WW domain-containing protein

Overview
NameWW domain-containing protein
Smed IDSMED30018971
Length (bp)1212
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WW domain-containing protein (SMED30018971) t-SNE clustered cells

Violin plots show distribution of expression levels for WW domain-containing protein (SMED30018971) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WW domain-containing protein (SMED30018971) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WW domain-containing protein (SMED30018971) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018971

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018971h1SMcG0018307 SmedASXL_012994SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WW domain-containing protein vs. Ensembl Human
Match: FNBP4 (formin binding protein 4 [Source:HGNC Symbol;Acc:HGNC:19752])

HSP 1 Score: 50.0618 bits (118), Expect = 6.037e-6
Identity = 32/105 (30.48%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  534 TEQVDEAEKYLKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQIKTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQYFCVSIEDG 848
            T +V+E E+ LK  I +++ TL +K E L  +     N   + +Q +TR+ DW EG L+ N    KL+++  ++ ++E +     W   W+ D  +YF V+ + G
Sbjct:  517 TPKVEE-EQDLKFQIGELANTLTSKFEFLGINRQSISNFHVLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSG 620          
BLAST of WW domain-containing protein vs. Ensembl Human
Match: FNBP4 (formin binding protein 4 [Source:HGNC Symbol;Acc:HGNC:19752])

HSP 1 Score: 50.0618 bits (118), Expect = 6.037e-6
Identity = 32/105 (30.48%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  534 TEQVDEAEKYLKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQIKTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQYFCVSIEDG 848
            T +V+E E+ LK  I +++ TL +K E L  +     N   + +Q +TR+ DW EG L+ N    KL+++  ++ ++E +     W   W+ D  +YF V+ + G
Sbjct:  517 TPKVEE-EQDLKFQIGELANTLTSKFEFLGINRQSISNFHVLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSG 620          
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000042652.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:7554025:7558097:1 gene:ENSXETG00000017564.1 transcript:ENSXETT00000042652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 5.327e-6
Identity = 28/90 (31.11%), Postives = 47/90 (52.22%), Query Frame = 3
Query:  564 LKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQIKTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQYFCV 833
            LK  I +++ +L +K+E L  +     N   +  Q +TR+ DW EG LS N    KL+++  +I ++E +     W   W+ D  +YF V
Sbjct:   87 LKFQIGELANSLISKLEFLGINRQSVSNFHVLLFQTETRISDWREGALSGNYLKRKLQDATEQIKQYEINATPKGWSCHWDRDHRRYFYV 176          
BLAST of WW domain-containing protein vs. Ensembl Mouse
Match: Fnbp4 (formin binding protein 4 [Source:MGI Symbol;Acc:MGI:1860513])

HSP 1 Score: 50.0618 bits (118), Expect = 4.861e-6
Identity = 30/100 (30.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  549 EAEKYLKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQIKTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQYFCVSIEDG 848
            E E+ LK  I +++ TL +K E L  +     N   + +Q +TR+ DW EG L+ N    KL+++  ++ ++E +     W   W+ D  +YF V+ + G
Sbjct:  575 EEEQDLKFQIGELANTLTSKFEFLGINRQSISNFHMLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSG 674          
BLAST of WW domain-containing protein vs. Ensembl Mouse
Match: Fnbp4 (formin binding protein 4 [Source:MGI Symbol;Acc:MGI:1860513])

HSP 1 Score: 50.0618 bits (118), Expect = 5.300e-6
Identity = 30/100 (30.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  549 EAEKYLKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQIKTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQYFCVSIEDG 848
            E E+ LK  I +++ TL +K E L  +     N   + +Q +TR+ DW EG L+ N    KL+++  ++ ++E +     W   W+ D  +YF V+ + G
Sbjct:  528 EEEQDLKFQIGELANTLTSKFEFLGINRQSISNFHMLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSG 627          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A087VZ22 (WW Rsp5 WWP OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000124600 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.886e-9
Identity = 30/70 (42.86%), Postives = 48/70 (68.57%), Query Frame = 3
Query:   84 VKEFLADAECIAHSSVFSEDNSCEPKTEWIEEIDSRTNFPFYWNSNTKESVWDMPKEYNDYMIKYEAYLR 293
            V+ F A+ + I  + V  +DN+  PKT WI ++DS++N PFY+N  TKE+ W++P EY  Y+ +Y+ YL+
Sbjct:    9 VENFFAEVDAITFNGVKEQDNA--PKTNWIVQVDSKSNLPFYYNFVTKETTWNIPDEYQSYLDEYKTYLQ 76          
BLAST of WW domain-containing protein vs. TrEMBL
Match: W6UIK4 (WW domain-containing protein OS=Echinococcus granulosus OX=6210 GN=EGR_04154 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.912e-9
Identity = 30/70 (42.86%), Postives = 48/70 (68.57%), Query Frame = 3
Query:   84 VKEFLADAECIAHSSVFSEDNSCEPKTEWIEEIDSRTNFPFYWNSNTKESVWDMPKEYNDYMIKYEAYLR 293
            V+ F A+ + I  + V  +DN+  PKT WI ++DS++N PFY+N  TKE+ W++P EY  Y+ +Y+ YL+
Sbjct:    9 VENFFAEVDAITFNGVKEQDNA--PKTNWIVQVDSKSNLPFYYNFVTKETTWNIPDEYQSYLDEYKTYLQ 76          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A068WTD7 (WW Rsp5 WWP OS=Echinococcus granulosus OX=6210 GN=EgrG_000124600 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.302e-9
Identity = 30/70 (42.86%), Postives = 48/70 (68.57%), Query Frame = 3
Query:   84 VKEFLADAECIAHSSVFSEDNSCEPKTEWIEEIDSRTNFPFYWNSNTKESVWDMPKEYNDYMIKYEAYLR 293
            V+ F A+ + I  + V  +DN+  PKT WI ++DS++N PFY+N  TKE+ W++P EY  Y+ +Y+ YL+
Sbjct:    9 VENFFAEVDAITFNGVKEQDNA--PKTNWIVQVDSKSNLPFYYNFVTKETTWNIPDEYQSYLDEYKTYLQ 76          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A564YP21 (WW domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7735 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.208e-8
Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   84 VKEFLADAECIAHSSVFSEDNSCEPKTEWIEEIDSRTNFPFYWNSNTKESVWDMPKEYNDYMIKYEAYLRDLIVKCKESQQL 329
            ++ F A+ E +  S      N   PKT WI ++D +TN P+Y N  TKE+ W++P+EY DY+ KYE YL++      + Q++
Sbjct:   10 IETFFAEVEAMKSSHNV---NDNVPKTNWIVQVDPKTNIPYYCNYVTKETTWNIPEEYQDYLTKYEHYLKEQYEGTTKPQEI 88          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A564YM03 (WW domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7735 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.431e-8
Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   84 VKEFLADAECIAHSSVFSEDNSCEPKTEWIEEIDSRTNFPFYWNSNTKESVWDMPKEYNDYMIKYEAYLRDLIVKCKESQQL 329
            ++ F A+ E +  S      N   PKT WI ++D +TN P+Y N  TKE+ W++P+EY DY+ KYE YL++      + Q++
Sbjct:   10 IETFFAEVEAMKSSHNV---NDNVPKTNWIVQVDPKTNIPYYCNYVTKETTWNIPEEYQDYLTKYEHYLKEQYEGTTKPQEI 88          
BLAST of WW domain-containing protein vs. Ensembl Cavefish
Match: fnbp4 (formin binding protein 4 [Source:NCBI gene;Acc:103040741])

HSP 1 Score: 52.7582 bits (125), Expect = 5.435e-7
Identity = 32/105 (30.48%), Postives = 54/105 (51.43%), Query Frame = 3
Query:  519 KDQWMTEQVDEAEKYLKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQIKTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQYFCV 833
            KD+ + +  +E    LK  I +++ TL +K+E L  D     N + + +Q +TR+ DW EG L+ N    +L+E+   I  +E +     W   W+ D  +YF V
Sbjct:  442 KDKSLPKTQEEETPDLKFQIGELANTLTSKMEFLGIDKKAISNFQLLLLQTETRIADWREGALNGNYLRRRLQEAAEHIKHYELNATPKGWSCHWDRDHRRYFYV 546          
The following BLAST results are available for this feature:
BLAST of WW domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FNBP46.037e-630.48formin binding protein 4 [Source:HGNC Symbol;Acc:H... [more]
FNBP46.037e-630.48formin binding protein 4 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000042652.15.327e-631.11pep primary_assembly:Xenopus_tropicalis_v9.1:4:755... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fnbp44.861e-630.00formin binding protein 4 [Source:MGI Symbol;Acc:MG... [more]
Fnbp45.300e-630.00formin binding protein 4 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VZ224.886e-942.86WW Rsp5 WWP OS=Echinococcus multilocularis OX=6211... [more]
W6UIK44.912e-942.86WW domain-containing protein OS=Echinococcus granu... [more]
A0A068WTD75.302e-942.86WW Rsp5 WWP OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A564YP212.208e-837.80WW domain-containing protein OS=Hymenolepis diminu... [more]
A0A564YM032.431e-837.80WW domain-containing protein OS=Hymenolepis diminu... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fnbp45.435e-730.48formin binding protein 4 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018971 ID=SMED30018971|Name=WW domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1212bp
TCATCATATTATTCAAAATTTTATATTAATATTAATTATTAAAATTATTC
GATTACATTGAATATTGTTTAATGGAACTATTTGTTAAGGAATTTCTTGC
AGATGCTGAATGCATTGCTCATTCATCAGTATTTTCGGAAGATAATAGTT
GTGAACCCAAAACTGAATGGATCGAGGAAATAGATTCTAGGACAAATTTT
CCTTTTTATTGGAATTCAAATACTAAAGAAAGTGTGTGGGATATGCCGAA
AGAATATAATGATTATATGATTAAATATGAAGCTTATTTAAGAGATTTAA
TTGTGAAATGTAAAGAATCACAACAATTAGAATTGGAAAACGATAATAAT
CAAATAAATATTGACATGAAAGGATTAATTGAATATTCAGACAGTGAAGA
TGATGAGATTCAAACTAATGATGATATTTCAATTAATAGTCCCGTAAAAC
CTGAAGAAATTGCCCCTGAAATTGTATCCCCTGAAATAGAGGAAAGTGAA
GAAGATTTATTAATTAAAAAAGATCAATGGATGACTGAACAGGTTGATGA
AGCTGAAAAGTATTTAAAATCGACTATTAAAAAGATGTCGGAAACGCTCA
AAAATAAAATCGAAGTTCTGATTCACGATGGCTTTGGTAATGATAATTTA
AAAGACATATCGATCCAAATTAAAACACGGCTTGAAGACTGGAGTGAGGG
TTATTTATCATTAAATAGAAAAGTTGATAAATTACGAGAATCTCTTATTG
AAATATCACGTTTTGAAGCCAGTTTAGAAACAGATAAATGGAGGTTGCAA
TGGAACAGTGATAAAAATCAGTATTTCTGTGTCAGTATCGAGGATGGAAA
ATTAATATCGGAATTGTCTGCCACTAAAACTTGTTATGAAGAAGGTGAGA
TTATTGAAGATGAAGATGATTTAGCACAAGATTTGGAAGAATATGTCTGT
ACGACTTTGCATAGGTCACTTTTAGAAGAAAGTCAAGAAACAGAGAAAAA
TGATGAATTATCCAGGTCGTCTCGGGATGACGGCAACCACAGCCAGTCGG
TACTGGCGGAAGACAATCTATCGGAAGAGAATTTAAATGATTCGGATTCA
GTTTCTTTTACAGAAGCTTGAAAATTATTTTCCTTTCCCAATTTATATCA
CGAACTCAGGCGAGTGATTTTCCTCAACCCCACTTGATATTAATTACATA
TTTGTGTACAAA
back to top

protein sequence of SMED30018971-orf-1

>SMED30018971-orf-1 ID=SMED30018971-orf-1|Name=SMED30018971-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MELFVKEFLADAECIAHSSVFSEDNSCEPKTEWIEEIDSRTNFPFYWNSN
TKESVWDMPKEYNDYMIKYEAYLRDLIVKCKESQQLELENDNNQINIDMK
GLIEYSDSEDDEIQTNDDISINSPVKPEEIAPEIVSPEIEESEEDLLIKK
DQWMTEQVDEAEKYLKSTIKKMSETLKNKIEVLIHDGFGNDNLKDISIQI
KTRLEDWSEGYLSLNRKVDKLRESLIEISRFEASLETDKWRLQWNSDKNQ
YFCVSIEDGKLISELSATKTCYEEGEIIEDEDDLAQDLEEYVCTTLHRSL
LEESQETEKNDELSRSSRDDGNHSQSVLAEDNLSEENLNDSDSVSFTEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036020WW_dom_sf
IPR030386G_GB1_RHD3_dom
IPR001202WW_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0016607nuclear speck
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001202WW domainSMARTSM00456ww_5coord: 28..61
e-value: 5.4E-4
score: 29.3
IPR001202WW domainPFAMPF00397WWcoord: 32..59
e-value: 6.3E-7
score: 29.4
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 33..61
score: 10.206
IPR001202WW domainCDDcd00201WWcoord: 30..61
e-value: 1.19235E-4
score: 36.737
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 28..66
e-value: 5.4E-7
score: 31.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 302..319
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 302..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 320..349
NoneNo IPR availablePANTHERPTHR46697FAMILY NOT NAMEDcoord: 133..285
coord: 32..81
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 28..61