLRAARAGNLERVLEHLKN--NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLL 191          

HSP 11 Score: 54.6842 bits (130), Expect = 8.625e-7
Identity = 56/197 (28.43%), Postives = 92/197 (46.70%), Query Frame = 1
Query:  148 SPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTV-DQEKRSAF---HLASAAGHLEIIKELISNYSNELLE-KPDVN--KKTGL----FKAVEKGILENVQYIFEK-GAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESG 702
            SP++  +   +P   A  +N +     L++  Y  + + E ++ F   HL+S  GH EI        SN L+E K  VN   K GL      A E  +  NV  I EK GA  ++    G + +H A     +++++FLL+   N +   +   TPLH   +      + LL+ +  + +AQ   G+TPL +A + G
Sbjct:  593 SPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAGFTPLHLSSQEGHAEI--------SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV--NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 777          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303115)

HSP 1 Score: 76.6406 bits (187), Expect = 1.888e-13
Identity = 58/229 (25.33%), Postives = 108/229 (47.16%), Query Frame = 1
Query:  148 SPYSVNEKQ-LSPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +P S   K  L+P   A     +   + L+  +   + V  +  +A H+A+  GH+ + K L+    N       +N  T L  A +K  L+ V+ +   GA  +   + G + +H A      +I+ +LL+ + +P+       TPLH+A   +  + +++L+     VDA+ +  +TPL +AS  GN + + +LL + A  D    + + ALH A+   + E   +L
Sbjct:  445 APISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR--NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 671          

HSP 2 Score: 74.7146 bits (182), Expect = 8.290e-13
Identity = 50/193 (25.91%), Postives = 91/193 (47.15%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK-LLQKTEDAQPQ 852
             H+A     L++++ L+ + ++  +     +  T L  A   G +  V Y+ +  A  +V   +G++ +H A R   + I++ LL      +    +  TPLH+A  L  ++ + LL+ +   VDA  K   T L +A++ G +    +L+ N A  D    +GF  LH  + +  I+  + LLQK  D   Q
Sbjct:  524 LHIACKKNRLKVVELLLRHGAS--ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQ 714          

HSP 3 Score: 74.3294 bits (181), Expect = 1.076e-12
Identity = 61/224 (27.23%), Postives = 105/224 (46.88%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFH--QRIECKKLLQKTEDA 843
            FL+A    +L +V + +K +   NT +    +A HLAS  GH+ ++ EL+      +++       T L  A   G  E V+ + E  A  NV+   G + ++ A +  H ++++ LL    N +    D  TPL VA +    +G   ++    + D + K+    L +A++  +  A  +LL N+ + D+    GF  LH AS +  Q I    L+QK  D 
Sbjct:  165 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRR--GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQ----QGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNI-ANLLIQKGADV 381          

HSP 4 Score: 70.4774 bits (171), Expect = 1.681e-11
Identity = 46/187 (24.60%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            +A H+A+  G  E+   LI N     L+       T L    + G ++  Q + +K A  + +   G + +H A  + +  +   LLEK  +P+    + +TPLH+A   + M+    L+ Y    +A++K G TPL L+S+ G+     +L+ + A  +     G   +H  +    +   ++L+K
Sbjct:  654 TALHIAAKEGQDEVAAVLIEN--GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 838          

HSP 5 Score: 69.3218 bits (168), Expect = 3.643e-11
Identity = 53/219 (24.20%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N L  V+ L++   S +   +   +  H+A+  G + I+  L+ + ++   + P V  +T L  A      + ++ +   GA+ + +  +  + +H A R  +  I+  LL+     +    D+ T LH+A +    E   +L+     +DA  K G TPL L ++ G+    Q+LL   AD D +   G   LH A  +   +   LL
Sbjct:  521 FTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP--DVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLL 737          

HSP 6 Score: 67.781 bits (164), Expect = 1.124e-10
Identity = 59/226 (26.11%), Postives = 99/226 (43.81%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            P L    + D  K   L+  + +  D   +S F   H+AS  G+         N +N L++K  DVN       + L  A + G    V  + EKG     K   G + +H A R  H  ++  LLE+    +    +   PLH+A + + ++  ++L+ +   VD       T L +A+  G+    ++LL  NAD + +   GF  LH A    R++  +LL +
Sbjct:  324 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN--------QNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLR 541          

HSP 7 Score: 66.2402 bits (160), Expect = 3.159e-10
Identity = 51/200 (25.50%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELI--------------------SNYSNE-----LLEK---PDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALH 783
             HL +  GH+++ + L+                     +Y+N+     LLEK   P    K G   L  A  K  ++    + E GA  N +   G + +H + +  H+ I   L+E +   N    +  TP+H+  + D +   ++L     ++D   K G TPL +AS  G  N ++ LL N A+ D   + G+  LH
Sbjct:  689 LHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLH 888          

HSP 8 Score: 64.3142 bits (155), Expect = 1.060e-9
Identity = 53/199 (26.63%), Postives = 86/199 (43.22%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK----LLQKTEDAQPQV 855
            S  H+A+  G   ++  L+    N  +E    +  T L  A   G  + V  + E+GA  + K   G + +H A + +H    + LL      ++   D  T LHVA     +   +LL++ + D +A+   G TPL +A +      +++LL + A        G   LH A+F   + C      LLQ   DA P V
Sbjct:  390 SPLHVAAKWGKTNMVSLLLEKGGN--IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF---MGCMNIVIYLLQ--HDASPDV 581          

HSP 9 Score: 63.5438 bits (153), Expect = 2.258e-9
Identity = 58/224 (25.89%), Postives = 96/224 (42.86%), Query Frame = 1
Query:  163 NEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             E   +P   A+ +     V  L++   +T  + +  A H+A+    ++    L+ N  N     PDV  K+G   L  A   G       + +KGA  N       S +H A +   ++++  LLEK  N      D  TPLH A      + + +L+     + A+ K G  PL +A++  + +A +ILL + A  D    +   ALH A+    +   KLL
Sbjct:  290 TEDGFTPLAVAMQQGHDKVVAVLLES--DTRGKVRLPALHIAAKKDDVKAATLLLDNDHN-----PDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLL 506          

HSP 10 Score: 62.7734 bits (151), Expect = 3.269e-9
Identity = 37/138 (26.81%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  376 TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYA 789
            T   +A   G LE V    +     N  +  G + +H A +  H  ++  LL +    +      NT LH+A      E ++LL+ ++  V+ Q++ G TPL +A++  ++  +++LLSN A++ +   +GF  L  A
Sbjct:  163 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 300          

HSP 11 Score: 61.2326 bits (147), Expect = 1.043e-8
Identity = 56/233 (24.03%), Postives = 101/233 (43.35%), Query Frame = 1
Query:  220 VKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNV----------KDD-------------------KGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            VK L++   S N   Q   +  ++A+   H  +++ L+SN +N+ L   D    T L  A+++G  + V  + E   +  V          KDD                    G + +H A  + + +I   L++K  + N       +PLHVA +      + LL+    +++A+ + G TPL  A+ SG+E  + +LL   A    K   G   LH A+  + ++  ++L
Sbjct:  243 VKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 473          

HSP 12 Score: 56.9954 bits (136), Expect = 2.008e-7
Identity = 44/185 (23.78%), Postives = 89/185 (48.11%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            ++F  A+ AG+LE + E + N  N  +   + N    L  A + G +  V  +  +GA  +    KG++ +H A       +++ LLE   + N  + +  TPL++A + +    ++LL++   +     + G TPL +A + G++  + +LL ++    ++      ALH A+    ++   LL
Sbjct:  163 TSFLRAARAGNLERVLEHLKN--NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLL 341          

HSP 13 Score: 55.0694 bits (131), Expect = 7.325e-7
Identity = 49/190 (25.79%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  148 SPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTV-DQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEK-GAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESG 702
            SP++  +   +P   A  +N +     L++  Y  + + E ++ F   HL+S  GH EI   LI + +   +  P  N  T +    ++  + NV  I EK GA  ++    G + +H A     +++++FLL+   N +   +   TPLH   +      + LL+ +  + +AQ   G+TPL +A + G
Sbjct:  743 SPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKA--AVNHPAKNGLTPMHLCAQEDNV-NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 927          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 76.6406 bits (187), Expect = 2.071e-13
Identity = 49/185 (26.49%), Postives = 93/185 (50.27%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +A H+A+  GH+ + K L+   ++       +N  T L  A +K  L+ V+ +   GA  +   + G + +H A      +I+ +LL+ + +P+       TPLH+A   +  + +++L+     VDA+ +  +TPL +AS  GN + + +LL + A  D    + + ALH A+   + E   +L
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRNADANARA--LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVL 521          

HSP 2 Score: 73.9442 bits (180), Expect = 1.292e-12
Identity = 50/195 (25.64%), Postives = 93/195 (47.69%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTE---DAQ 846
            +  H+A     L++++ L+ + ++  +     +  T L  A   G +  V Y+ +  A  +V   +G++ +H A R   + I++ LL      +    +  TPLH+A  L  ++ + LL+ +   VDA  K   T L +A++ G +    +L+ N A  D    +GF  LH  + +  I+  +LL + E   DAQ
Sbjct:  372 TPLHIACKKNRLKVVELLLRHGAS--ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQ 564          

HSP 3 Score: 70.8626 bits (172), Expect = 1.257e-11
Identity = 46/187 (24.60%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            +A H+A+  G  E+   LI N +   L+       T L    + G ++  Q + +K A  + +   G + +H A  + +  +   LLEK  +P+    + +TPLH+A   + M+    L+ Y    +A++K G TPL L+S+ G+     +L+ + A  +     G   +H  +    +   ++L+K
Sbjct:  504 TALHIAAKEGQDEVAAVLIENGA--ALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 688          

HSP 4 Score: 67.0106 bits (162), Expect = 1.771e-10
Identity = 53/219 (24.20%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +P   A  +N L  V+ L++   S +   +   +  H+A+  G + I+  L+ + ++  +  P V  +T L  A      + ++ +   GA+ + +  +  + +H A R  +  I+  LL+     +    D+ T LH+A +    E   +L+     +DA  K G TPL L ++ G+    Q+LL   AD D +   G   LH A  +   +   LL
Sbjct:  371 FTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDV--PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLL 587          

HSP 5 Score: 66.2402 bits (160), Expect = 2.786e-10
Identity = 59/224 (26.34%), Postives = 98/224 (43.75%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEK-PDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            P L    + D  K   L+  + +  D   +S F   H+AS  G+         N +N L++K  DVN       + L  A + G    V  + EKG     K   G + +H A R  H  ++  LLE+    +    +   PLH+A + + ++  ++L+ +   VD       T L +A+  G+    ++LL  NAD + +   GF  LH A    R++  +LL
Sbjct:  174 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN--------QNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELL 389          

HSP 6 Score: 66.2402 bits (160), Expect = 3.466e-10
Identity = 53/212 (25.00%), Postives = 91/212 (42.92%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELIS--------------------NYSNE-----LLEK---PDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIEC 813
            +  HL +  GH+++ + L+                     +Y+N+     LLEK   P    K G   L  A  K  ++    + E GA  N +   G + +H + +  H+ I   L+E +   N    +  TP+H+  + D +   ++L     ++D   K G TPL +AS  G  N ++ LL N A+ D   + G+  LH  +  Q+  C
Sbjct:  537 TPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTA--QQGHC 746          

HSP 7 Score: 65.4698 bits (158), Expect = 5.784e-10
Identity = 46/185 (24.86%), Postives = 83/185 (44.86%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +  H+A+   H++  + L+  Y    +++  V+  T L  A   G +   + + ++ A  N +   G + +H A +     +++ LL    + +       TPLHVA  +  M  +  L+ +    D     G+TPL LA+ +   + I+ILL N A  D +  E    LH AS    ++   LL
Sbjct:  306 APLHMAAQGEHVDAARILL--YHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          

HSP 8 Score: 63.1586 bits (152), Expect = 2.535e-9
Identity = 45/175 (25.71%), Postives = 77/175 (44.00%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            S  H+A+  G   ++  L+    N  +E    +  T L  A   G  + V  + E+GA  + K   G + +H A + +H    + LL      ++   D  T LHVA     +   +LL++ + D +A+   G TPL +A +      +++LL + A        G   LH A+F
Sbjct:  240 SPLHVAAKWGKTNMVSLLLEKGGN--IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAF 412          

HSP 9 Score: 61.6178 bits (148), Expect = 7.873e-9
Identity = 37/138 (26.81%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  376 TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYA 789
            T   +A   G LE V    +     N  +  G + +H A +  H  ++  LL +    +      NT LH+A      E ++LL+ ++  V+ Q++ G TPL +A++  ++  +++LLSN A++ +   +GF  L  A
Sbjct:   13 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA 150          

HSP 10 Score: 61.6178 bits (148), Expect = 8.781e-9
Identity = 53/224 (23.66%), Postives = 96/224 (42.86%), Query Frame = 1
Query:  241 SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNV----------KDD-------------------KGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            S N   Q   +  ++A+   H  +++ L+SN +N+ L   D    T L  A+++G  + V  + E   +  V          KDD                    G + +H A  + + +I   L++K  + N       +PLHVA +      + LL+    +++A+ + G TPL  A+ SG+E  + +LL   A    K   G   LH A+  + ++  ++L
Sbjct:  102 SVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGF--TPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 323          

HSP 11 Score: 56.225 bits (134), Expect = 3.034e-7
Identity = 44/185 (23.78%), Postives = 89/185 (48.11%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            ++F  A+ AG+LE + E + N  N  +   + N    L  A + G +  V  +  +GA  +    KG++ +H A       +++ LLE   + N  + +  TPL++A + +    ++LL++   +     + G TPL +A + G++  + +LL ++    ++      ALH A+    ++   LL
Sbjct:   13 TSFLRAARAGNLERVLEHLKN--NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATLL 191          

HSP 12 Score: 52.373 bits (124), Expect = 5.679e-6
Identity = 49/190 (25.79%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  148 SPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTV-DQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEK-GAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESG 702
            SP++  +   +P   A  +N +     L++  Y  + + E ++ F   HL+S  GH EI   LI + +   +  P  N  T +    ++  + NV  I EK GA  ++    G + +H A     +++++FLL+   N +   +   TPLH   +      + LL+ +  + +AQ   G+TPL +A + G
Sbjct:  593 SPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKA--AVNHPAKNGLTPMHLCAQEDNV-NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 777          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-272n13.3 (si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104-216])

HSP 1 Score: 104.76 bits (260), Expect = 7.461e-24
Identity = 69/232 (29.74%), Postives = 125/232 (53.88%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A++  + Y V EK L    KA +  D+ K+++L KK+  N +D+E R+A H+A A GH ++++ L+   S   L   D   ++ L KAV+     +V  + E  A  N+ D  G++ +H + R     +   LLE   N +  N D NTPL +A   +  +  +LL+    DV+ +N+  ++ L++A+ +G  + +++LL  +AD  +KD++G+ +  YA  +    C  L+
Sbjct:   20 ASVLSASYDVKEKDLGKVHKAAFSGDVVKLRQLAKKNDLNQLDKENRTALHIACACGHTDVVQYLVE--SKVKLNLCDNQNRSALMKAVQCEQDRSVSLLLEHEADPNLVDINGNTALHLSARIPSLPVALQLLEHSANIDAQNKDGNTPLMLALMENHADMTELLLKEGADVNVKNQEQRSALMIAACNGQISMVRLLLQYDADITVKDDKGWSSDDYAVMNGHHACSHLI 249          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-272n13.3 (si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104-216])

HSP 1 Score: 104.375 bits (259), Expect = 1.174e-23
Identity = 69/232 (29.74%), Postives = 125/232 (53.88%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A++  + Y V EK L    KA +  D+ K+++L KK+  N +D+E R+A H+A A GH ++++ L+   S   L   D   ++ L KAV+     +V  + E  A  N+ D  G++ +H + R     +   LLE   N +  N D NTPL +A   +  +  +LL+    DV+ +N+  ++ L++A+ +G  + +++LL  +AD  +KD++G+ +  YA  +    C  L+
Sbjct:   20 ASVLSASYDVKEKDLGKVHKAAFSGDVVKLRQLAKKNDLNQLDKENRTALHIACACGHTDVVQYLVE--SKVKLNLCDNQNRSALMKAVQCEQDRSVSLLLEHEADPNLVDINGNTALHLSARIPSLPVALQLLEHSANIDAQNKDGNTPLMLALMENHADMTELLLKEGADVNVKNQEQRSALMIAACNGQISMVRLLLQYDADITVKDDKGWSSDDYAVMNGHHACSHLI 249          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankdd1a (ankyrin repeat and death domain containing 1A [Source:ZFIN;Acc:ZDB-GENE-070615-8])

HSP 1 Score: 93.9745 bits (232), Expect = 2.815e-19
Identity = 60/217 (27.65%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSA--FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK 819
            ++  L A W   L+ +K L+        + K      H A+  GH+ I++ ++ +  N  L K + + KT    A E G LE V+++   G   N+KD  G++ +H A +  HS +LQ ++E   N ++ N D  T LH+A E    E ++LL+   C+V+      +T L L ++  + + +++L+    + D  D +   ALH A  +   E  K
Sbjct:   82 MNALLLAAWFGHLTILKILVSTGAKLTTENKNGLNLLHCAAQRGHITILEYIMEDLENVQLNKVENSGKTAFHLAAEHGHLEVVEFLIGMGCAHNLKDKHGNTALHLAAKQGHSDVLQKIMETGENIDERNIDGMTALHLASEGGHYECIRLLLEAGCNVNELTDSKRTALHLVAQHASASEVRLLIQAGINLDSVDTQHVSALHLAVLNNSTEIVK 298          

HSP 2 Score: 67.0106 bits (162), Expect = 9.906e-11
Identity = 51/225 (22.67%), Postives = 109/225 (48.44%), Query Frame = 1
Query:  241 SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLAS 915
            ++N  D+   +A HLA+  GH +++++++    N  +++ +++  T L  A E G  E ++ + E G   N   D   + +H   +H  +S ++ L++  +N +  +    + LH+A   +  E ++ L+   CD+D  +   +T L +A+E G  N  + +L +  + ++ D +G  +L  A+    +    ++ K  D   +     +P T      + KLAS
Sbjct:  174 AHNLKDKHGNTALHLAAKQGHSDVLQKIMETGEN--IDERNIDGMTALHLASEGGHYECIRLLLEAGCNVNELTDSKRTALHLVAQHASASEVRLLIQAGINLDSVDTQHVSALHLAVLNNSTEIVKDLIEAGCDLDIFDNRLQTALHIAAEHGRLNIAETILISGVNLNLLDKQGKSSLDVAARGNHVNVVDMIIKA-DRFYKWEKDHQPETQHIRSVLWKLAS 395          

HSP 3 Score: 65.4698 bits (158), Expect = 3.107e-10
Identity = 55/188 (29.26%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  274 AFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFE--KGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRI-ECKKLLQ 828
            A  LA+  GHL I+K L+S  +   L   + N    L  A ++G +  ++YI E  +  + N  ++ G +  H A  H H  +++FL+      N  +   NT LH+A +    + LQ +M    ++D +N  G T L LASE G+   I++LL    + +   +    ALH  + H    E + L+Q
Sbjct:   84 ALLLAAWFGHLTILKILVSTGAK--LTTENKNGLNLLHCAAQRGHITILEYIMEDLENVQLNKVENSGKTAFHLAAEHGHLEVVEFLIGMGCAHNLKDKHGNTALHLAAKQGHSDVLQKIMETGENIDERNIDGMTALHLASEGGHYECIRLLLEAGCNVNELTDSKRTALHLVAQHASASEVRLLIQ 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd1a (ankyrin repeat domain 1a (cardiac muscle) [Source:ZFIN;Acc:ZDB-GENE-100405-1])

HSP 1 Score: 90.5077 bits (223), Expect = 5.265e-19
Identity = 59/182 (32.42%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPL--ILASESGNENAI 717
            FLKAV  N L  V+K +      N  D  KRSA H ASA GH EI+++L+ + ++  +++ D    T +  A   G L  ++ +  KGAK N +D    + +H A+R  H    + L+    + N  + D +TP+H A  ++  + ++LLM Y   ++A+N  GKTP+  +L+ + G +N +
Sbjct:  120 FLKAVTENKLPVVEKYLVDGGDPNACDHFKRSALHKASAQGHTEIMQKLLESGAS--MDQKDKLDATAVHWACRGGSLPALELLLNKGAKFNSRDKLSSTPLHVAVRTGHYECAEHLIHCGADVNAKDRDGDTPMHDAVRINRFKMIRLLMMYGASLNAKNNDGKTPMETLLSWQKGVKNIL 299          

HSP 2 Score: 61.6178 bits (148), Expect = 2.574e-9
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  358 PDVNKKT---GLF-KAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            PD+  +T   GLF KAV +  L  V+     G   N  D    S +H A    H+ I+Q LLE   + +  +    T +H AC    +  L+LL+N     ++++KL  TPL +A  +G+    + L+   AD + KD +G   +H A    R +  +LL
Sbjct:  108 PDILPETVDQGLFLKAVTENKLPVVEKYLVDGGDPNACDHFKRSALHKASAQGHTEIMQKLLESGASMDQKDKLDATAVHWACRGGSLPALELLLNKGAKFNSRDKLSSTPLHVAVRTGHYECAEHLIHCGADVNAKDRDGDTPMHDAVRINRFKMIRLL 267          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd1a (ankyrin repeat domain 1a (cardiac muscle) [Source:ZFIN;Acc:ZDB-GENE-100405-1])

HSP 1 Score: 90.5077 bits (223), Expect = 5.265e-19
Identity = 59/182 (32.42%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPL--ILASESGNENAI 717
            FLKAV  N L  V+K +      N  D  KRSA H ASA GH EI+++L+ + ++  +++ D    T +  A   G L  ++ +  KGAK N +D    + +H A+R  H    + L+    + N  + D +TP+H A  ++  + ++LLM Y   ++A+N  GKTP+  +L+ + G +N +
Sbjct:  120 FLKAVTENKLPVVEKYLVDGGDPNACDHFKRSALHKASAQGHTEIMQKLLESGAS--MDQKDKLDATAVHWACRGGSLPALELLLNKGAKFNSRDKLSSTPLHVAVRTGHYECAEHLIHCGADVNAKDRDGDTPMHDAVRINRFKMIRLLMMYGASLNAKNNDGKTPMETLLSWQKGVKNIL 299          

HSP 2 Score: 61.6178 bits (148), Expect = 2.574e-9
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  358 PDVNKKT---GLF-KAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            PD+  +T   GLF KAV +  L  V+     G   N  D    S +H A    H+ I+Q LLE   + +  +    T +H AC    +  L+LL+N     ++++KL  TPL +A  +G+    + L+   AD + KD +G   +H A    R +  +LL
Sbjct:  108 PDILPETVDQGLFLKAVTENKLPVVEKYLVDGGDPNACDHFKRSALHKASAQGHTEIMQKLLESGASMDQKDKLDATAVHWACRGGSLPALELLLNKGAKFNSRDKLSSTPLHVAVRTGHYECAEHLIHCGADVNAKDRDGDTPMHDAVRINRFKMIRLL 267          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rai14 (retinoic acid induced 14 [Source:NCBI gene;Acc:100127689])

HSP 1 Score: 98.5969 bits (244), Expect = 5.264e-20
Identity = 59/207 (28.50%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKS---YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
             L+AV  N++ KV  L+ K       +D E ++AFHLA+A G++E ++ +++   +  +   D+   + L  AV    +E ++ + +     +  D+ G S +H A  +   + +Q L +++   N  + + NTPL VA     +E  + L+++  D++ ++  G+TPL+LA ES N N + +L+ N AD  + D  G  ALH++  
Sbjct:   19 LLQAVDHNEVDKVSSLLGKKGVVATKMDSEGKTAFHLAAAKGNVECLRVMLTQGID--VSAQDIAGHSALHLAVRNNHIECIKRLLQSKCPVDSTDNIGKSPMHYAAANGCVASVQILCDQKCPTNIKDQEGNTPLLVAVLHGHIEVCKYLLDHRADINVKDANGRTPLMLACESSNFNMVDMLVRNGADLRLSDALGHDALHFSKL 223          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: cpsf1 (cleavage and polyadenylation specific factor 1 [Source:Xenbase;Acc:XB-GENE-5881751])

HSP 1 Score: 93.5893 bits (231), Expect = 1.066e-19
Identity = 69/248 (27.82%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKK--SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVN-----------------------------------TPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A W  +   VK+L+++  + ++ D    ++ H A+A GHL  +K LI   +  LL   D +  T L  A   G     + + ++GA        G + +H A  + H+ I Q LL++ L+P  C  D N                                    PLH+A E   +E L  L++   DV+ +++LG+TPL +A+ +GN   +++LL  NA+ D +D  G  ALH A+    +   KLL
Sbjct:   42 AAWNGNTRLVKQLLQQGEAVDSRDGLGWTSLHCAAANGHLSTVKLLIQRGA--LLSCQDGSGCTPLHHAAHNGHTHLCELLLQRGANPGATTKGGLTPLHLAASNGHTLITQLLLKQNLDP--CVGDNNQWSPLHWATVSNHFHIIELMKEYGVPLDLEASGNLAPLHIAAETGRLEALGYLLDNRADVNVKDQLGRTPLAIAAGNGNLEVVRLLLEKNAEIDEQDKHGRTALHRAAGAGHLHVVKLL 285          

HSP 2 Score: 62.003 bits (149), Expect = 3.319e-9
Identity = 53/203 (26.11%), Postives = 86/203 (42.36%), Query Frame = 1
Query:  202 RNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYAS----FH 798
            R  L   + L +KS   V + K    HLA+  G+  ++K+L+     E ++  D    T L  A   G L  V+ + ++GA  + +D  G + +H A  + H+ + + LL++  NP                                  A  K G TPL LA+ +G+    Q+LL  N D  + DN  +  LH+A+    FH
Sbjct:   16 RQCLELSENLPEKSCPGVKEWK--TLHLAAWNGNTRLVKQLLQ--QGEAVDSRDGLGWTSLHCAAANGHLSTVKLLIQRGALLSCQDGSGCTPLHHAAHNGHTHLCELLLQRGANPG---------------------------------ATTKGGLTPLHLAASNGHTLITQLLLKQNLDPCVGDNNQWSPLHWATVSNHFH 181          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD29 (ankyrin repeat domain 29 [Source:NCBI gene;Acc:100496526])

HSP 1 Score: 86.2705 bits (212), Expect = 1.958e-17
Identity = 58/193 (30.05%), Postives = 99/193 (51.30%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVN-----KKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYAS---FHQRIE 810
            D    +A  +AS AGH + ++EL+       L+  D+N       T LF A ++G  + V+ +FE GA T      G + + AA ++ H+ +++ LL+   N +D   D  T L +A +  ++  ++LL+     V+   + G TPL +AS+ G+   +++LL   ADRD   N+G   L  A+   F + IE
Sbjct:   40 DSTGATALMVASYAGHFDCVRELV-------LQGADINIQRESGSTALFFAAQQGHNDIVKLLFEFGASTEFTTKDGGTALLAASQYGHTRVVETLLKNGANIHDQLYDGATALFLAAQGGYINVVRLLLTSGAKVNQPRQDGTTPLWIASQMGHNELVRVLLLRGADRDAARNDGTTPLFKAASKGFCEVIE 225          

HSP 2 Score: 59.3066 bits (142), Expect = 1.745e-8
Identity = 49/185 (26.49%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  205 NDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKD 759
            ND+ K+      S     ++  +A   AS  GH  +++ L+ N +N  +     +  T LF A + G +  V+ +   GAK N     G + +  A +  H+ +++ LL +  + +   ND  TPL  A    F E ++ L+ +S  +    K G T L  A   GN  ++ +LL   A+  IK+
Sbjct:   89 NDIVKLLFEFGASTEFTTKDGGTALLAASQYGHTRVVETLLKNGAN--IHDQLYDGATALFLAAQGGYINVVRLLLTSGAKVNQPRQDGTTPLWIASQMGHNELVRVLLLRGADRDAARNDGTTPLFKAASKGFCEVIEELLKFSPALGIL-KNGSTALHAAVLCGNVKSVALLLEAGANPMIKN 270          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 90.1225 bits (222), Expect = 1.987e-17
Identity = 64/221 (28.96%), Postives = 113/221 (51.13%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLIKKSYNTVDQEK--RSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNV----KDDKGDSLIHAAIRHKHSSILQFLLEKEL---------NPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSN-NADRDIKDNEGFKALHYAS 792
            +P + +V       V  L+ K  N   ++K  R+A H  +  GH E ++ L+ + +N LL   D   +T +  A   G +  +  + +     +V     D+ G + +H A  + H + ++ LLE+E+         +P  C     TPLH A   D +E LQLL++++  V+A +  GKTPL++A+E+G  +A+++L+S+  AD  ++D     ALH A 
Sbjct:  682 TPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLR--DCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHC---AVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLAC 897          

HSP 2 Score: 87.0409 bits (214), Expect = 1.996e-16
Identity = 58/188 (30.85%), Postives = 99/188 (52.66%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNEN-AIQILLSNNADRDIKDNEGFKALHYASFHQRI 807
            N  D+  R+A H A+ +GH+E++  L+S  +N  +   D   +  +  A   G +E V+ +   GA+   KD K  + +HAA      S++++LL+  ++ N+ N   NTPLHVAC       +  L++   +V+  N+ G TPL  A+ S +    +++L+ N AD +IK  +G   LH  + H R 
Sbjct:  161 NVSDRAGRTALHHAAFSGHVEMVSLLLSRGAN--INAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRF 346          

HSP 3 Score: 76.6406 bits (187), Expect = 3.001e-13
Identity = 58/219 (26.48%), Postives = 98/219 (44.75%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVN-----KKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIEC 813
            +P   A +      V +LI    + N V++   +  H A+A+ H  +  EL+      +    DVN      KT L      G     Q I + GA+ + +D  G++ +H A R+ H  ++  L+    + +        PLH+A    F +  + L++   D+D  +  G+T L  A+  GN   + +LLS  AD + KD  G   LHYA+ +   +C
Sbjct:  268 TPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELL------VCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQC 480          

HSP 4 Score: 69.3218 bits (168), Expect = 4.755e-11
Identity = 58/217 (26.73%), Postives = 100/217 (46.08%), Query Frame = 1
Query:  181 PFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            P ++A++  D  +V+ LI  K+  N  D EKR+  H A+  G  EII+ LI +                                   GA+ N KD K  + +H A+       +Q LL+   + N  + +  TPLH+A     ++  + L+    +V+  ++ G+T L  A+ SG+   + +LLS  A+ +  D +  +A+H+A++   IE  KLL
Sbjct:   38 PLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILS-----------------------------------GARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLL 219          

HSP 5 Score: 65.4698 bits (158), Expect = 8.460e-10
Identity = 65/261 (24.90%), Postives = 106/261 (40.61%), Query Frame = 1
Query:  220 VKKLIKKSYN--TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIH-AAIRHKHSSILQFLLEKELNPN----------------------------------------DCNNDVNT-----PLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKA-LHYASFHQRIECKKLLQKTEDAQPQV 855
             +KL+   ++  T D   R+  H A+A G+LE +  L+S  ++    K D   +T L  A      + +  +   GA  N  D++G S +H AA        L++LL  + NP                                         D  ND  T     PLH+A      + L++L+    D+D +N  G+TPL LA+  G+   + +L++  A   +KD    +  +H A+ +   EC +LL    D Q  V
Sbjct:  415 CRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGAD--FNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAV 673          

HSP 6 Score: 63.5438 bits (153), Expect = 2.767e-9
Identity = 63/216 (29.17%), Postives = 103/216 (47.69%), Query Frame = 1
Query:  256 DQEKR---SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGD-SLIHAAIRHKHSSILQFLL-----EKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTE---DAQPQVS 858
            D E R   S  HLA+  GH + ++ L+ +     L   DV   TG   L  A  KG +E V  +  +GA   VKD     + IH+A  + HS  L+ L+     +  ++ +D N    TPL ++      E +  L+N   +VDA++K G+T L   + +G+E  ++ LL +NA+  ++D  G   +H A+    I     L +T    D  P ++
Sbjct:  571 DAETRAPISPLHLAAYHGHHQALEVLVQS-----LLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNG--QTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIA 779          

HSP 7 Score: 63.1586 bits (152), Expect = 3.597e-9
Identity = 49/193 (25.39%), Postives = 89/193 (46.11%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNEN-AIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
            D+   +  H+A+  GH  +I  LI++ ++    K  ++    L  A   G  +  + +   G   +  DD G + +HAA    +   L  LL    + N  +    TPLH A      + L  L+     V+  ++ G +PL  A+ S  +   ++ LL N+A+  I+D  G+ A+HYA+ +    C +L+ +
Sbjct:  363 DKNGNTPLHIAARYGHELLINTLITSRADT--SKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIAR 553          

HSP 8 Score: 61.6178 bits (148), Expect = 1.187e-8
Identity = 55/233 (23.61%), Postives = 103/233 (44.21%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKK--SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKG---AKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRD----IKDNEGFKALHYASFHQRIECKKLLQKTEDAQ 846
            +SP   A +      ++ L++     +  +   R+   LA+  GH+E +  LI N    +L K  V K+T +  A   G  E ++ +       A  ++ D  G + +  ++ + H+  +  LL K  N +  +    T LH        E ++ L+ ++ +   ++  G+TP+ LA+  G+   +  LL      D    I DN G+  LH+A ++    C +LL + E  Q
Sbjct:  578 ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLI-NQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQ 809          

HSP 9 Score: 59.3066 bits (142), Expect = 6.179e-8
Identity = 64/234 (27.35%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  163 NEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAF-----HLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGL-FKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLE--KELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKT 834
            ++K  +P   A     +S +K L+      VD  + +A+     H+A   G   ++ ELI   +N       VN++  T L F A        ++ +   GA  N+K   G + +H    H   S  Q +++   E++  D N   NTPLH+A        +  L+    D   +   G  PL LA+ SG  +  + LLS+  D D  D+ G   LH A+    +EC  LL  T
Sbjct:  230 DKKSYTPLHAAASSGMISVIKYLLDLG---VDMNESNAYGNTPLHVACYNGQDVVVNELIDCGAN----VNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNG--NTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLST 454          

HSP 10 Score: 52.7582 bits (125), Expect = 6.704e-6
Identity = 61/259 (23.55%), Postives = 101/259 (39.00%), Query Frame = 1
Query:  163 NEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQE---KRSAFHLASAAGHLEIIKELISNYSNEL-LEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELN--PNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKL----GKTPLILASESGNENAI---------------------------------------QILLSNNADRDIKDNEGFKALHYAS 792
            N    +P   A ++  +  V  LI +  + + ++   KR+  H A+  GH E ++ LI N   +  ++  D N +T L  +V  G  E V  +  KGA  + KD  G + +H      H   ++ LL+   N    DC     TP+H+A     +  L  L+  +  VD    +    G TPL  A  +G++  +                                       Q+LLS+NA  +  D+ G   L  A+
Sbjct:  607 NSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRG--RTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAA 863          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD29 (ankyrin repeat domain 29 [Source:NCBI gene;Acc:100496526])

HSP 1 Score: 86.2705 bits (212), Expect = 2.105e-17
Identity = 58/193 (30.05%), Postives = 99/193 (51.30%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVN-----KKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYAS---FHQRIE 810
            D    +A  +AS AGH + ++EL+       L+  D+N       T LF A ++G  + V+ +FE GA T      G + + AA ++ H+ +++ LL+   N +D   D  T L +A +  ++  ++LL+     V+   + G TPL +AS+ G+   +++LL   ADRD   N+G   L  A+   F + IE
Sbjct:   41 DSTGATALMVASYAGHFDCVRELV-------LQGADINIQRESGSTALFFAAQQGHNDIVKLLFEFGASTEFTTKDGGTALLAASQYGHTRVVETLLKNGANIHDQLYDGATALFLAAQGGYINVVRLLLTSGAKVNQPRQDGTTPLWIASQMGHNELVRVLLLRGADRDAARNDGTTPLFKAASKGFCEVIE 226          

HSP 2 Score: 58.9214 bits (141), Expect = 2.052e-8
Identity = 49/185 (26.49%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  205 NDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKD 759
            ND+ K+      S     ++  +A   AS  GH  +++ L+ N +N  +     +  T LF A + G +  V+ +   GAK N     G + +  A +  H+ +++ LL +  + +   ND  TPL  A    F E ++ L+ +S  +    K G T L  A   GN  ++ +LL   A+  IK+
Sbjct:   90 NDIVKLLFEFGASTEFTTKDGGTALLAASQYGHTRVVETLLKNGAN--IHDQLYDGATALFLAAQGGYINVVRLLLTSGAKVNQPRQDGTTPLWIASQMGHNELVRVLLLRGADRDAARNDGTTPLFKAASKGFCEVIEELLKFSPALGIL-KNGSTALHAAVLCGNVKSVALLLEAGANPMIKN 271          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Rai14 (retinoic acid induced 14 [Source:MGI Symbol;Acc:MGI:1922896])

HSP 1 Score: 100.523 bits (249), Expect = 9.076e-21
Identity = 67/236 (28.39%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTL 882
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E +K ++++  +  +   D +  + L  A + G  E ++ + +  +     D+ G + +H A        +Q L E +   N  + D N PL VA +    E    L+++  DV++++K G+T L+LA E+G+ N +  L+   AD  + D+ G  ALHY+   +    + LL         +  P +P  L
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLKVMVTHGVD--VTAQDSSGHSALHVAAKNGHPECIRKLLQYKSPAENIDNSGKTALHYAAAQGCLQAVQLLCEHKSPINLKDLDGNIPLLVAVQNGHSEACHFLLDHGADVNSRDKNGRTALMLACETGSSNTVDALIKKGADLSLVDSLGHNALHYSKLSENAGIQNLLLSKISQDADLKTPTKPKQL 256          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Rai14 (retinoic acid induced 14 [Source:MGI Symbol;Acc:MGI:1922896])

HSP 1 Score: 100.138 bits (248), Expect = 1.342e-20
Identity = 66/233 (28.33%), Postives = 114/233 (48.93%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E +K ++++  +  +   D +  + L  A + G  E ++ + +  +     D+ G + +H A        +Q L E +   N  + D N PL VA +    E    L+++  DV++++K G+T L+LA E+G+ N +  L+   AD  + D+ G  ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLKVMVTHGVD--VTAQDSSGHSALHVAAKNGHPECIRKLLQYKSPAENIDNSGKTALHYAAAQGCLQAVQLLCEHKSPINLKDLDGNIPLLVAVQNGHSEACHFLLDHGADVNSRDKNGRTALMLACETGSSNTVDALIKKGADLSLVDSLGHNALHYSKLSENAGIQNLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Rai14 (retinoic acid induced 14 [Source:MGI Symbol;Acc:MGI:1922896])

HSP 1 Score: 100.138 bits (248), Expect = 1.342e-20
Identity = 66/233 (28.33%), Postives = 114/233 (48.93%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E +K ++++  +  +   D +  + L  A + G  E ++ + +  +     D+ G + +H A        +Q L E +   N  + D N PL VA +    E    L+++  DV++++K G+T L+LA E+G+ N +  L+   AD  + D+ G  ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLKVMVTHGVD--VTAQDSSGHSALHVAAKNGHPECIRKLLQYKSPAENIDNSGKTALHYAAAQGCLQAVQLLCEHKSPINLKDLDGNIPLLVAVQNGHSEACHFLLDHGADVNSRDKNGRTALMLACETGSSNTVDALIKKGADLSLVDSLGHNALHYSKLSENAGIQNLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Invs (inversin [Source:MGI Symbol;Acc:MGI:1335082])

HSP 1 Score: 93.5893 bits (231), Expect = 1.681e-18
Identity = 57/193 (29.53%), Postives = 95/193 (49.22%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            N  D+   +A H A+ +GH+  +K L+ N  +  ++  DV K T LF+A E G  + +Q + + GA+ ++ D  G SL+H A    ++ + Q L+E ++NPN                                  Q+  G+TPL  A+  G  N + +L+ NNAD +I+D EG  ALH++  +  ++  KLL
Sbjct:  351 NMSDKYGGTALHAAALSGHVSTVKLLLDN--DAQVDATDVMKHTPLFRACEMGHRDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPN---------------------------------VQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLL 508          

HSP 2 Score: 58.5362 bits (140), Expect = 7.286e-8
Identity = 57/250 (22.80%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNEL---------------------------------LEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFL--------LEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNY-SCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI-KDNEGFKALHYAS 792
            +P +  V  + +     L+K     N  D  +R+A HLA+  G+   +K L++  +N +                                 ++  D NK+T L  +      E+ + + +  +   + D +G   +H A  HK  S +  +         E  LN  D   +  TPLH A     +  + +L +Y SC++ + + L +TPL  A+  G+   + +LL  N    I  D++G   LHYA+
Sbjct:   50 TPLMYCVLADRVDCADALLKAGADVNKTDHSRRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLSTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHAKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQD--YEGRTPLHFAVADGNLTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAA 297          

HSP 3 Score: 56.9954 bits (136), Expect = 2.322e-7
Identity = 60/224 (26.79%), Postives = 100/224 (44.64%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGH-----LEIIKELISNYSNE-LLEKPDVNKKTGLFKAVEKGILENVQYI--FEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELN---PNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI--KDNEGFKALHYASFHQRIECKKLL 825
            + + N+    K LIK   N    +      L  AA H     +  ++ ++     E LL   D   +T L  AV  G L  V  +  +E    T+  D+   + +H A    H+ I+  LLE+  +   P+D      TPLH A + +F E +++ + +    D  +  G+T  + A+  GN++ ++ +LS  +D DI   D  G  ALH A+    +   KLL
Sbjct:  156 SAYYNNPEHAKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNLTVVDVLTSYESCNITSY-DNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQG--ATPLHYAAQSNFAETVKVFLQHPSVKDDSDLEGRTSFMWAAGKGNDDVLRTMLSLKSDIDINMSDKYGGTALHAAALSGHVSTVKLL 376          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd1 (ankyrin repeat domain 1 (cardiac muscle) [Source:MGI Symbol;Acc:MGI:1097717])

HSP 1 Score: 88.9669 bits (219), Expect = 2.635e-18
Identity = 61/192 (31.77%), Postives = 100/192 (52.08%), Query Frame = 1
Query:  145 PSPYSVNEKQLSP-FLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTP--LILASESGN 705
            P P  + E    P FLKA   N L  V+K +  K S +  D+ KR+A H A   GHL I+++L+   +   +E  D+ + T +  A   G  + ++ +  KGAK + +D    + +H A+R  H    + L+  E + N  + + +TPLH A  L+  + ++LLM +  D+  +N  GKTP  L+L  +SG 
Sbjct:  110 PEPEIMTEPVDVPRFLKAALENKLPVVEKFLSDKNSPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQ--IEFRDMLESTAIHWACRGGNADVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTFGADLKVKNCAGKTPMDLVLHWQSGT 299          

HSP 2 Score: 60.8474 bits (146), Expect = 4.350e-9
Identity = 42/140 (30.00%), Postives = 71/140 (50.71%), Query Frame = 1
Query:  358 PDVN---KKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEG 768
            PDV    K+T L +A  +G L  V+ + E GA+   +D    + IH A R  ++ +L+ LL K    +  +  ++T LHVA      E  + L+    D++A+++ G TPL  A        I++L++  AD  +K+  G
Sbjct:  146 PDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWACRGGNADVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTFGADLKVKNCAG 285          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9P0K7|RAI14_HUMAN (Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 3.442e-20
Identity = 66/233 (28.33%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E ++ +I++  +  +   D    + L  A +    E ++ + +        D  G + +H A        +Q L E +   N  + D N PL +A +    E    L+++  DV+++NK G+T L+LA E G+ NA++ L+   AD ++ D+ G+ ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLRVMITHGVD--VTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EP71|RAI14_MOUSE (Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.384e-20
Identity = 66/233 (28.33%), Postives = 114/233 (48.93%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRP 873
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E +K ++++  +  +   D +  + L  A + G  E ++ + +  +     D+ G + +H A        +Q L E +   N  + D N PL VA +    E    L+++  DV++++K G+T L+LA E+G+ N +  L+   AD  + D+ G  ALHY+   +    + LL         +  P +P
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLKVMVTHGVD--VTAQDSSGHSALHVAAKNGHPECIRKLLQYKSPAENIDNSGKTALHYAAAQGCLQAVQLLCEHKSPINLKDLDGNIPLLVAVQNGHSEACHFLLDHGADVNSRDKNGRTALMLACETGSSNTVDALIKKGADLSLVDSLGHNALHYSKLSENAGIQNLLLSKISQDADLKTPTKP 253          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5U312|RAI14_RAT (Ankycorbin OS=Rattus norvegicus OX=10116 GN=Rai14 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 3.687e-19
Identity = 63/217 (29.03%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKK---SYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             L+AV   D  KV  L+ K   S    D E ++AFHLA+A GH+E +K ++++  +  +   D +  + L  A + G  E ++ + +  +     D+ G + +H A        +Q L E +   N  + D N PL VA +    E    L+++  DV++++K G+T L+LA E+G+ N ++ L+   AD ++ D+ G  AL+Y+   +    + LL
Sbjct:   23 LLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLKVMVTHGVD--VTAQDSSGHSALHIAAKNGHPEYIKKLLQYKSPAESVDNLGKTALHYAAAQGSLQAVQVLCEHKSPINLKDLDGNIPLLVAIQNGHSEACHFLLDHGADVNSRDKNGRTALMLACETGSANTVEALIKKGADLNLVDSLGHNALYYSKLSENAGIQSLL 237          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y283|INVS_HUMAN (Inversin OS=Homo sapiens OX=9606 GN=INVS PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 2.536e-18
Identity = 60/195 (30.77%), Postives = 104/195 (53.33%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDN--EGFKALHYASFHQRIECKKLL 825
            N  D+   +A H A+ +GH+  +K L+ N  N  ++  DV K T LF+A E G  + +Q + + GA+ ++ D  G SL+H A    ++ + Q L+E ++NPN  +    TPL  A    ++  + +LM  + D + Q+K G+T L  +  +G  +AI++LL   A  +  +N  E +  L YA   +R E  + +
Sbjct:  351 NMADKYGGTALHAAALSGHVSTVKLLLEN--NAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFM 543          

HSP 2 Score: 68.5514 bits (166), Expect = 5.153e-10
Identity = 55/225 (24.44%), Postives = 96/225 (42.67%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIF--EKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVD---------------------------------AQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            D +  +  H A+ +   E +K  + + S  + +  D+  +T    A  KG  + ++ +   +     N+ D  G + +HAA    H S ++ LLE     +  +   +TPL  ACE+   + +Q L+     VD                                  Q+  G+TPL  A+  G  N + +L+ NNAD +I+D EG  ALH++  +  ++  KLL
Sbjct:  286 DSQGATPLHYAAQSNFAETVKVFLKHPS--VKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLL 508          

HSP 3 Score: 60.4622 bits (145), Expect = 1.483e-7
Identity = 59/250 (23.60%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNEL---------------------------------LEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFL--------LEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNY-SCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI-KDNEGFKALHYAS 792
            +P +  V  + L     L+K     N  D  +R+A HLA+  G+   +K L++  +N +                                 ++  D NK+T L  +      E+V+ + +  +   + D +G   +H A  HK  S +  +         E  LN  D      TPLH A     +  + +L +Y SC++ + + L +TPL  A+  G+   + +LL  N    I  D++G   LHYA+
Sbjct:   50 TPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLTTRHRSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEG--RTPLHFAVADGNVTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAA 297          

HSP 4 Score: 55.4546 bits (132), Expect = 5.135e-6
Identity = 59/224 (26.34%), Postives = 101/224 (45.09%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGH-----LEIIKELISNYSNE-LLEKPDVNKKTGLFKAVEKGILENVQYI--FEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELN---PNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI--KDNEGFKALHYASFHQRIECKKLL 825
            + + N+   VK LIK   N    +      L  AA H     +  ++ ++     E LL   D   +T L  AV  G +  V  +  +E    T+  D+   + +H A    H+ I+  LLE+  +   P+D      TPLH A + +F E +++ + +    D  +  G+T  + A+  G+++ ++ +LS  +D DI   D  G  ALH A+    +   KLL
Sbjct:  156 SAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTSYESCNITSY-DNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQG--ATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLL 376          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6JAN1|INVS_CANLF (Inversin OS=Canis lupus familiaris OX=9615 GN=INVS PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.787e-18
Identity = 60/195 (30.77%), Postives = 104/195 (53.33%), Query Frame = 1
Query:  247 NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDN--EGFKALHYASFHQRIECKKLL 825
            N  D+   +A H A+ +GH+  +K L+ N  N  ++  DV K T LF+A E G  + +Q + + GA+ ++ D  G SL+H A    ++ + Q L+E ++NPN  +    TPL  A    ++  + +LM  + D + Q+K G+T L  +  +G  +AI++LL   A  +  +N  E +  L YA   +R E  + +
Sbjct:  351 NMADKYGGTALHAAALSGHVSTVKLLLEN--NAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLLLDFAAFPNQMENNEERYTPLDYALLGERHEVIQFM 543          

HSP 2 Score: 68.1662 bits (165), Expect = 5.735e-10
Identity = 55/225 (24.44%), Postives = 96/225 (42.67%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIF--EKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVD---------------------------------AQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            D +  +  H A+ +   E +K  + + S  + +  D+  +T    A  KG  + ++ +   +     N+ D  G + +HAA    H S ++ LLE     +  +   +TPL  ACE+   + +Q L+     VD                                  Q+  G+TPL  A+  G  N + +L+ NNAD +I+D EG  ALH++  +  ++  KLL
Sbjct:  286 DSQGATPLHYAAQSNFAETVKVFLKHPS--VKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLLLENNAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLVDQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENNADPNIQDKEGRTALHWSCNNGYLDAIKLL 508          

HSP 3 Score: 55.0694 bits (131), Expect = 6.054e-6
Identity = 59/224 (26.34%), Postives = 101/224 (45.09%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGH-----LEIIKELISNYSNE-LLEKPDVNKKTGLFKAVEKGILENVQYI--FEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELN---PNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI--KDNEGFKALHYASFHQRIECKKLL 825
            + + N+   VK LIK   N    +      L  AA H     +  ++ ++     E LL   D   +T L  AV  G +  V  +  +E    T+  D+   + +H A    H+ I+  LLE+  +   P+D      TPLH A + +F E +++ + +    D  +  G+T  + A+  G+++ ++ +LS  +D DI   D  G  ALH A+    +   KLL
Sbjct:  156 SAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVLTSYESCNITSY-DNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQG--ATPLHYAAQSNFAETVKVFLKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGTALHAAALSGHVSTVKLL 376          

HSP 4 Score: 55.0694 bits (131), Expect = 6.209e-6
Identity = 52/203 (25.62%), Postives = 94/203 (46.31%), Query Frame = 1
Query:  220 VKKLIKKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFL--------LEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNY-SCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI-KDNEGFKALHYAS 792
            +K L+ +  N +  D E+ +  HLA+     + +  L+   +   ++  D NK+T L  +      E+V+ + +  +   + D +G   +H A  HK  S +  +         E  LN  D   +  TPLH A     +  + +L +Y SC++ + + L +TPL  A+  G+   + +LL  N    I  D++G   LHYA+
Sbjct:   97 MKLLLTRRANWMQKDLEEMTPLHLATRHKSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQD--YEGRTPLHFAVADGNVTVVDVLTSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAA 297          

HSP 5 Score: 54.6842 bits (130), Expect = 8.419e-6
Identity = 50/195 (25.64%), Postives = 88/195 (45.13%), Query Frame = 1
Query:  271 SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSC--DVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQP 849
            S  H A+  G    +  LI   S  L +K D   +T L   V    L+    + + GA  N  D    + +H A +  +   ++ LL +  N    + +  TPLH+A      + L LL+ +    +VD Q+K  +T L  ++   N   +++L+ ++++  I D EG   LH+A+ H+       ++   DA P
Sbjct:   16 SQVHAAAINGDKGALHRLIIGNS-ALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEMTPLHLATRHKSPKCLALLLKFMAPGEVDTQDKNKQTALHWSAYYNNPEHVKLLIKHDSNIGIPDVEGKIPLHWAANHKDPSAVHTVRCILDAAP 209          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210PYH6 (Ankyrin repeat domain-containing protein 26 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11877 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.047e-29
Identity = 84/236 (35.59%), Postives = 129/236 (54.66%), Query Frame = 1
Query:  133 ATIYPSP---YSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQ-LLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQ 828
            A   P P   Y V EK L    KA W  D++KVK+ +KK  +  D+E R+A HLA A GH  +++EL+  ++   +   D + KT L KAVE    E V  + E     +  D  GD+ +H A+R+ +++I++ LL      +  N +  TPLH+AC+    E ++ LL +    VD  +  G+TPL+LAS  G+  A+Q+LL  NA+  IKD +GF A   A    +  C +L++
Sbjct:   26 AGAQPIPELGYDVREKDLPKLHKAAWTGDIAKVKQYVKKDSSAPDKENRTALHLACAQGHSGVVQELLEWHAKTNI--GDNDTKTPLIKAVECNREECVMLLLEHRGDVDATDRDGDTSLHIAVRNGYTNIVKVLLRNGGTIDKKNKEGCTPLHIACKGKKPEIIRILLFDSKASVDVSDINGRTPLMLASYEGSVTAVQLLLQCNANTMIKDTKGFTAEDIAMMTAQHGCSQLIR 259          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A5K3FAJ0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 5.785e-27
Identity = 81/236 (34.32%), Postives = 127/236 (53.81%), Query Frame = 1
Query:  154 YSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELIS-NYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVS 858
            Y V EK+LS   KAVW  DL  V++L+ K     D+E R+  HLA A G   I + L+  N    LL   D N +T L KA++ G  E V  +    A   V+D  G+S IH A+++   +IL+ LL   ++ N  N D  TP+H++ +   +  L+ L+    +VD  ++ G+T L++A ESGN    ++L+S  A+ D+ DN G  A   A   ++ +C +LL    D+  +V+
Sbjct:   36 YDVKEKELSKLQKAVWAGDLEAVQRLVMKEPMIPDKELRTPLHLACAKGDENITQCLLEFNAKVNLL---DQNNQTPLMKAIKGGHFECVDLLLNYRADLTVRDKYGNSPIHQAVKYGRQNILELLLRNGVDINTHNEDGMTPIHLSTKKQDIAMLRFLIQEGAEVDCTDENGRTALMIACESGNAEIAELLISCGANIDLCDNNGQTAEEIAKSSEQTQCYQLLHSLRDSVGRVT 268          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A556THS3 (Ankyrin repeat domain-containing protein 26 OS=Bagarius yarrelli OX=175774 GN=Baya_0262 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.398e-25
Identity = 85/262 (32.44%), Postives = 138/262 (52.67%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLAS 915
            A++    Y + EK LS   KA +  D++K+K L KKS  N +D+E R+A H+A   GH  +++ L+ N     L   D   ++ L KAV+      V ++ E  A  N+ D  G++ +H A+R     +   LLE   N N  N D NTPL ++ E + +E  + L+    DV+ QN+  +TPL++A+ +G  + +++LL  NAD  +KDN+G+ +  YA  +    C  L+ +           KR  +L++P  IAK  S
Sbjct:   21 ASVLSVGYDLKEKDLSKVHKAAFTGDVAKIKHLAKKSDLNQLDKENRTALHIACVYGHTHVVQYLVENKVK--LNLCDNQNRSALMKAVQCQQDHCVSFLLEHEADPNLVDINGNTSLHLAVRIPSLPVAMKLLEHNANINAQNKDGNTPLILSVEENHLEMAEFLLKEGADVNLQNQEQRTPLLIAACNGQISMVRLLLQFNADITVKDNKGWSSDDYAVMNGHHACSHLINE--------HGAKR-KSLQSPSHIAKQTS 271          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: E3TF17 (Ankyrin repeat domain-containing protein 7 OS=Ictalurus punctatus OX=7998 GN=ANKR7 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.121e-24
Identity = 75/232 (32.33%), Postives = 125/232 (53.88%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            A++    Y + E+ L    KA +  D++K+K+L KK+  N +D+E R+A H+A   GH E+++ L+ N     L   D   ++ L KAV+      V  + E  A  N+ D  G++ +H A R     +   LLE E N N  N + NTPL ++ E +  E  + L+    DV+ QN+  +TPL++A+ +G  + +++LL  NAD  +KDN+G+ +  YA  +    C  L+
Sbjct:   21 ASVLSVGYDLKERDLGKVHKAAFTGDVAKLKQLTKKNDLNQLDKENRTALHIACVHGHTEVVQYLVENKVK--LNLCDNQNRSALMKAVQCQQDRCVSILLEHEADPNLVDINGNTALHLAARIPSLPVALNLLEHEANINAQNKEGNTPLILSVEENHAEMAEFLLKEGADVNLQNQECRTPLLIAACNGQISMVRLLLQYNADIAVKDNKGWSSDDYAVMNGHHACSHLI 250          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A401S808 (ANK_REP_REGION domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0004940 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 2.708e-24
Identity = 86/285 (30.18%), Postives = 152/285 (53.33%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPP-------TLEAPEFIAKLASDNQKSQKSANHK-RTS 960
            A++  + Y + EK L    KA    DL+K+++LIKK+  N +D+E R+  HLA A+GH+E +  L+ + S   L   D + ++ L KAV+         + +  A  N+ D  G++ +H A    + S++  L+E+E + N  N D NTPL +A   +  E ++LL+    DV+A++K G+T L++A+ +G  + +++LL  NAD  +K+++G+ A  +A  +    C  L+ + +  +  +  P   P         EA   +   A+D  + Q+S   K RTS
Sbjct:   22 ASVASAGYELREKDLGKLHKAASTGDLTKLRQLIKKNDVNQLDKENRAPLHLACASGHVEAVTFLVEHKSK--LNICDNDNRSPLMKAVQCQQERCAIILLDHNADPNLVDINGNTALHLAALIPNISLVMHLIEREAHMNARNKDGNTPLLLAAIENHQEIVELLLKEGADVNAKDKTGRTALMIAASNGQISLVKLLLHYNADVSLKEDKGWTAEDHAMMNGHHACSHLISEHDTRKKLLQSPYYGPNKVKGNHAAEAGFALGGPATDKDEFQESPEQKWRTS 304          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-272n13.3 (si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104-216])

HSP 1 Score: 115.546 bits (288), Expect = 5.651e-26
Identity = 74/232 (31.90%), Postives = 125/232 (53.88%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             ++    Y + EK L    KA +  D+SK+++L KK+  N +D+E R+A H+A   GH E+++ L+   S   L   D   ++ L KAV+      V  + E  A  N+ D  G++ +H A R    S+   LLE E N N  N + NTPL ++ E +  E  +LL+    DV+ +N+  ++ L++A+ SG  + +++LL  NAD  +KD++G+ +  YA  +    C  L+
Sbjct:   21 GSVLSVGYDLKEKDLGKVHKAAFTGDVSKLRQLAKKNDLNQLDKENRTALHVACVHGHTEVVQFLVE--SKVKLNLCDNQNRSALMKAVQCQQDRCVSILLEHEADPNLVDINGNTALHLAARIPSLSVALQLLEHEANINAQNKEGNTPLALSVEENHTEMAELLLKEGADVNVKNQEQRSSLMIAACSGQISMVRLLLQYNADITVKDDKGWSSDDYAVMNGHHACSHLI 250          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-272n13.3 (si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104-216])

HSP 1 Score: 115.161 bits (287), Expect = 6.173e-26
Identity = 74/232 (31.90%), Postives = 125/232 (53.88%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             ++    Y + EK L    KA +  D+SK+++L KK+  N +D+E R+A H+A   GH E+++ L+   S   L   D   ++ L KAV+      V  + E  A  N+ D  G++ +H A R    S+   LLE E N N  N + NTPL ++ E +  E  +LL+    DV+ +N+  ++ L++A+ SG  + +++LL  NAD  +KD++G+ +  YA  +    C  L+
Sbjct:   21 GSVLSVGYDLKEKDLGKVHKAAFTGDVSKLRQLAKKNDLNQLDKENRTALHVACVHGHTEVVQFLVE--SKVKLNLCDNQNRSALMKAVQCQQDRCVSILLEHEADPNLVDINGNTALHLAARIPSLSVALQLLEHEANINAQNKEGNTPLALSVEENHTEMAELLLKEGADVNVKNQEQRSSLMIAACSGQISMVRLLLQYNADITVKDDKGWSSDDYAVMNGHHACSHLI 250          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 96.6709 bits (239), Expect = 1.700e-19
Identity = 54/181 (29.83%), Postives = 97/181 (53.59%), Query Frame = 1
Query:  283 LASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +A+  G+++II  L+   +   ++  D +    ++ A   G +E ++Y+ EK    +V+D  G++ +H A R+ +  ++Q+L     NP+  + +  TPLH A    +    + L    CDV+A+N+ G++PL+ AS  G  + ++ LL + AD D  D +G  ALH A    +IE  K L
Sbjct:  383 IAAGCGNVQIIDVLMRKGAE--IQALDKSGANAIYYASRHGHVETLKYLHEKKCPLDVQDKSGETALHVAARYGNVDVVQYLCSIHANPDLTDREQETPLHCAAWHGYSPVARALCEAGCDVNARNREGESPLLTASARGFRDIVECLLEHGADMDSTDKDGHIALHLAVRRCQIEVVKCL 561          

HSP 2 Score: 77.411 bits (189), Expect = 1.234e-13
Identity = 53/190 (27.89%), Postives = 99/190 (52.11%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            D+   +A H+A+  G++++++ L S ++N  L   D  ++T L  A   G     + + E G   N ++ +G+S +  A       I++ LLE   + +  + D +  LH+A     +E ++ L+++ C VD Q++ G TPL +A + GN   I +L +  A+ DI +  G  ALH A+ +  +E  + L
Sbjct:  440 DKSGETALHVAARYGNVDVVQYLCSIHANPDLT--DREQETPLHCAAWHGYSPVARALCEAGCDVNARNREGESPLLTASARGFRDIVECLLEHGADMDSTDKDGHIALHLAVRRCQIEVVKCLLSHHCYVDHQDRHGNTPLHIACKDGNLPVISLLSTAKANLDIPNKFGRTALHVAASNGGVEVVRHL 627          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 88.1965 bits (217), Expect = 9.571e-19
Identity = 62/170 (36.47%), Postives = 87/170 (51.18%), Query Frame = 1
Query:  322 LISNYSNELLEKPDVNK--KTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +I NYS    E P  N   +T L  A   G    VQ++ + GA+ ++KDD   + +H A       I++ L+ K    N  N +  TPLH A   +  E   LL+    D +A +KL  TPL  AS  GN   IQ+LL  +A  +I+D+EG  ALH A   +R+E  KLL
Sbjct:   40 VILNYS----ELPPFNSDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLL 205          

HSP 2 Score: 62.003 bits (149), Expect = 6.104e-10
Identity = 44/145 (30.34%), Postives = 74/145 (51.03%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILA 690
            D    +  H+A++AG  EI++ LIS  +   L   + N  T L  A  K   E    + E GA  N  D    + +H A    +  ++Q LL++  + N  +++ NT LH+AC+ + +E  +LL+ +   +  +NK  KTPL +A
Sbjct:   84 DDASWTPLHIAASAGREEIVRSLISKGAQ--LNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIA 226          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 87.0409 bits (214), Expect = 1.489e-18
Identity = 56/157 (35.67%), Postives = 82/157 (52.23%), Query Frame = 1
Query:  355 KPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            + D + +T L  A   G    VQ++ + GA+ ++KDD   + +H A       I++ L+ K    N  N +  TPLH A   +  E   LL+    D +A +KL  TPL  AS  GN   IQ+LL  +A  +I+D+EG  ALH A   +R+E  KLL
Sbjct:   35 RTDQDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLL 191          

HSP 2 Score: 61.6178 bits (148), Expect = 7.991e-10
Identity = 43/138 (31.16%), Postives = 72/138 (52.17%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILA 690
             H+A++AG  EI++ LIS  +   L   + N  T L  A  K   E    + E GA  N  D    + +H A    +  ++Q LL++  + N  +++ NT LH+AC+ + +E  +LL+ +   +  +NK  KTPL +A
Sbjct:   77 LHIAASAGREEIVRSLISKGAQ--LNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIA 212          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 1.784e-16
Identity = 62/234 (26.50%), Postives = 109/234 (46.58%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLIKKSYNTVDQE---KRSAFHLASAAGHLEIIKELISNY-SNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLL----MNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDI---KDNEGFKALHYASFHQRIECKKLLQKTEDAQ 846
            +P   A  R     V+ LI+   + + +E   +R+A H A+  GH+E ++ L+ N  SNE ++  D N++T +  AV  G  +    +  KGA  N KD+KG + +H      H   +  LL++ ++ +        PLH+A     M  L  L    M     +   ++ G TPL  A  +G++  +++LL    + D+   ++   F  LH A  +    C ++L  T  A+
Sbjct:  618 TPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLL----ELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAK 847          

HSP 2 Score: 77.7962 bits (190), Expect = 1.539e-14
Identity = 64/239 (26.78%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLI--KKSYNTVDQEKRSAFHLASAAGHLEIIKELI--------------------------SNYSNELLEKPDVNKK-----TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            +P ++A++  D  +V+ LI  K+  N VD EKR+  H A+  G  EII+ L+                          +     L    DVN +     T L  A     ++  + I    + +NV D  G + +H A  + HS ++ FL+ K  N N  +      +H A  +   E +++L+ +  DV  ++K G +PL  AS SG    +++LL    D D  ++ G  ALH A +
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACY 246          

HSP 3 Score: 67.0106 bits (162), Expect = 3.566e-11
Identity = 56/202 (27.72%), Postives = 102/202 (50.50%), Query Frame = 1
Query:  220 VKKLIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELI--SNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSL--IHAAIRHKHSSILQFLLE----KELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILL-SNNADRDIKDNEGFKALHYAS 792
            V  L+++S +   +E+R  +  H+A+A GH+ I+  L+  +  S   +   D N  T L  A   G    V+ + E       +  +G++   +H A+ + + S  + L++    K +N  D    +  PLH A   D +E LQLL++++  V+  +  GK+PL++A E+G   A+++L+ S   D  ++D     ALH A 
Sbjct:  735 VDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDV---FQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRM--PLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLAC 931          

HSP 4 Score: 64.3142 bits (155), Expect = 2.276e-10
Identity = 55/219 (25.11%), Postives = 102/219 (46.58%), Query Frame = 1
Query:  193 AVWRNDLSKVKKLIKKSYNTVDQEKR--SAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSI-LQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE-CKKLLQKTE 837
            A +      VK L+    +   ++K+  S  H AS++G + ++K L+    +  ++ P+    T L  A   G    V  + + GA  N  +++G + +H A    H ++ L+ L+    + N  + D  +PLH+          Q L+    ++D +++ G TPL +A+  G+E  I  L++N AD   +   G   LH A+     + C+KLL   +
Sbjct:  178 AAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVD--IDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQ 394          

HSP 5 Score: 61.2326 bits (147), Expect = 1.840e-9
Identity = 41/152 (26.97%), Postives = 78/152 (51.32%), Query Frame = 1
Query:  418 VQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNT-----PLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFK-ALHYASFHQRIECKKLLQKTEDAQPQV 855
            ++++  K A   ++D +G + +H A  + H   L+ LLE+   P    +D  +     PLH+A        L++L+    D+D +   G TPL LA+  G+ + +++L+ + A   +K+    + ALH A+ +  +EC +LL +  D+   V
Sbjct:  531 LEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQ---PGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAV 679          

HSP 6 Score: 59.6918 bits (143), Expect = 5.210e-9
Identity = 57/224 (25.45%), Postives = 95/224 (42.41%), Query Frame = 1
Query:  220 VKKLIKKSYNTVDQEKRSAF---HLASAAGHLEIIKELISNYSNELLEKPDVN-----KKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMN----YSC--------------DVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIEC 813
            V +LI    N V+Q     F   H A+A+ H  +  EL+ N         DVN      K+ L      G     Q + + G + + +D  G++ +H A R+ H  ++  L+    +          PLH+A    F +  + L++    YS               ++D  ++ G+T L  A+  GN   + +LLS  AD + KD     ALHYA+ +  ++C
Sbjct:  253 VNELIDCGAN-VNQANERGFTPLHFAAASTHGALCLELLVN------NGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQC 469          

HSP 7 Score: 50.8322 bits (120), Expect = 2.523e-6
Identity = 53/199 (26.63%), Postives = 84/199 (42.21%), Query Frame = 1
Query:  322 LISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLL---EKELNPNDCNNDVNTPLHVACELD---FMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFK-ALHYASFHQRIECKKL-----LQKTEDAQPQVSPPKRPPTL 882
            LI  +  +++  PD   +  L  A     +E +Q +    A  NV D  G S +  A  +  ++ ++ L+   + +L   D N   NT LH+AC          +   ++    ++A N   +TPL LA+ SG    +Q+LL+  A     D+ G+  AL  A      EC  L     L  + DA P  S     P L
Sbjct:  840 LIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANR--NTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCAPNKSVAECLSLILGAMLPLSPDAVPSASSLHSSPVL 1036          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 2.200e-15
Identity = 65/231 (28.14%), Postives = 101/231 (43.72%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIK--KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKK-LLQKTEDAQPQVS 858
             +P   A  +N +  ++ L+K   S +T  +   +  H+AS  GHL +++ L+ N ++      +V  +T L  A   G LE V+ + + GA+  VK                                   +  TPLH+A  L   E +QLL+    D +A    G TPL  AS  G+ +   +LL N AD      +GF  LH AS + R+E    LL+K   A P+V+
Sbjct:  371 FTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS--NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKA---------------------------------REDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVA 566          

HSP 2 Score: 79.337 bits (194), Expect = 5.025e-15
Identity = 69/274 (25.18%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLIKKSY--NTVDQEKRSAFHLASAAGHLEIIKELISN---------------YSNELLEKPDV----------------NKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKE------------------------LNPNDCNNDVN-----TPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYA--SFHQRI 807
            + FL+A    +L ++   +K     NT +Q   +A HLAS  GH++++ EL+                 +   L  + D+                N  T L+ A ++  LE V+++ + GA  +V  + G + +  A++  H  ++  LLE +                        L  ++ N DV      TPLH+A     M    LL+N    VD   + G TPL +A++ GN N +++LL   A  D K  +G   LH A  S H+++
Sbjct:   13 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKV 286          

HSP 3 Score: 72.4034 bits (176), Expect = 6.306e-13
Identity = 63/223 (28.25%), Postives = 110/223 (49.33%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSL--IHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE-CKKLLQ 828
            ++P   A  R + + VK L+ +    +T  ++  +  H A+ +GH ++I E++      +L K   N  + L  A +   L  VQ +   G +  V D   D L  +H A    H  + + LL++   PN    +  TPLH+AC+ + ++ ++LL+ +   +    + G TP+ +AS  G+ N +Q+LL N A  +  +  G   LH AS   ++E  K LLQ
Sbjct:  239 ITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVI-EMLLERDAPILAKTK-NGLSPLHMATQGEHLACVQLLL--GRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQ 457          

HSP 4 Score: 65.4698 bits (158), Expect = 9.415e-11
Identity = 49/189 (25.93%), Postives = 90/189 (47.62%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKK--TGLFKAVEKGILENVQYIFEKGAKTN--VKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQK 831
             + AS  GH ++   L+ N +    +   V KK  T L  A + G LE    + EK A  +  V    G + +H A  + H  +   LL+K  +P+    +  TPLH+A + + +E  ++L+    + +   + G  PL LA++ G+ + + +LL  +A   +    G  A+H A+   ++   ++L K
Sbjct:  506 LYFASREGHGDVASLLLENGA----DISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTK 690          

HSP 5 Score: 65.0846 bits (157), Expect = 1.246e-10
Identity = 58/219 (26.48%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  160 VNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVD-----QEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYAS 792
            V +K  +P   A     L +V  L+ + Y + D     Q   +  H+A+   H ++   L+   ++     P    K G   L  A +K  LE  + + E GA+TN+   +G + +H A +  H+ ++  LL +  + +       T +H+A + D +   ++L  +  DV+   KL  TPL +AS  GN   +  LL N A  + K   G+  LH A+
Sbjct:  531 VTKKGFTPLHIASKYGRL-EVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGAS-----PHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAA 743          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005495.1 (pep scaffold:Pmarinus_7.0:GL476878:391902:403130:-1 gene:ENSPMAG00000004993.1 transcript:ENSPMAT00000005495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 4.920e-15
Identity = 76/259 (29.34%), Postives = 127/259 (49.03%), Query Frame = 1
Query:  148 SPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKS-YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIH--AAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL--QKTEDAQPQVS--PPKRPPTLEAPEFIA 903
            S Y + +K L    KA    DL K+K+L+KK   N +D++ R+  HLA A GH +++  L+ N   +L    D + ++ L K+V + +   V  +          D +    +H    I   H S  +  ++   N    N D NTPL +A     +  ++LL+ +  +VD++N+  +TPL++A+ +G    +++LL + AD   KD++G+ A  +A  H    C  L+  Q    AQ Q+S     R P L  PE  A
Sbjct:   26 SRYELKDKDLGKLHKAAASGDLEKLKRLLKKGDVNQLDKQNRTPLHLACANGHSDVVLFLLQNNFVKL-NLCDNDNRSPLMKSVHQCMYGRVSILISHLFCPICPDHRTLKFLHYKPPIPKNHISFKK--IKHASNREAENKDGNTPLLLAMSSGDLTMVELLLRHGANVDSRNRARRTPLMIAASNGENEIVKLLLEHGADVSCKDDKGWSAEDHAVIHGHHACSHLIGEQGVRAAQSQLSVGSTGRGPVL--PELGA 279          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009528.1 (pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 gene:ENSPMAG00000008612.1 transcript:ENSPMAT00000009528.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 5.226e-15
Identity = 54/213 (25.35%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  259 QEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIR----------------------------------HKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            Q KR+  H A+  GH+E++  L+    N  ++  D ++KT L +A E   L + +Y+ + GA    KDD+G + +H A +                                  +KH  +++ LL +  +    +N+ N  LH A     ++  +  +N  CD+ A N  G TPL +AS   +   + +LL+  A+ D+++ EG   +  AS 
Sbjct:  563 QRKRTPMHGAAERGHVEVLHTLVQAGGN--IDACDQDQKTPLLQAAESNQLASTRYLVKAGAYVAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGGWTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGDTPLHIASRENHYECVVLLLARGANVDVRNKEGETPMECASV 773          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ankrd1a (ankyrin repeat domain 1a (cardiac muscle) [Source:ZFIN;Acc:ZDB-GENE-100405-1])

HSP 1 Score: 73.1738 bits (178), Expect = 9.324e-15
Identity = 51/181 (28.18%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYN--TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNEN 711
            ++ FLKA  R  +  V++ +++  +  + D   R+A H +S AGHLE++++LI   +   LE  D  K T +  A   G +  ++ + + GA     D    S +H A R    ++ +FL+E+  + N  + + +TPLH        +  QLL++    V A+N  GK+ + L     NE 
Sbjct:    3 VAEFLKAAARGKVEVVEEYLQQGGDPDSCDATHRTALHQSSQAGHLEVVQKLIDKGAQ--LENKDKLKSTAMHCASRGGHVAVLETLLDSGASIKATDSILSSPLHVAARVGQYNVAEFLIERGASVNAQDKEGDTPLHEVMRQALPKFAQLLISAGASVGAKNYAGKSAVDLLPPMNNET 181          

HSP 2 Score: 67.0106 bits (162), Expect = 1.458e-12
Identity = 47/168 (27.98%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKAL 780
            F  A+A G +E+++E +    +   +  D   +T L ++ + G LE VQ + +KGA+   KD    + +H A R  H ++L+ LL+   +    ++ +++PLHVA  +      + L+     V+AQ+K G TPL            Q+L+S  A    K+  G  A+
Sbjct:    6 FLKAAARGKVEVVEEYLQQGGDP--DSCDATHRTALHQSSQAGHLEVVQKLIDKGAQLENKDKLKSTAMHCASRGGHVAVLETLLDSGASIKATDSILSSPLHVAARVGQYNVAEFLIERGASVNAQDKEGDTPLHEVMRQALPKFAQLLISAGASVGAKNYAGKSAV 171          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 64.6994 bits (156), Expect = 1.104e-10
Identity = 37/124 (29.84%), Postives = 69/124 (55.65%), Query Frame = 1
Query:  466 KGDSLIHAAIRHKHSSILQFLLE-KELNPNDCNNDVN-TPLHVACELDFMEGLQLLMNYSCDVDAQNKL-GKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQ 828
            K  SL+H A    +  +L  LL  K  + N  +N+++ TPL++AC L+F E    L+    D++ + KL G T + +A+  G  + +++L++NNA+ DI+D  G+  + +A     +    ++Q
Sbjct:  503 KSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQ 626          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 63.5438 bits (153), Expect = 1.114e-10
Identity = 54/216 (25.00%), Postives = 98/216 (45.37%), Query Frame = 1
Query:  286 ASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTN--VKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNN---DVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNN---ADRDIKDNEGFKALHYA-SFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAK 906
            A   G+L I+K L+    + L      N  + L  A   G      Y+ + G   +  +K  KG++ +H A+   H   L  LL++   P   N+   +   P+H+AC  D+ + L LL+    D+   +  G TPL +  E G+ + +++LL+      D +++D   +K +  A +F       K+L++ +   P +   K+P +   P   AK
Sbjct:   12 AIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQF--PRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKEVKKKGPPLGAGKKPSSFRTPILNAK 225          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 59.3066 bits (142), Expect = 4.526e-9
Identity = 51/217 (23.50%), Postives = 91/217 (41.94%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYNTVD-----QEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTG------LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYAS 792
            L+ +  A  R DL+ VK++I      V+      E  +  H AS    L ++  L+S       +  DVN + G      L  A   G +  V ++ + GA   + DD+G +L+H ++   +  ++ ++L   ++                     +GL        D+D ++  G+T L+ A+  G+   +  LL   A   I D EGF  LH+ +
Sbjct:   74 LTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVS-------QGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVS---------------------KGL-------LDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGT 255          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 67.0106 bits (162), Expect = 1.957e-12
Identity = 44/175 (25.14%), Postives = 90/175 (51.43%), Query Frame = 1
Query:  220 VKKLIK---KSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSN-ELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLL-EKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILL 729
            V+KL++    + NT+D +  S  H A+   H++I++ L+   ++ ++   P + +   +  A +   +E+ + +   GA  N+ +  G + +H A R  HS +++ LL + +++ N  + D  T LHVA  +     ++ L+    ++ A++  G T   LA+  G E  +Q LL
Sbjct:   11 VRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 62.003 bits (149), Expect = 2.189e-10
Identity = 31/79 (39.24%), Postives = 45/79 (56.96%), Query Frame = 1
Query:  577 PLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIEC 813
            PLH+AC   F E  + L+ Y  DV+A++   +TPL  A+ SGN N +++L+S   D +  D  G   LHYA+ H    C
Sbjct:    3 PLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRC 81          

HSP 2 Score: 59.3066 bits (142), Expect = 1.928e-9
Identity = 49/196 (25.00%), Postives = 97/196 (49.49%), Query Frame = 1
Query:  178 SPFLKAVWRNDLSKVKKLIKKS--YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGI-LENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNND-----VNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
            +P   A    +++ ++ L+ ++  +N +D+  R+  H A+   +   +  L++  SN  + KPD    T L  A    +  + V+++       + +D +G S +H A  + H   ++ LL+  ++ ND  N        TPLH+A        L++L+    D++ ++  G+TPL LAS  G+   ++ LL++NA
Sbjct:   35 TPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSN--VNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLD--VSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO47820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL87])

HSP 1 Score: 65.0846 bits (157), Expect = 2.737e-10
Identity = 57/215 (26.51%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  223 KKLIKKSYNTVDQEKRSAFHLASAA--GHLEIIKELIS-------NYSNE------LLEKPDVNKKTGLFKAVEKGI------LENVQYIFEKGAKTNVKDDKGDSLIH--AAIRHKHSSILQFLLEKE--LNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYAS 792
            + LI    ++V+++  S+ HL  AA  G+++I+K L+S       N +N       LL   D+N    +F+ VE+ +      +E VQ +    A  ++   +G   +H  A  R  ++  +  LL KE   NP+  +    +P+H+A + + +  +  L++   DV+ +   GKTPL +A+ +G+++   +L+ N AD  + D+ G+ A+   S
Sbjct:  120 RSLIPLLIDSVERQGTSSRHLLQAAWQGNVQILKRLLSSPKKVDVNCTNADGMTPLLLVTRDIN----MFEQVEQRLDSAYNPIEVVQELLLHKADCSISGKEGRHALHQIATTRGPNAEKIASLLIKEGGCNPDILDGHRYSPIHLASKENNVPIVLALVDGGGDVNVRGCGGKTPLHIAASNGHQSVSGVLVENGADVTLVDDHGYSAMDVTS 330          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 61.2326 bits (147), Expect = 3.689e-10
Identity = 56/184 (30.43%), Postives = 84/184 (45.65%), Query Frame = 1
Query:  244 YNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
             N +D    SA H A+    +E + ELI N S E L  P       L  A +KG +E  + + EKGA  + K+DKG++ +H A        L+FLL K +  ++ +    TP   A      E   LL+        +N+  K+PL LA  +G    ++ L       + +D EG  ALH A+ 
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLSTP-------LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD-----ENQ--KSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAAL 170          

HSP 2 Score: 49.6766 bits (117), Expect = 2.755e-6
Identity = 38/155 (24.52%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  277 FHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNA 741
             H+A+  G  + +K L+S      +++ D + +T    AV  G  EN   + EK       D+   S +H A     +  ++ L    L+ N+ + +  + LH+A    F + +  L+ Y  D++A++    TPL+ A+++G+      LL + A
Sbjct:   73 LHMAACIGSFDALKFLLSK--GVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGA 218          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO42168 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S234])

HSP 1 Score: 55.0694 bits (131), Expect = 2.115e-9
Identity = 28/79 (35.44%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  574 TPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIE 810
            TPLH A     +E  +LL+ Y  +V+  N  G+TPL  A ++ +   + +L+ N AD ++ DN G   LH A+ H  I+
Sbjct:    3 TPLHRAATRGNIEACKLLIQYGANVNKVNGFGETPLHYACQAASLRFVNVLVENGADFNVLDNGGRSFLHIAAEHGHID 81          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: uacab (uveal autoantigen with coiled-coil domains and ankyrin repeats [Source:NCBI gene;Acc:101168930])

HSP 1 Score: 93.5893 bits (231), Expect = 1.332e-18
Identity = 65/217 (29.95%), Postives = 104/217 (47.93%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKSY---NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +KAV R ++ K   ++ K       +D E RSAFHLA+A GHLE +  L+ +  N  +   D   K+ L  A   G    VQ + +        D +G + +H A+     S +  L +   + N  + +  TPL +A ++      QLL+    D+  ++K  KT LIL  E   ++A+++LL + AD    D+ G  A HYA   Q  E  +L+
Sbjct:   27 LIKAVERGEVDKAAAVLSKKGIIPTKLDVEGRSAFHLAAARGHLECLNLLLGH--NVDITASDATGKSALHLASRNGHFGCVQKLLQHNCPVGNVDLQGRTALHDAVMAGCCSSVTLLCDSGASVNASDLEGRTPLILATQMCHPRICQLLLERGADIKLRDKQDKTALILGCEFRCKDAVEVLLKSGADVKAVDSLGHDAFHYARLSQNPELTELV 241          

HSP 2 Score: 51.9878 bits (123), Expect = 6.901e-6
Identity = 33/108 (30.56%), Postives = 52/108 (48.15%), Query Frame = 1
Query:  472 DSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            D LI A  R +       L +K + P   + +  +  H+A     +E L LL+ ++ D+ A +  GK+ L LAS +G+   +Q LL +N      D +G  ALH A  
Sbjct:   25 DRLIKAVERGEVDKAAAVLSKKGIIPTKLDVEGRSAFHLAAARGHLECLNLLLGHNVDITASDATGKSALHLASRNGHFGCVQKLLQHNCPVGNVDLQGRTALHDAVM 132          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: uacab (uveal autoantigen with coiled-coil domains and ankyrin repeats [Source:NCBI gene;Acc:101168930])

HSP 1 Score: 93.2041 bits (230), Expect = 1.532e-18
Identity = 65/217 (29.95%), Postives = 104/217 (47.93%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLIKKSY---NTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
             +KAV R ++ K   ++ K       +D E RSAFHLA+A GHLE +  L+ +  N  +   D   K+ L  A   G    VQ + +        D +G + +H A+     S +  L +   + N  + +  TPL +A ++      QLL+    D+  ++K  KT LIL  E   ++A+++LL + AD    D+ G  A HYA   Q  E  +L+
Sbjct:   27 LIKAVERGEVDKAAAVLSKKGIIPTKLDVEGRSAFHLAAARGHLECLNLLLGH--NVDITASDATGKSALHLASRNGHFGCVQKLLQHNCPVGNVDLQGRTALHDAVMAGCCSSVTLLCDSGASVNASDLEGRTPLILATQMCHPRICQLLLERGADIKLRDKQDKTALILGCEFRCKDAVEVLLKSGADVKAVDSLGHDAFHYARLSQNPELTELV 241          

HSP 2 Score: 51.6026 bits (122), Expect = 8.090e-6
Identity = 33/108 (30.56%), Postives = 52/108 (48.15%), Query Frame = 1
Query:  472 DSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            D LI A  R +       L +K + P   + +  +  H+A     +E L LL+ ++ D+ A +  GK+ L LAS +G+   +Q LL +N      D +G  ALH A  
Sbjct:   25 DRLIKAVERGEVDKAAAVLSKKGIIPTKLDVEGRSAFHLAAARGHLECLNLLLGHNVDITASDATGKSALHLASRNGHFGCVQKLLQHNCPVGNVDLQGRTALHDAVM 132          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd29 (ankyrin repeat domain 29 [Source:NCBI gene;Acc:101171068])

HSP 1 Score: 87.0409 bits (214), Expect = 3.880e-18
Identity = 56/185 (30.27%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  256 DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVN--KKTG---LFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF 795
            D    +A  +AS  GH + +KELI       ++  D+N  ++TG   LF + + G  + V+ +FE GA T  +   G + +  A ++ HS ++  LL    N +D  ND  TPL +A +   +  ++ L++    V+   + G TPL +A++ G+   +++LLS  ADRD    +G  AL  A+ 
Sbjct:   36 DSVGTTALMVASHGGHYDCVKELI-------MQGADINYQRETGSSALFFSSQHGYHDVVKLLFEFGASTEFQTKDGGTALTVACQYGHSKVVDLLLRNGANVHDQLNDGATPLFLAAQGGHVTVIRHLLSCGAKVNQPREDGTTPLWIAAQMGHSQVVKVLLSRGADRDAVRQDGSTALFKAAM 213          

HSP 2 Score: 50.0618 bits (118), Expect = 7.753e-6
Identity = 49/183 (26.78%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  220 VKKLIKKSYNTVDQEK--RSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDA-QNKLGKTPLILASESGNENAIQILLSNNADRDIKD 759
            VK L +   +T  Q K   +A  +A   GH +++  L+ N +N   +  D    T LF A + G +  ++++   GAK N   + G + +  A +  HS +++ LL +  + +    D +T L  A      + ++ L+ +S  +D  QN  G T L  A  +GN   +++LL   AD  + D
Sbjct:   88 VKLLFEFGASTEFQTKDGGTALTVACQYGHSKVVDLLLRNGANVHDQLND--GATPLFLAAQGGHVTVIRHLLSCGAKVNQPREDGTTPLWIAAQMGHSQVVKVLLSRGADRDAVRQDGSTALFKAAMKGHNDVIEELLKFSPSLDILQN--GSTALHAAVMAGNVQTVRLLLGAGADPTLPD 266          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: rai14 (retinoic acid induced 14 [Source:NCBI gene;Acc:101168307])

HSP 1 Score: 89.3521 bits (220), Expect = 1.963e-17
Identity = 70/265 (26.42%), Postives = 123/265 (46.42%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLI-KKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQ-----------------KTEDAQPQVSPPKRPPTLEAPEFIAKLASD 918
             L AV   ++ KV  L+ KK  N V  D E +SA HLA+A GH + +  ++++ ++  L   D +  T L  A +   +E  + + +     +  D+ G + +H A  + +  I+Q L E     N  + D  TPL +A +    E    L+++S D++  +  G+T +++A+ES   + +++L+   AD    D EG   LHY       E +  L                  +TED    V+P  +PP     + +AKL+ +
Sbjct:   23 LLAAVEHGEVEKVASLLAKKGSNAVKLDNEGKSALHLAAAGGHTDCLAAILAHGAD--LSVSDASGFTALHLAAKNNHVECCKKLVQNKCAVDATDNTGKTALHYAAANGNIQIVQLLCELRSPINLKDADALTPLLLAAKHCHSETCCTLLDFSADINTPDNTGRTAVMVAAESNAVSVVEVLVQRGADLSAVDLEGHDVLHYVKMSPNAEARAALTAVLNRHVLGEKSPKQAPQTEDGAKTVNPNIKPPKSPQHDQVAKLSDE 285          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: rai14 (retinoic acid induced 14 [Source:NCBI gene;Acc:101168307])

HSP 1 Score: 89.3521 bits (220), Expect = 1.963e-17
Identity = 70/265 (26.42%), Postives = 123/265 (46.42%), Query Frame = 1
Query:  184 FLKAVWRNDLSKVKKLI-KKSYNTV--DQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQ-----------------KTEDAQPQVSPPKRPPTLEAPEFIAKLASD 918
             L AV   ++ KV  L+ KK  N V  D E +SA HLA+A GH + +  ++++ ++  L   D +  T L  A +   +E  + + +     +  D+ G + +H A  + +  I+Q L E     N  + D  TPL +A +    E    L+++S D++  +  G+T +++A+ES   + +++L+   AD    D EG   LHY       E +  L                  +TED    V+P  +PP     + +AKL+ +
Sbjct:   23 LLAAVEHGEVEKVASLLAKKGSNAVKLDNEGKSALHLAAAGGHTDCLAAILAHGAD--LSVSDASGFTALHLAAKNNHVECCKKLVQNKCAVDATDNTGKTALHYAAANGNIQIVQLLCELRSPINLKDADALTPLLLAAKHCHSETCCTLLDFSADINTPDNTGRTAVMVAAESNAVSVVEVLVQRGADLSAVDLEGHDVLHYVKMSPNAEARAALTAVLNRHVLGEKSPKQAPQTEDGAKTVNPNIKPPKSPQHDQVAKLSDE 285          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000022931.1 (SMESG000022931.1)

HSP 1 Score: 2712.56 bits (7030), Expect = 0.000e+0
Identity = 1456/1456 (100.00%), Postives = 1456/1456 (100.00%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKXXXXXXXXXXXXXXGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALXXXXXXXXXXXVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTXXXXXXXXXXXXXXXDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESXXXXXXXXXXXXXXXXXXXDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDIXXXXXXXXXXXXXXXXIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDXXXXXXXXXXXXXXXXXXXXXXXXSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP 4500
            ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKKNELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP
Sbjct:   30 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKKNELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP 1485          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000022931.1 (SMESG000022931.1)

HSP 1 Score: 2694.84 bits (6984), Expect = 0.000e+0
Identity = 1456/1485 (98.05%), Postives = 1456/1485 (98.05%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKXXXXXXXXXXXXXXGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALXXXXXXXXXXXVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNH-----------------------------EEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTXXXXXXXXXXXXXXXDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESXXXXXXXXXXXXXXXXXXXDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDIXXXXXXXXXXXXXXXXIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDXXXXXXXXXXXXXXXXXXXXXXXXSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP 4500
            ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNH                             EEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKKNELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP
Sbjct:   30 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHESSYDGNGSIHETFLQKTITHLKNKISTVEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKKNELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP 1514          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000022931.1 (SMESG000022931.1)

HSP 1 Score: 2659.02 bits (6891), Expect = 0.000e+0
Identity = 1435/1456 (98.56%), Postives = 1435/1456 (98.56%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKXXXXXXXXXXXXXXGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALXXXXXXXXXXXVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTXXXXXXXXXXXXXXXDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESXXXXXXXXXXXXXXXXXXXDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDIXXXXXXXXXXXXXXXXIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDXXXXXXXXXXXXXXXXXXXXXXXXSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP 4500
            ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPND                     IENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKKNELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP
Sbjct:   30 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPND---------------------IENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKKNELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREKLENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKILSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLSQFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAKHLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP 1464          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000022931.1 (SMESG000022931.1)

HSP 1 Score: 2270.74 bits (5883), Expect = 0.000e+0
Identity = 1210/1210 (100.00%), Postives = 1210/1210 (100.00%), Query Frame = 1
Query:  133 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKXXXXXXXXXXXXXXGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALXXXXXXXXXXXVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTXXXXXXXXXXXXXXXDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESXXXXXXXXXXXXXXXXXXXDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDIXXXXXXXXXXXXXXXXIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFD 3762
            ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFD
Sbjct:   30 ATIYPSPYSVNEKQLSPFLKAVWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSANHKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDATIPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDEESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNVGIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTDSNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVNKNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGDNLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLRSLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEEYKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQLNQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISKKQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKTIKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVAKLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEKILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPDSSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIKVLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQISDLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKEALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQLNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFD 1239          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 110.153 bits (274), Expect = 3.434e-24
Identity = 67/219 (30.59%), Postives = 117/219 (53.42%), Query Frame = 1
Query:  175 LSPFLKAVWRNDLSKVKKLIKKSYN-TVDQEKRSAFHLASAAGHLEIIKELISNYSNELLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDK-GDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASFHQRIECKKLL 825
            +S  + AV  N+  KVK+ I+  +N  +D++ +S  H+A+  G LEI+K L+  +    +  PD    T L KA   G ++ +Q + E+GA+ N++D   G++ +H +    +S  +++L      PN  N  + TPLH+A +    +  + L+    D+ AQN+ G TPL      G+    +IL+S + D + ++  G  ALH A+  +R +  KLL
Sbjct:   54 VSNLIDAVSINNFDKVKEFIRAGHNLIIDKDGKSPIHIAAENGQLEILKYLLQAFPMYNVNTPDNFDSTPLHKAASIGQIDIIQMLLERGAQVNIQDSTHGNTPLHESAWKGYSQTVEYLCLIGRLPNLVNYSLFTPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLL 272          

HSP 2 Score: 54.6842 bits (130), Expect = 6.239e-7
Identity = 31/117 (26.50%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  376 TGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAIRHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCDVDAQNKLGKTPLILASESGNENAIQIL 726
            T L  AV+ G  +  + +   GA  + ++  GD+ +H  +R+ H+ + + L+    + N  N + +T LH+A  L   +  +LL+     +D +N   +TPL +A +  +   I+IL
Sbjct:  189 TPLHLAVQGGHNQTTRNLIRCGADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRNQNGDTALHIAAALKRRKITKLLVESGASIDIRNIQNETPLDVALKKSHSEIIEIL 305          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAI145.100e-2128.39retinoic acid induced 14 [Source:HGNC Symbol;Acc:H... [more]
RAI147.059e-2128.33retinoic acid induced 14 [Source:HGNC Symbol;Acc:H... [more]
RAI147.168e-2128.33retinoic acid induced 14 [Source:HGNC Symbol;Acc:H... [more]
RAI147.168e-2128.33retinoic acid induced 14 [Source:HGNC Symbol;Acc:H... [more]
RAI147.168e-2128.33retinoic acid induced 14 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-449.714e-1627.42AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.714e-1627.42AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.227e-1527.42AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.227e-1527.42AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.247e-1527.42AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG100111.271e-1727.52gene:FBgn0039590 transcript:FBtr0085319[more]
Ank21.802e-1325.33gene:FBgn0261788 transcript:FBtr0303124[more]
Ank21.812e-1325.33gene:FBgn0261788 transcript:FBtr0303121[more]
Ank21.888e-1325.33gene:FBgn0261788 transcript:FBtr0303115[more]
Ank22.071e-1326.49gene:FBgn0261788 transcript:FBtr0303125[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.37.461e-2429.74si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
si:ch211-272n13.31.174e-2329.74si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
ankdd1a2.815e-1927.65ankyrin repeat and death domain containing 1A [Sou... [more]
ankrd1a5.265e-1932.42ankyrin repeat domain 1a (cardiac muscle) [Source:... [more]
ankrd1a5.265e-1932.42ankyrin repeat domain 1a (cardiac muscle) [Source:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rai145.264e-2028.50retinoic acid induced 14 [Source:NCBI gene;Acc:100... [more]
cpsf11.066e-1927.82cleavage and polyadenylation specific factor 1 [So... [more]
ANKRD291.958e-1730.05ankyrin repeat domain 29 [Source:NCBI gene;Acc:100... [more]
rev11.987e-1728.96REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
ANKRD292.105e-1730.05ankyrin repeat domain 29 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rai149.076e-2128.39retinoic acid induced 14 [Source:MGI Symbol;Acc:MG... [more]
Rai141.342e-2028.33retinoic acid induced 14 [Source:MGI Symbol;Acc:MG... [more]
Rai141.342e-2028.33retinoic acid induced 14 [Source:MGI Symbol;Acc:MG... [more]
Invs1.681e-1829.53inversin [Source:MGI Symbol;Acc:MGI:1335082][more]
Ankrd12.635e-1831.77ankyrin repeat domain 1 (cardiac muscle) [Source:M... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P0K7|RAI14_HUMAN3.442e-2028.33Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 S... [more]
sp|Q9EP71|RAI14_MOUSE9.384e-2028.33Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 ... [more]
sp|Q5U312|RAI14_RAT3.687e-1929.03Ankycorbin OS=Rattus norvegicus OX=10116 GN=Rai14 ... [more]
sp|Q9Y283|INVS_HUMAN2.536e-1830.77Inversin OS=Homo sapiens OX=9606 GN=INVS PE=1 SV=2[more]
sp|Q6JAN1|INVS_CANLF2.787e-1830.77Inversin OS=Canis lupus familiaris OX=9615 GN=INVS... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PYH61.047e-2935.59Ankyrin repeat domain-containing protein 26 OS=Miz... [more]
A0A5K3FAJ05.785e-2734.32Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A556THS33.398e-2532.44Ankyrin repeat domain-containing protein 26 OS=Bag... [more]
E3TF172.121e-2432.33Ankyrin repeat domain-containing protein 7 OS=Icta... [more]
A0A401S8082.708e-2430.18ANK_REP_REGION domain-containing protein OS=Chilos... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.35.651e-2631.90si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
si:ch211-272n13.36.173e-2631.90si:ch211-272n13.3 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
dapk11.700e-1929.83death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
psmd109.571e-1936.47proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
psmd101.489e-1835.67proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003991.11.784e-1626.50pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000000095.12.200e-1528.14pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000005495.14.920e-1529.34pep scaffold:Pmarinus_7.0:GL476878:391902:403130:-... [more]
ENSPMAT00000009528.15.226e-1525.35pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 ge... [more]
ankrd1a9.324e-1528.18ankyrin repeat domain 1a (cardiac muscle) [Source:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
GDE11.104e-1029.84Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
AVO21.114e-1025.00Component of a complex containing the Tor2p kinase... [more]
AKR14.526e-923.50Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391131.957e-1225.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494852.189e-1039.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478202.737e-1026.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387253.689e-1030.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421682.115e-935.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uacab1.332e-1829.95uveal autoantigen with coiled-coil domains and ank... [more]
uacab1.532e-1829.95uveal autoantigen with coiled-coil domains and ank... [more]
ankrd293.880e-1830.27ankyrin repeat domain 29 [Source:NCBI gene;Acc:101... [more]
rai141.963e-1726.42retinoic acid induced 14 [Source:NCBI gene;Acc:101... [more]
rai141.963e-1726.42retinoic acid induced 14 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022931.10.000e+0100.00SMESG000022931.1[more]
SMESG000022931.10.000e+098.05SMESG000022931.1[more]
SMESG000022931.10.000e+098.56SMESG000022931.1[more]
SMESG000022931.10.000e+0100.00SMESG000022931.1[more]
SMESG000063648.13.434e-2430.59SMESG000063648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018972 ID=SMED30018972|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4561bp
AAGTTTCTAAAGCAATCAAACTGAATACCTATTTTAAATATTGAAATGAG
TTCGTTTTTTAATAAATTTTCCAAAAGGAAAAGTTCGATTGATAAATCGT
CATTGGGAAGTAATTCGTCATTATTTAGTAGTGCAACAATTTATCCTTCG
CCTTATTCTGTAAATGAAAAACAATTATCCCCATTTTTGAAAGCTGTTTG
GAGAAATGACTTAAGTAAAGTTAAAAAACTTATCAAAAAAAGTTATAATA
CGGTTGATCAGGAAAAAAGATCCGCGTTTCATTTGGCCTCTGCTGCTGGT
CATTTAGAAATAATTAAAGAATTGATCAGTAATTACAGCAATGAATTGTT
AGAGAAACCTGATGTGAATAAGAAAACTGGTCTTTTCAAAGCTGTAGAAA
AAGGAATATTGGAAAATGTTCAGTACATATTTGAAAAAGGTGCAAAAACC
AATGTTAAAGACGACAAAGGCGATTCGTTGATACATGCAGCTATTCGACA
TAAACATAGTAGTATATTACAATTTTTACTGGAAAAAGAGCTAAATCCCA
ATGACTGCAATAATGATGTAAACACGCCTTTACATGTTGCATGTGAGCTG
GATTTTATGGAAGGGCTTCAACTGCTTATGAATTATTCATGTGATGTTGA
TGCTCAAAATAAGCTTGGAAAAACTCCTCTAATACTTGCTTCAGAATCTG
GAAATGAGAATGCTATTCAAATTCTTTTATCAAATAATGCAGACCGAGAT
ATTAAAGACAATGAAGGTTTTAAAGCGCTCCACTACGCCAGCTTTCACCA
GAGAATAGAATGTAAGAAGCTGCTGCAGAAAACTGAGGACGCGCAACCTC
AGGTGTCACCTCCTAAACGTCCCCCCACATTAGAAGCTCCAGAATTTATA
GCGAAATTGGCATCTGATAATCAGAAATCACAGAAATCTGCGAACCATAA
AAGGACCTCACAAAATGATGCTACGAAATCAAGAATTCCTGTTTCCGACA
AACAAAATCAAGCACGAAAATCGATAAGCCAAGATTCTATTCACTCTAAT
AGTTCATGGATCGGTGATTTCGCTAGCACTTCTAGCGATGCCACGATCCC
AGTATCAAGGAACTCTATAGCCATTCATGACATAAGTACACCATCATCAA
TGATGAATCCCTCCGACAATATAGTAGGTAAAACAAAACACGTTTCACCT
GGCTTCGACAATTCGAATTTAAAAAAACAATTTTCCGATGATGAAGAGAG
TCAATGGTCTGAAAATGAGAAATCTGTTAAAGAAGAGATTGTATACCCAG
CGGTGTTAAATAAACCTGTTGAAAGGAAAGATGAAGTCGACAACAAAAAT
AGTGAAAGTGAATGGGACTCAGAAGACACCGAACAACAAAATGTTGGCAT
TGAACTCTCAACTATCGACGAAGAAAGCGGAGGAAAACGGAGTCGTATTA
ATTCTATGACTAGCCCACAATTAGTTAAACAAATTCATGAGAACGAAAAG
TCAGAATTGAGTCTTCCATATGCTGATGATGGTCATCAAACGGATTCAAA
TATTGAAGAATGCTATAAGACAAATTACATAATAACAACGAATCCACCAA
TACGTTATGATAACGTAGATGCGCTTGATATTTCCATCGACGAAGATAGT
GACGACGACGTATTGAATGAGCTCTGCACCACACAAGTTGTTAATAAAAA
CTACAAAGAGAATTCACAAGCTCCTTCAACAAAACCTCCCAAATCACCAG
GAGTCTATTCAAGTGACAAGAATATTCCAACAATTAATGTCCAAGATGTA
ACGCCAAAAAAACGAACTCATTATTTAAATCAAGCAGGGGGTGATAATCT
ATCATATTCCAGTACCGAGTTCGACGTCAATAGCCGTAATGGGTCCTTGG
CAGAATCAGATTCTTTAACCGACTTCAAAAAGTCGAACAGGAGATCACTC
GATGAATATATAAAAAAATGCACTCATTTAGAATCGAAACTTCGTTCTTT
AGAATCGGAAAAAGATTGCTTACAAATGAACATCAATGCGATTAATTCAT
CGAAAGAAAAATTGGAATCAGAAAGATTAAAAATTCATGCCGAAAATAAA
AAAATTGAGTCTCAGTTGTCAGAACGGATAGAAGAGTTGGAAGAATATAA
AGCAAAATTCATTGGAGCAGAAGATCAGTTAAAGAAACGTGAAAAAGAAT
TATTTGACATCAAAAAATCCAAACAGGAAATTGAAGATAAATACAATCAG
CTGGAGATTAATAATCTTGCATTGAATTCCAAAGTCAAACAGTTAAATCA
AGAAATGGATGATCTTCAATCTCAAAATCATGAGGAAGATTCACTAAAGC
AAAAGAGACAACACGAAAACGAATTAAAGAATTTATCAATGACAAATGAT
AACCTAAAAAGTCAAATTTCAAATCTTCAACATGAAATTTCTAAAAAACA
AGAAGATTATGCAATTGTTGCAAGCGATAACCAGAAAAATATTGAGAATT
TACACAAAGAAATTAAAACATTTACACAAACAATTCAGAGTGAAAAGGAA
GAGAAAGAAAGTCTCCAAGAAGAAATTGATCAATTAAAAAAGACAATAAA
AAGTTTGAACTCTGACCTTGAATCGTCCAATAAATCCACTGCACTCGTCA
AAAAGCAAGAGCGTGAAAATAAAGAATTAAAGGATCGGATTCAAGAACTA
GAAAAGAATTGCTCTCAATTACATGCCGATAATGAAAATGTTGCGAAATT
GTCTTTGGATAAAGACCAAAAAATAAACGCCATCCAATTAGAGGTAGAAA
GACTGAAAAATCAATTGAATTTGAAGGACGACAAAATTTATCATTTGGAA
ACTCAATATAAAACCTACGAAAATCAATCTAAAGACTTGGAAAAAATCCT
AGAAAGAAAAAACAGTGAATTAAGAGAAAGCGAAAACAAACTGCTACATT
TAGAAATCGAGTTAAAGAAAGAAATTAAGAAAAATGAAGATGTATTAAAT
ACAATTAATGATGCAATTAATACTGTAATTAATGATTGCCCCGATTCCTC
AGAACTGTTGGAGAAATTACAGAATATTAGAAAAACGATTAATAGTTCTT
ATGGAAATCCAGTTATTATTCACAAACCAGTAAATCTTTCAATTGGTGAC
AAAGATTTATTCATAGAATTATCAAAATCGAAATCACAGATTAAAGTTTT
AGAAGAACAAATTGAACAGATGAAACAAAACTATAATAGTGAAATTCGAT
CCTTTTCCAATAAGCAAAATTCATACGAAGAATCTCCAAATGATTTTCTA
CACAAAAATTCCTCAAAATCCTTTATACCATTTAAACAAATCTCTGATTT
GTTATTGATTGAAAATGAAAGAATTGATAAACTAGAAATTATTGAAAGAC
AATTACATTCTGATTTGCAATATAAATCGAGAATAATTCAAACAAATCAA
CACGAATTAACACAATTAGATAAAGACATTTCGCAATTGAAAGAGGCTTT
AAAAGAGGAAAAGCAAAAATCTCAATTAATCCAGGAAAAAGATAAATCTC
TTTCTAATCAATTAAGAAATGAAATAAAAAAACGAAAACAATTATCAGAA
GCTATAGACTCGGTAAAGTATTGGTTGGATAAATATGGTAAACAGCTCAA
TTTATCAACTCGCACTGAAGAATTCATGGCTTCATCAAACACTGATACAG
TTGACAATGCCTTTTCGTCAGTTCCCAACGAATGTTCTTTACTACTACAG
ACACTTTTCGATAAAAATGAAGATTTGAAAATGAAATTAAAGAAAAATGA
ACTGGAGTTACTGGAACTGAACAATCGAAAATTGTCGTCGGAAAAATGCC
AGGAAATATCAAATGGAAATGCTCAAGTCCTATTAAATCAGCAATTAGAG
GAAATGACTCAAATGATGGAGAATCAACGTTTAAATAGAGAGAAATTGGA
AAATATCCGAGATGAAAATGAATTCCAGTTAAGGAACGAATTATATCAAT
TAAAACAACAAACAATGATTGAAGTTTCCCAATTTACTAATAAGGCAGCA
GCCACTGAAGAAGAACGGGAAAAGTTAATTCAGCAAAATAAAATCCTCAG
TGAAACCCTAGTCAAAGAAAGACAACTGAAAGACTCATTGACCGAACAGT
TGGTAAATTTAATGAAAAATTCGCATGGTTCTAATCAACATATAAATGGA
TATGAATCTACATTCCATGCCAATAACTTTAATCCTTCCCTGTCGCAGTT
TAGTATACCAATCAGCTTAATAGATAATGATAGAAAAGGTTATGCCAATT
CTATGATTAACTTATCAGTTTTCAAGCCGTCAGGAGTTGAAGATGACGAA
CTGCGTCAAAAGCTACGACAAGAATTAGATAGGAGCATCGCAAAGCATTT
AGAAAGTGGAAAACCTATTCGACAGTTAAACATTAAAGAAAAAATCAGAT
CATTGAACGGCGGCCGATATCCCAGTGGCATTGTATCTTGGAAGTCACCA
TAAACTTTCAACTACTTTCACATAACATCAAATATGAGTATATAAATAAA
ATACTTTATGA
back to top

protein sequence of SMED30018972-orf-1

>SMED30018972-orf-1 ID=SMED30018972-orf-1|Name=SMED30018972-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1486bp
MSSFFNKFSKRKSSIDKSSLGSNSSLFSSATIYPSPYSVNEKQLSPFLKA
VWRNDLSKVKKLIKKSYNTVDQEKRSAFHLASAAGHLEIIKELISNYSNE
LLEKPDVNKKTGLFKAVEKGILENVQYIFEKGAKTNVKDDKGDSLIHAAI
RHKHSSILQFLLEKELNPNDCNNDVNTPLHVACELDFMEGLQLLMNYSCD
VDAQNKLGKTPLILASESGNENAIQILLSNNADRDIKDNEGFKALHYASF
HQRIECKKLLQKTEDAQPQVSPPKRPPTLEAPEFIAKLASDNQKSQKSAN
HKRTSQNDATKSRIPVSDKQNQARKSISQDSIHSNSSWIGDFASTSSDAT
IPVSRNSIAIHDISTPSSMMNPSDNIVGKTKHVSPGFDNSNLKKQFSDDE
ESQWSENEKSVKEEIVYPAVLNKPVERKDEVDNKNSESEWDSEDTEQQNV
GIELSTIDEESGGKRSRINSMTSPQLVKQIHENEKSELSLPYADDGHQTD
SNIEECYKTNYIITTNPPIRYDNVDALDISIDEDSDDDVLNELCTTQVVN
KNYKENSQAPSTKPPKSPGVYSSDKNIPTINVQDVTPKKRTHYLNQAGGD
NLSYSSTEFDVNSRNGSLAESDSLTDFKKSNRRSLDEYIKKCTHLESKLR
SLESEKDCLQMNINAINSSKEKLESERLKIHAENKKIESQLSERIEELEE
YKAKFIGAEDQLKKREKELFDIKKSKQEIEDKYNQLEINNLALNSKVKQL
NQEMDDLQSQNHEEDSLKQKRQHENELKNLSMTNDNLKSQISNLQHEISK
KQEDYAIVASDNQKNIENLHKEIKTFTQTIQSEKEEKESLQEEIDQLKKT
IKSLNSDLESSNKSTALVKKQERENKELKDRIQELEKNCSQLHADNENVA
KLSLDKDQKINAIQLEVERLKNQLNLKDDKIYHLETQYKTYENQSKDLEK
ILERKNSELRESENKLLHLEIELKKEIKKNEDVLNTINDAINTVINDCPD
SSELLEKLQNIRKTINSSYGNPVIIHKPVNLSIGDKDLFIELSKSKSQIK
VLEEQIEQMKQNYNSEIRSFSNKQNSYEESPNDFLHKNSSKSFIPFKQIS
DLLLIENERIDKLEIIERQLHSDLQYKSRIIQTNQHELTQLDKDISQLKE
ALKEEKQKSQLIQEKDKSLSNQLRNEIKKRKQLSEAIDSVKYWLDKYGKQ
LNLSTRTEEFMASSNTDTVDNAFSSVPNECSLLLQTLFDKNEDLKMKLKK
NELELLELNNRKLSSEKCQEISNGNAQVLLNQQLEEMTQMMENQRLNREK
LENIRDENEFQLRNELYQLKQQTMIEVSQFTNKAAATEEEREKLIQQNKI
LSETLVKERQLKDSLTEQLVNLMKNSHGSNQHINGYESTFHANNFNPSLS
QFSIPISLIDNDRKGYANSMINLSVFKPSGVEDDELRQKLRQELDRSIAK
HLESGKPIRQLNIKEKIRSLNGGRYPSGIVSWKSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001105RNA polymerase II transcription coactivator activity
GO:0002039p53 binding
GO:0003677DNA binding
GO:0003712transcription cofactor activity
GO:0003714transcription corepressor activity
GO:0008134transcription factor binding
GO:0031432titin binding
GO:0042826histone deacetylase binding
GO:0070412R-SMAD binding
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0010976positive regulation of neuron projection development
GO:0035690cellular response to drug
GO:0035914skeletal muscle cell differentiation
GO:0035994response to muscle stretch
GO:0042692muscle cell differentiation
GO:0043065positive regulation of apoptotic process
GO:0043517positive regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045892negative regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0050714positive regulation of protein secretion
GO:0055008cardiac muscle tissue morphogenesis
GO:0071222cellular response to lipopolysaccharide
GO:0071260cellular response to mechanical stimulus
GO:0071347cellular response to interleukin-1
GO:0071356cellular response to tumor necrosis factor
GO:0071407cellular response to organic cyclic compound
GO:0071456cellular response to hypoxia
GO:0071560cellular response to transforming growth factor beta stimulus
GO:2000279negative regulation of DNA biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0001650fibrillar center
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030016myofibril
GO:0031674I band
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1284..1304
NoneNo IPR availableCOILSCoilCoilcoord: 635..804
NoneNo IPR availableCOILSCoilCoilcoord: 816..902
NoneNo IPR availableCOILSCoilCoilcoord: 910..979
NoneNo IPR availableCOILSCoilCoilcoord: 1327..1375
NoneNo IPR availableCOILSCoilCoilcoord: 1131..1165
NoneNo IPR availableCOILSCoilCoilcoord: 1234..1266
NoneNo IPR availableCOILSCoilCoilcoord: 1042..1073
NoneNo IPR availablePFAMPF13637Ank_4coord: 143..183
e-value: 2.2E-5
score: 24.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..410
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 551..580
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..453
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 393..410
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..441
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 290..334
NoneNo IPR availablePANTHERPTHR24189:SF55IQ MOTIF AND ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN LOC642574-RELATEDcoord: 107..212
coord: 41..182
NoneNo IPR availablePANTHERPTHR24189FAMILY NOT NAMEDcoord: 107..212
coord: 41..182
coord: 174..268
NoneNo IPR availablePANTHERPTHR24189:SF55IQ MOTIF AND ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN LOC642574-RELATEDcoord: 174..268
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 207..236
e-value: 0.0092
score: 25.2
coord: 108..137
e-value: 380.0
score: 8.2
coord: 141..170
e-value: 0.026
score: 23.7
coord: 174..203
e-value: 0.23
score: 20.6
coord: 73..103
e-value: 0.22
score: 20.6
coord: 42..72
e-value: 450.0
score: 7.6
coord: 240..269
e-value: 1500.0
score: 3.8
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 174..206
score: 9.751
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 141..173
score: 8.977
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 207..239
score: 12.022
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 108..140
score: 9.057
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 192..262
e-value: 1.4E-10
score: 41.6
coord: 49..139
e-value: 1.6E-9
score: 38.2
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 73..260
score: 44.723
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 26..329
e-value: 2.4E-53
score: 183.2
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 32..262