Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30018957
Length (bp)3468
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30018957) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30018957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30018957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30018957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018957h1SMcG0002577 SmedASXL_017646SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018957h1SMcG0002577 dd_Smed_v4_11345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018957h1SMcG0002577 dd_Smed_v6_11345_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 261.536 bits (667), Expect = 1.270e-71
Identity = 221/765 (28.89%), Postives = 361/765 (47.19%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CK-QVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVE--VKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG--VTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N+++  L   +   F + GH   L+    +  ++ K G +  T++ IDRE +  C+ Q+  +P C +   +      +   P +++  I + DIND+ P  N  + ++TL IPE++ I S F +P A D D GP+ V  SY +    + +  F L+V        +   +  LIV+G LDRE+   Y + I   DGG PP +    + + V D ND++P+F+ +      L EN+ I   +    A D D      + ++F    E  V +   L   +G + +Q  +D E   +  F+V   D G +  S   +  V V ++NDN+P I ++          +  +SE+      +  V V+D D+      V C +  D P  + + S    +++ K+ L+T    D E        I   D+G PP  S+ + ++ ++DVNDNAPVF          EN   G +I ++ A D D+  NA   + L+P+      F I  ETG+I  K   + E+   YE+     D    SL+GT       V +N+ D NDN P+F    Y+FS+ EN+ + +P+  V   D D  E N  ++         S+ +  G  V Q+G   + SS   DRE+  ++TF + A+D G P  S+   + I V D NDN P +I    + +H  +T    +G  V +  A+D D G N+EL Y I   N    +FQ+   +G++ +++ +       HRL + V DRG P
Sbjct:   66 EEQPPNTLIGSLAADY--GFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDP-CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP--NFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA-SYELQAGPEAQELFGLQVA-----EDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFE-RPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA-VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGT-----ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE-NAQVQL--------SVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-YITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNP-YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 800          

HSP 2 Score: 158.303 bits (399), Expect = 1.623e-38
Identity = 130/459 (28.32%), Postives = 210/459 (45.75%), Query Frame = 1
Query: 1216 EVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP----IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHK-VFGKVDLNIEDMNDNSP----RFDKDIYH----FSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK--HIGVTQDGKIFVRSSQ-LDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++V ++NDN+P  +         L + EN+  G      + +D D     +  +     P    +  L    D+   +  L  +   DRE       TIK  D G PP+ SS   R+ +LD NDNAP F      A + EN  +G  + Q+KA D D   NA   +      EV     R++  TG I  +   + E+ S    S    D   GT  K    +V + ++DMNDN+P    R    + H     +I E+V   T +  V+  D D  E N A+           + +    G     K F++++  LD EK   +T  I+A+D+G+P LSS+  ++++V D+NDN P +     S+  +    +   G  + +  A D D GSN+EL Y +    + + +F + P TG + VK +L      ++ L ++  DRG+PSL+ T T  VN++
Sbjct:  155 QIEVQDINDNTPNFASPVIT----LAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKD--RGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ---SVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVL 603          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 262.692 bits (670), Expect = 1.803e-71
Identity = 221/765 (28.89%), Postives = 361/765 (47.19%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CK-QVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVE--VKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG--VTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N+++  L   +   F + GH   L+    +  ++ K G +  T++ IDRE +  C+ Q+  +P C +   +      +   P +++  I + DIND+ P  N  + ++TL IPE++ I S F +P A D D GP+ V  SY +    + +  F L+V        +   +  LIV+G LDRE+   Y + I   DGG PP +    + + V D ND++P+F+ +      L EN+ I   +    A D D      + ++F    E  V +   L   +G + +Q  +D E   +  F+V   D G +  S   +  V V ++NDN+P I ++          +  +SE+      +  V V+D D+      V C +  D P  + + S    +++ K+ L+T    D E        I   D+G PP  S+ + ++ ++DVNDNAPVF          EN   G +I ++ A D D+  NA   + L+P+      F I  ETG+I  K   + E+   YE+     D    SL+GT       V +N+ D NDN P+F    Y+FS+ EN+ + +P+  V   D D  E N  ++         S+ +  G  V Q+G   + SS   DRE+  ++TF + A+D G P  S+   + I V D NDN P +I    + +H  +T    +G  V +  A+D D G N+EL Y I   N    +FQ+   +G++ +++ +       HRL + V DRG P
Sbjct:   66 EEQPPNTLIGSLAADY--GFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDP-CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP--NFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA-SYELQAGPEAQELFGLQVA-----EDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFE-RPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA-VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGT-----ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE-NAQVQL--------SVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-YITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNP-YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 800          

HSP 2 Score: 158.688 bits (400), Expect = 1.389e-38
Identity = 128/464 (27.59%), Postives = 211/464 (45.47%), Query Frame = 1
Query: 1216 EVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP----IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHK-VFGKVDLNIEDMNDNSP----RFDKDIYH----FSIYENVNSGTPIDRVEAKDSDISE-------INKAIRYNFKPGTDKSILKHIGVTQDGKIFVR-SSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++V ++NDN+P  +         L + EN+  G      + +D D     +  +     P    +  L    D+   +  L  +   DRE       TIK  D G PP+ SS   R+ +LD NDNAP F      A + EN  +G  + Q+KA D D   NA   +      EV     R++  TG I  +   + E+ S    S    D   GT  K    +V + ++DMNDN+P    R    + H     +I E+V   T +  V+  D D  E       +   + +  +  ++       G     K F++ ++ LD EK   +T  I+A+D+G+P LSS+  ++++V D+NDN P +     S+  +    +   G  + +  A D D GSN+EL Y +    + + +F + P TG + VK +L      ++ L ++  DRG+PSL+ T T  VN++
Sbjct:  155 QIEVQDINDNTPNFASPVIT----LAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKD--RGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASE------TGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ---SVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVL 603          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 256.914 bits (655), Expect = 5.445e-70
Identity = 222/755 (29.40%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   +       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP AVD D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDRE++  Y + +   DGG P  S    + + VTD ND+ P FK +  I +S+ EN  + + +    A D D  +   + FSF +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V +VNDN P I ++       + + +SEN      I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  +I EN + G  + ++ A D D+  NA   + L PD+   F ++  TG +      + E+  +Y  +    D+           V ++I D NDNSP F  + Y+F + EN+     +  +   D D  + +           D +I    GV +    F      DREK  S+TFY+ A D G  + SSSA + I V D+NDN P +I P  + ++  +      G  V +  A D D G N+E++Y I   N+ RD+F ++  TG++ +     V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-IFRLVKIRFLIE--DINDNAPLFPA--TVINISIPENSAINSKYTLPAAVDPDVGINGV-QNYELIKSQN---IFGLDVI-----ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPF-RLRPV---FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-TVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF------DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT-RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 257.299 bits (656), Expect = 1.521e-69
Identity = 222/755 (29.40%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   +       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP AVD D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDRE++  Y + +   DGG P  S    + + VTD ND+ P FK +  I +S+ EN  + + +    A D D  +   + FSF +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V +VNDN P I ++       + + +SEN      I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  +I EN + G  + ++ A D D+  NA   + L PD+   F ++  TG +      + E+  +Y  +    D+           V ++I D NDNSP F  + Y+F + EN+     +  +   D D  + +           D +I    GV +    F      DREK  S+TFY+ A D G  + SSSA + I V D+NDN P +I P  + ++  +      G  V +  A D D G N+E++Y I   N+ RD+F ++  TG++ +     V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-IFRLVKIRFLIE--DINDNAPLFPA--TVINISIPENSAINSKYTLPAAVDPDVGINGV-QNYELIKSQN---IFGLDVI-----ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPF-RLRPV---FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-TVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF------DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT-RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 257.299 bits (656), Expect = 1.790e-69
Identity = 222/755 (29.40%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   +       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP AVD D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDRE++  Y + +   DGG P  S    + + VTD ND+ P FK +  I +S+ EN  + + +    A D D  +   + FSF +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V +VNDN P I ++       + + +SEN      I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  +I EN + G  + ++ A D D+  NA   + L PD+   F ++  TG +      + E+  +Y  +    D+           V ++I D NDNSP F  + Y+F + EN+     +  +   D D  + +           D +I    GV +    F      DREK  S+TFY+ A D G  + SSSA + I V D+NDN P +I P  + ++  +      G  V +  A D D G N+E++Y I   N+ RD+F ++  TG++ +     V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-IFRLVKIRFLIE--DINDNAPLFPA--TVINISIPENSAINSKYTLPAAVDPDVGINGV-QNYELIKSQN---IFGLDVI-----ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPF-RLRPV---FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-TVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF------DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT-RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 205.297 bits (521), Expect = 3.292e-53
Identity = 207/730 (28.36%), Postives = 339/730 (46.44%), Query Frame = 1
Query:  376 LFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSP--LSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIE--SETGKIF--SKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDI--FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL----ERTLTF 2520
            LF ++   G++R    +DRE + K +      K+  +    P    +  V    ++H+LD+ D++P + K +     +I E +PI +      A DLD G +N    Y++ +     +          ++N+KSG    +     LDRE  S  ++ + A D G P       V I V D+ND++P F +    N+++ EN  I ++I    A D D      + +S  S++         +   +GE+ L++ +D +     T  ++  DG      +++ + + V+++ND++P +     A  +++T+ EN   G+ +G V   D D           I K  +E S   + DE  +  L+KT K  DRE  +     +   D G P  ++S T  + + D+NDNAP F  +    TI E M  G+ I  LKA D D +    +R   + D EV F I    + G I   S  +   +   R EISA     L+G        V++ I+D+N ++P F+   +   I E+   G P+  ++A+D D  + N  I Y+     D S    I  +  G I V SS LDRE   +F+  + A D+ SP L++S  I++ + DINDN+P++     S     I+  +PVG   ++  A D D G N  + YF+ E +S   I  F+L+ T+G+L V   L         L I  +DRG PSL    E TLT 
Sbjct:  212 LFTLDTMSGEIRLAKSMDREVLDKHI-----LKVTAYERVDPTISASTTV----VVHVLDVQDNSPIFEKDSYFG--EIREDAPIGTTVLSVFARDLDSG-ENGEIEYSLGEGNGKNLL---------AINAKSG---VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASD-SYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLRERIDAKNS-PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL----IAAQKMITLEENVAIGEEVGRVYAIDEDSGPN------GIIKYSMEGSEDFIIDE--DSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE-EADREV-FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRC-----VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD-NARIVYSI----DSSQFFRIDPSS-GDISV-SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS---SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 882          

HSP 2 Score: 145.206 bits (365), Expect = 1.268e-34
Identity = 168/666 (25.23%), Postives = 292/666 (43.84%), Query Frame = 1
Query:  496 HPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDS--------SDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVT-DGKHFTSIYVE----VKVLNVNDNSPKISVQSFAGGELLTV-SENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN----FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK-HIGVTQDG--KIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR 2430
             P   +T P+ I    +++DINDHAPT      ++TL+  E+  I        A+D D GP+ + K Y++  ++D  +  D  +I  + L               LDRE  ++Y + +TA D G P L+    + + + DIND++P F  +   N+++ E     S I    A D D          +A+   FS L     ++     +   SGEL   K  D++ ++  + T Q    G+   +++++        N +  S KI   S  G  ++T+ +E+ + G +   V   D+         F  ID    ++S  SD              DRE  +     +  SD   PP ++S    + + D+NDN+P F +    ATI E++ VGT   Q+ A D D   N    ++L   S       FR++  +G +      + E+ +   +  +  D    +      ++ L + D+NDN+P F++  Y   I EN   G+ +  + A+D+D  + N  I +    G D  +        Q+G  +I  R ++ D E   +  F+ +   +G   LSS+  ++I V D+NDN P        +N  +   +V +  ++    A D DQ  N+ L+YF+ E     D+ + E  TG + VK+
Sbjct:  456 QPALSSTVPLTI----NVIDINDHAPTLIAAQKMITLE--ENVAIGEEVGRVYAIDEDSGPNGIIK-YSMEGSEDFIIDEDSGLIKTTKL---------------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK-EYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSIL-----DIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-------FFRIDPSSGDISVSSD-------------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAA-SEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD-NADISFRIFGGADAKLFDIEEDAEQNGVVRILTR-AEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFD---NVQMARQIGFIPAFDPDQ--NATLEYFLEE----NDLIEAEKYTGKILVKQ 1056          

HSP 3 Score: 142.124 bits (357), Expect = 9.816e-34
Identity = 138/490 (28.16%), Postives = 224/490 (45.71%), Query Frame = 1
Query:  967 LHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQV---TDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEV-NFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDL--NIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQL 2397
            L E+T I +II    A    S     L +S ++  +      F L   SGE+ L KS+D E    +   V      D     S  V V VL+V DNSP     S+ G     + E++  G  + +V   D D          S +   +E S      +N         +++T    DRE  S     +  SD G P + S+    + ++DVNDNAPVF ++    TI EN+ +  +I  +KA DED   N    + +   S +    I+  TG++  +   +A+ S    I+A V  + +G    +   V L  N+ D+ND++P         ++ ENV  G  + RV A D D S  N  I+Y+ +   D  I +  G+ +  K+      LDRE    ++  + A D G+P+L++S  I + +KDINDN P +   D    ++ I+  +P G ++I  +A D D+  + ++ Y I E +  R++F +
Sbjct:  174 LPEDTPIETIIASVKASHASS---QPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFG----EIREDAPIGTTVLSVFARDLD----------SGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSP---ITA-VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSMEGSEDFIIDEDSGLIKTTKL------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEAD--REVFSI 628          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 171.4 bits (433), Expect = 1.180e-42
Identity = 166/557 (29.80%), Postives = 265/557 (47.58%), Query Frame = 1
Query:  895 VNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSP--LSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIE--SETGKIF--SKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDI--FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL----ERTLTF 2520
            V I V D+ND++P F +    N+++ EN  I ++I    A D D      + +S  S++         +   +GE+ L++ +D +     T  ++  DG      +++ + + V+++ND++P +     A  +++T+ EN   G+ +G V   D D           I K  +E S   + DE  +  L+KT K  DRE  +     +   D G P  ++S T  + + D+NDNAP F  +    TI E M  G+ I  LKA D D +    +R   + D EV F I    + G I   S  +   +   R EISA     L+G        V++ I+D+N ++P F+   +   I E+   G P+  ++A+D D  + N  I Y+     D S    I  +  G I V SS LDRE   +F+  + A D+ SP L++S  I++ + DINDN+P++     S     I+  +PVG   ++  A D D G N  + YF+ E +S   I  F+L+ T+G+L V   L         L I  +DRG PSL    E TLT 
Sbjct:    2 VEITVVDVNDNAPVFASD-SYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLRERIDAKNS-PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL----IAAQKMITLEENVAIGEEVGRVYAIDEDSGPN------GIIKYSMEGSEDFIIDE--DSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE-EADREV-FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRC-----VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD-NARIVYSI----DSSQFFRIDPSS-GDISV-SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS---SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 523          

HSP 2 Score: 144.821 bits (364), Expect = 1.413e-34
Identity = 168/666 (25.23%), Postives = 292/666 (43.84%), Query Frame = 1
Query:  496 HPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDS--------SDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVT-DGKHFTSIYVE----VKVLNVNDNSPKISVQSFAGGELLTV-SENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN----FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK-HIGVTQDG--KIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR 2430
             P   +T P+ I    +++DINDHAPT      ++TL+  E+  I        A+D D GP+ + K Y++  ++D  +  D  +I  + L               LDRE  ++Y + +TA D G P L+    + + + DIND++P F  +   N+++ E     S I    A D D          +A+   FS L     ++     +   SGEL   K  D++ ++  + T Q    G+   +++++        N +  S KI   S  G  ++T+ +E+ + G +   V   D+         F  ID    ++S  SD              DRE  +     +  SD   PP ++S    + + D+NDN+P F +    ATI E++ VGT   Q+ A D D   N    ++L   S       FR++  +G +      + E+ +   +  +  D    +      ++ L + D+NDN+P F++  Y   I EN   G+ +  + A+D+D  + N  I +    G D  +        Q+G  +I  R ++ D E   +  F+ +   +G   LSS+  ++I V D+NDN P        +N  +   +V +  ++    A D DQ  N+ L+YF+ E     D+ + E  TG + VK+
Sbjct:   97 QPALSSTVPLTI----NVIDINDHAPTLIAAQKMITLE--ENVAIGEEVGRVYAIDEDSGPNGIIK-YSMEGSEDFIIDEDSGLIKTTKL---------------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK-EYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSIL-----DIGDQGAILSVSGEL---KRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-------FFRIDPSSGDISVSSD-------------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAA-SEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD-NADISFRIFGGADAKLFDIEEDAEQNGVVRILTR-AEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFD---NVQMARQIGFIPAFDPDQ--NATLEYFLEE----NDLIEAEKYTGKILVKQ 697          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 150.214 bits (378), Expect = 3.758e-36
Identity = 191/718 (26.60%), Postives = 318/718 (44.29%), Query Frame = 1
Query:  352 FRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTW--NKVNNLMTLQIPEHSPINSAFRLPEAV--DLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTP-IDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKI-FVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDI-FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            FR+ D +  F I    G + T S +D E+I          K   F +   GK T++      IIH+ D ND AP +    V NL  L+  E   ++    +  ++  DLD G + +     +S N               ++NS +G+ LSLI L   DRE+ S +++LI A D G+P LS   ++ I V DIND++P F+      I + EN+ I S I   +A D D  DA  L++S  S   DE+T  F +   +G + +   ++ E    + F V+VTDG+  + + VE+ V + NDN P I+ ++      + V + + S + I  + V D D +  L     + +  + E    + E   K  L+T         +  +      D G    H ++   L       + PVF+ +    +++E+      +++            + R+ +      +  +E  TG + +K   +AEE S   +    T   +        K  + I D+NDNSPRFD+ +Y F++ E  NSG   I  V A+D D S     + Y    G          VT+ G+I  VR   LDRE    +   + AID+G P    +  + + V D +DN P +      + H+ +   V +G  VI+  A D D+ SN   +        G  I F+++  TG ++V  +L     +++R+ + + D
Sbjct: 1589 FRIQDNDYNFTISPFDGTIFTNSPLDFENI----------KTYRFNIT-AGKSTSQ-----VIIHVTDENDEAPRFITGDVVNLKVLE--ELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTS-----------LFAVNSTTGDILSLIPL---DREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELS-SYFIKISENSKIGSKIIRILATDKDK-DAE-LQYSLESN--DEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMINDRN----SDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSE----NGEITLKSPLQT---------AVPVRVTVSDDAG----HVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGD--------SIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTE--NSGPKLIGHVIARDIDRS---SRVFYEIVGGDAN---HEFMVTESGQIESVR--DLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF----SRIFHVEVPEDVRIGEPVIQLSASDADEHSNHRFEL----DGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTD 2222          

HSP 2 Score: 109.383 bits (272), Expect = 1.278e-23
Identity = 180/791 (22.76%), Postives = 328/791 (41.47%), Query Frame = 1
Query:  175 MTVMLKIVYTSITYLILFMVKRIT---SEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAGG-ELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHIL--DVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESS-----RYEISAYVTDSLEG-TFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPS 2499
            MT+ +      + +LI F +   T   SE +I+  + E+   N+I+  L       +      RL   N     +E+  +L   S +DRES         +  I + I+  P      P +I  +I +LD+ND++P +    ++  ++IPE +PI    ++  A D D G +     Y +    D     D    M      +S   L L V G LDRE +  Y + +TA+D GVP LS    +NI + DIND+ P F  +   +++L+ N   N+ +F   A D+DS++ + L +  L +     ++ F +   S E IL    + E      F V+  D       T++ + V +   N++ P I+++ +      + V     +G+ +  + +TD+D   G        +    E S  S  +R    + T+K  +       I   + +D G+ P        L I       +  + +      T++++   G+ +  ++    D     +F      +S+V F+I+   G I +  I     +S     R  +    T  +E   F KV  +        +  SP   K  Y F+ +++V+ GT I R+       ++I   I            +  +GV  DG +FV        K  +  F  + +   +   + ++ I + VK +N ++P        +  I++  + P+G    + +A+D D G +  + Y  +T+ +    IF L+ T+GSL   +       R++      KD G PS
Sbjct:    1 MTIRIFFSIFLLNHLIFFHLFNFTHQFSEETIKFSVSEDAKLNTIIGHLEAEIGYTY------RLSRGNSKIKFDEQTLELSVSSPLDRES---------ENAIDMLIITSP------PSIIHILIDVLDVNDNSPIFPI--DVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELV---DSLATVD---TMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIR---SLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPS--GPTSEMFSI---SDENILVTQNNTECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGN--EQSIFSLISRQSINILTVKHVENANQEQYILEFRAND-GQSPADRITRKELKIFFKKYVKSTQIHVERESHVTVEKDTVPGSFVAHVETNCTDM---CSFEL---ANSDV-FKIDPFNGIIVTSSILPEGVTSYHLPIRIHLPPPSTQLVEADVFVKVIQESVPKNLIRSSESPIHLKRAYTFTTWQDVSLGTVIGRLPK-----AQIYSTI----------DTVSELGVFPDGSVFVG-------KTITSDFVTLPVTLVNRNTTQTSIITLIVKPLNQHSPIC-----QITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPS 717          

HSP 3 Score: 104.76 bits (260), Expect = 2.964e-22
Identity = 160/682 (23.46%), Postives = 293/682 (42.96%), Query Frame = 1
Query:  532 KSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLR----VIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG--------------KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGK--VDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQD-GKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTL 2514
            K +IH+ DIND+ P +   +    ++I E+S I S                + +     K+KD E+++ L     + +   +N  +G    + V G ++RE+  +++  +   DG     S ++ V I V D ND+ P   ++   +I + + T    II V    D+D SD  +L+FS  ++             ++GE+ L+  L  +T +    TV    G              KHF     ++  ++V ++  +      A G+ +  S  S    H+      + + ++G+L    S+D                           E     +F I  +     P  +   + + I+D+NDN+P F  +  R  + EN     LI  + A+D D      F   +  D+   F + +E+G+I S    + E  S Y +   + ++++    +  G   V + + D +DN+PRF + I+H  + E+V  G P+ ++ A D+D    +   R+    G +    +   V ++ G +FV  S LD EK  S+   +  + +G+  + +S ++   VKD+NDN P  I   P    I+      +G    +F A D+D  +N +++Y +T P      F++EP+TG L   R      L +  L +   D G P L++T+
Sbjct: 1741 KILIHVGDINDNTPEFELSSYF--IKISENSKIGS---------------KIIRILATDKDKDAELQYSLESNDEITIPFRINVATG---WITVAGKVNREENEEFRFFVKVTDG---EKSSKVIVEIHVEDFNDNHPMINDRNS-DIFVPDPTRSVEIIHVINVHDLDKSD--HLKFSLNNSNL--------NLSENGEITLKSPL--QTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCSDHL------EMEKSTGILKTKSSLDA-------------------------EEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSG-PKLIGHVIARDIDRSSRV-FYEIVGGDANHEFMV-TESGQIESVRDLDRETKSEYHL---IVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHSNH---RFELDGGGEGIPFR---VDENTGMVFVNDS-LDFEKKQSYRIKV-KLTDGAWLIETSLFVN--VKDVNDNAP--IFEKPEYLFISEENSAEIG----QFHASDMDSENNGKIRYSVTSP-----YFKIEPSTGVLSRFRQQLPQPLMS--LKVTATDHGVPRLQKTV 2325          

HSP 4 Score: 101.293 bits (251), Expect = 3.435e-21
Identity = 103/401 (25.69%), Postives = 182/401 (45.39%), Query Frame = 1
Query: 1030 SDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLD---YETKMSYTFTVQVTDGKHFTSIY-VEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFL------LKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSE-VNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQI 2199
            ++ +++R+S +S   D +     +++ +G L  + SLD   Y   + +       D K  ++I    +K++++NDNSP+   Q +       V+ENS   + IG V+  D D +S    VF  I         +  +A ++F+      +++++  DRE  S     ++  D G+P +  + T  + +LD +DNAP F +      + E++ +G  + QL A D D   ++N RF L    E + FR++  TG +F     + E+   Y I   +TD        +F    +N++D+NDN+P F+K  Y F   EN      I +  A D D SE N  IRY+           +  +     +  R  Q  +   P  +  + A D+G P L  +    +
Sbjct: 1970 ANGDSIRYSIVSRCSDHLE----MEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYR----FNVTENS-GPKLIGHVIARDIDRSSR---VFYEI---------VGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF-SRIFHVEVPEDVRIGEPVIQLSASDADE--HSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLF----VNVKDVNDNAPIFEKPEYLFISEEN---SAEIGQFHASDMD-SENNGKIRYSVTS-------PYFKIEPSTGVLSRFRQ--QLPQPLMSLKVTATDHGVPRLQKTVLAHL 2329          

HSP 5 Score: 83.5741 bits (205), Expect = 9.806e-16
Identity = 98/349 (28.08%), Postives = 161/349 (46.13%), Query Frame = 1
Query:  385 IEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPV--MIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF--TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSP 1416
            +E+  G L+TKS +D E   +           L  +        KP+  + K+ I I+DIND++P +++   L    + E    NS  +L   V + R  D  ++ +      D   +F         + ++SG   S+     LDRE +S+Y +++ A+D G P   G   V + V D +D++PRF      ++ + E+  I   +    A D D  + +N RF      E      F + E +G + +  SLD+E K SY   V++TDG     TS++V VK  +VNDN+P      F   E L +SE  E+   IG    +D D +N+G   +  S+  P  ++ P
Sbjct: 1989 MEKSTGILKTKSSLDAEEYSE----------CLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQ--QLYRFNVTE----NSGPKLIGHV-IARDIDRSSRVFYEIVGGDANHEF---------MVTESGQIESV---RDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIF--HVEVPEDVRIGEPVIQLSASDAD--EHSNHRFELDGGGEG---IPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVK--DVNDNAP-----IFEKPEYLFISE--ENSAEIGQFHASDMDSENNG--KIRYSVTSPYFKIEP 2290          

HSP 6 Score: 70.0922 bits (170), Expect = 1.201e-11
Identity = 77/317 (24.29%), Postives = 137/317 (43.22%), Query Frame = 1
Query: 1591 FLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPG-TDKSILKHIGVTQ-DGKIFVR-SSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            F  E ++ ++ E+  + T+I  L+A     E+   +R   + +S++ F  ++    + S +    +  S   I   +  S     H     + +++ D+NDNSP F  D+    I E    G  +    A D D  +     +Y           +   G+ Q DG +F+  + +LDRE    ++  + AID G P LSSS ++ I + DINDN P +      +  + + ++     ++    A DLD   NS L Y I       ++F +  +  ++ V +  T   L+     +  +D G P L  TL   VN+
Sbjct:   27 FSEETIKFSVSEDAKLNTIIGHLEA-----EIGYTYRLS-RGNSKIKFDEQTLELSVSSPL----DRESENAIDMLIITSPPSIIH-----ILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF-----GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSI--SDENILVTQNNT-ECLQRCEFVVEARDSGVPPLSTTLNIVVNM 320          

HSP 7 Score: 51.6026 bits (122), Expect = 5.200e-6
Identity = 61/212 (28.77%), Postives = 93/212 (43.87%), Query Frame = 1
Query: 1189 GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGEL-----------LTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATI--KENMAVGTLIYQLKAQDEDTEL-NANFRFYLQPDSEVNFRIESETGKI 1761
            GK  TS +V + V  VN N+ + S+ +     L           + V EN+  G   G +   D D  SGL  V         ++   SD+    F        L++LKAFD E      F  +  D G P K ++  + + I DVNDN P F +    ATI  K N  V      ++A D D ++ N   +++L    +  F+++ ETGK+
Sbjct:  594 GKTITSDFVTLPVTLVNRNTTQTSIITLIVKPLNQHSPICQITEIHVLENAPIGTIFGRIQARDED--SGLSGVVS------YKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAI----VQANDNDVDVKNQKLQYHLLNYHDF-FQLDKETGKV 792          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 143.28 bits (360), Expect = 4.734e-34
Identity = 186/714 (26.05%), Postives = 317/714 (44.40%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPD-NVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQ--IPINISLHENTAINSIIFVFVAEDIDSSDANN------LRFSFLSTTEDEVTQTFFLKEKSG----ELILQKSLDYETKMSYTFTVQVTD--GKHFTSIYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSE--SGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSD-------TGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFS-IYENVNSGTPIDRVEAKDSDISEINKAIRYNFK-PGTDK--SILKHIGVTQDGKIFVRSSQLDREKN---PSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKF---EAKDLDQGS--NSELQYFITEPN--SGRDIFQLEPTTGSLYVKRTL--TVHDLRTHRLNILVKDRGNPSLE--RTLTFKV 2526
            + ++DIND++P + + +      +     + ++     A D D   +  +T S  I      E + DL       +N +SG E++LI    +   K  ++   + A D G+P  L    +V + V D    +P+++        I++ EN  +N +I    A  + S D+ N      L  S     + E     F K ++G    E+++ + LDYE   +YT T+  TD   +  ++    V+V +VND  P+ +V  F G   E +T +E+ E  +G+ I  V   D D +     V   I      +   + E    F +  L         FDRE     I T++ SD           P   +   ++ I DVNDNAP F  +     +KE+   G  +  +KA D D   N  +         + F + +++G IF K   + E S +Y +    +D      H     V ++IED+NDN+P+F++  Y  + I E+V+    +  V A D+D  E +  I Y  +  G D+   I K+ G  +     V++  LDR+     PS+ F + AID+    L   A +Q+ V+DINDN+P  I P+    +I      P+  + + F   +A+D D  +  N+ ++Y I      +G  +F+++  TG ++  R+L   +   R   + +   DRG PS E    +T KV
Sbjct:  967 VEVVDINDNSPQFERPS--YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFF--ELVNRRSG-EITLIKPIPM---KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRA--VSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRI------VGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR----HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIE----LVKA--LDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFPERLFGYIEENRE-PIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKV 1651          

HSP 2 Score: 127.487 bits (319), Expect = 3.259e-29
Identity = 170/679 (25.04%), Postives = 286/679 (42.12%), Query Frame = 1
Query:  340 NDGHFRLL-----DQNKLFYIEEKFGKLRTKSRIDRESI---CKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPE---HSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSD-ANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKM---SYTFTVQVTD--GKHFTSIY-VEVKVLNVNDNSPKISVQSFAGGELLTVSENSE----SGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEA-----RNKFLLKTLKAFDREIGSYQIFTI--KCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNAN-FRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYE---------ISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPE-WIHPDPSL 2256
            N+ H+R++     ++ K F I+E  G++    + DRE I      V+A+     AL     PG        +K  I I D+ND+AP++ +   +  ++  E   H  I       +A DLD+   +    Y +     G + F +R        + SG   ++ V   LD E   QY +++ A DG     +    V I + D+ND++P+F+ Q      + E+  I  ++F   A D D  + ++ + +       DEV   F + + SG + L K+LD +      S+ F VQ  D  G        V+V V ++NDNSP    + F       + EN E     G +   V   D DD +       +I+  IV    ++ E+     +N   +  +++ DREI S + F I  + +D G P +       + + D+NDNAP F       +++E   +G  +    A D D E   N F + L  +S+  +    +  K  S  +   ++   YE         +   V+D      H     V + + D ND++P       H  + E+V  GT I R  A D D  +  +     F+        +   + QDG + V +  LDRE    +   I A DN +        + + ++D+NDN PE +  P P +
Sbjct: 1253 NEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL-----PGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI-----KAHDLDK---HSNLRYHLIGAGGGRIPFGVR--------TDSG---TIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG-----YIEENREPIHSDGVYFMDVQARDFDDPT---TENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR----HDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTAR-----FRINRQSDPKRQFTIDQDGTLRV-AHTLDREDIAVYNLIIEAYDNSNNI--GRQMVAVYLQDVNDNGPEPYTVPRPCI 1880          

HSP 3 Score: 85.8853 bits (211), Expect = 1.889e-16
Identity = 147/583 (25.21%), Postives = 250/583 (42.88%), Query Frame = 1
Query:  895 VNIEVTDINDHSPRFKNQ-IPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNV--NDNSPKISVQSFAGGELLTVSENS---ESGQHIGAVVVTDADDNSGLLPVFCSI--DKPIVELSPLS-DEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSR----YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRF-DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK----SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNG------SPTLSSSAYIQIEVKDINDNTPEWIHPDPS----LNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY--FITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTH-RLNILVK--DRGNPSLERTLTFKVNIV 2535
            + I V DI D  P F N  +P+   +  N  I  I++ FVA D      +N+ +  +         +F +  KSG ++      YE   +Y  + Q  D     + TS   EV +L +  ++  P+ + Q +     +TVSE++    S   + A      +D     P+  S+  D P  E      D +     L  L  FD +    ++  +K +   E  + S     + I DVNDN P F      A ++E++ +   I ++ A D+DT  N+   + +      NF I S  G+I +K+  +A++ +     Y  +    D  E         + +  E+ ND S  F     Y   + E+   GTP+ +++A+D+D  E+  +        T K    SI +H G+ +  +  V ++ L   +NP     +I  D+G      S T +S A + I ++D+N+N PE+  PD +    +  I    +      ++K EA D D  +N ++ Y  + T+  S R  F ++  TG L       V D  T  R ++ VK  DRG+  L     F V +V
Sbjct:  409 IRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIP---AGSFIVDPKSG-VVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYE----VTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFD-DPALPKLHKLKVT-AREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVK-LRHGVSAADLAEAENP-INLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF--PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES-RKAFVIDRQTGVL-TPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVV 970          

HSP 4 Score: 85.5001 bits (210), Expect = 2.496e-16
Identity = 163/732 (22.27%), Postives = 294/732 (40.16%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTI-----SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQT--FFLKEKSGELILQKSL------DYETKMSYTFTVQVTDGK--------HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIV-ELSPLSDEARNKFLLKTLKA---------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDS--------EVNF--RIESETGKI---------FSKIIFN--AEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKD---IYHFSIYENVNSGTPIDR---VEAKDSDISEINKAIRYNFKPGTD-KSILKHIGVTQDGKIFVR---SSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEW------------IHPDPSLNHINITYHVPVGHEVIKFEAKDLDQ-GSNSELQYFITEPNSGRDI--FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            I I D+ND+ PT+ +   L T Q+ E  P+N       AVD D G DN   +Y++     S N +GE+   +R      L++   NE   +            Y+  +TA D G P  LS    ++I   + ND S  F         + E+    + +    A D   +D + + +SF+        +   F + E +G + L+  +      + E  ++ T  VQ  DG         H +   + + + +VN+N P+         ++  + E +        V V   DD+S       S +  IV  L     E+R  F++              FDRE    +  T+K +D G+ P        + ++D+NDN+P F       ++    AVGT +  + A D D   NA   + L+ D+        +++F   +   +G+I           K IFN  A+++        + ++L+ +      +V LN+ D    +P++          ++ ENV     I R   V + DS  S++   +  +  PG   +S  +     ++G  +V       LD E+  ++T  + A D  S   S+  ++ +EV+D+ND  P++            + P+  L   N       G  ++  +A D D  G  +E+ Y I    +G +   F+++  TG ++         +  + L +   DR   +L
Sbjct:  630 IRIDDVNDNVPTFTR--PLYTAQVREDIPLNQTILKVTAVDKDTG-DNSRITYSVDNHNFSINSNGEISAKVR------LDADQLNERHFV------------YRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQ-DDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP-DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDS-------SANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNG-------IPEALQSS-----AQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTN-------GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          

HSP 5 Score: 81.6481 bits (200), Expect = 3.686e-15
Identity = 113/419 (26.97%), Postives = 178/419 (42.48%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINS---AFRLPEAVDLDR-GPDNVTKSYTISKNK--DGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLIT--AMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDE---VTQTFFLKEKS-GELILQKSLDYE---TKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFL-----LKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSR----LHILDVNDNAPVFLNEPMRATIKENMAVGTL-IYQLKAQDEDT-ELNANFRFYLQP 1716
            +++ DIND++P + +   L         PI+S    F   +A D D    +N    Y I +NK  +GE  F +             N   +  +  LDRE  S+ + +I   A D GVP   G   V I+VTD+ND++P F+ +     S+ E   I + +  F A D D    +N+ F++  + E +   VT     K+ S G L +++ LDYE    +  +   ++V+DG+H     V V +++ ND++P I      G     V E+   G  IG    TD D          + D     ++  SD  R   +     L+     DRE I  Y +         E   +S+   R    +++ DVNDN P     P     +EN  V  L   +++A D DT E    F   + P
Sbjct: 1534 VNVRDINDNSPIFPE--RLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRI-----------DQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFE-KTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-----GATEHRVREDVPRGTSIGRYTATDRD----------AGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLII-------EAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSP 1915          

HSP 6 Score: 57.3806 bits (137), Expect = 8.146e-8
Identity = 76/332 (22.89%), Postives = 137/332 (41.27%), Query Frame = 1
Query: 1546 TSRLHILDVNDNAPVFLNEP--MRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKI---FSKIIFNAEESSRYEISAYVTD--SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKA---IRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLR----THRLNILVKDRGNP 2496
            T R+H+ D+ D  P F+N P  M A +  N  +G ++YQ  A+DE  + ++N  +  +      +F ++ ++G +   +SK     E    Y ISA   D    + T  ++     L I   ++  P+F K  Y  ++ E+      +  V+A+     E  ++   I Y+ +  T +   K   +     I   +  LD +       + + +        S   + I + D+NDN P +  P   L    +   +P+   ++K  A D D G NS + Y +   N     F +  + G +  K  L    L      +R N+  +D G P
Sbjct:  408 TIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSGVVRTGWSKY----ERGDTYRISAQAMDLSPSDNTTSQLSEVAILEIL-ADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRP---LYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEP 724          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 143.28 bits (360), Expect = 4.734e-34
Identity = 186/714 (26.05%), Postives = 317/714 (44.40%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPD-NVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQ--IPINISLHENTAINSIIFVFVAEDIDSSDANN------LRFSFLSTTEDEVTQTFFLKEKSG----ELILQKSLDYETKMSYTFTVQVTD--GKHFTSIYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSE--SGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSD-------TGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFS-IYENVNSGTPIDRVEAKDSDISEINKAIRYNFK-PGTDK--SILKHIGVTQDGKIFVRSSQLDREKN---PSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKF---EAKDLDQGS--NSELQYFITEPN--SGRDIFQLEPTTGSLYVKRTL--TVHDLRTHRLNILVKDRGNPSLE--RTLTFKV 2526
            + ++DIND++P + + +      +     + ++     A D D   +  +T S  I      E + DL       +N +SG E++LI    +   K  ++   + A D G+P  L    +V + V D    +P+++        I++ EN  +N +I    A  + S D+ N      L  S     + E     F K ++G    E+++ + LDYE   +YT T+  TD   +  ++    V+V +VND  P+ +V  F G   E +T +E+ E  +G+ I  V   D D +     V   I      +   + E    F +  L         FDRE     I T++ SD           P   +   ++ I DVNDNAP F  +     +KE+   G  +  +KA D D   N  +         + F + +++G IF K   + E S +Y +    +D      H     V ++IED+NDN+P+F++  Y  + I E+V+    +  V A D+D  E +  I Y  +  G D+   I K+ G  +     V++  LDR+     PS+ F + AID+    L   A +Q+ V+DINDN+P  I P+    +I      P+  + + F   +A+D D  +  N+ ++Y I      +G  +F+++  TG ++  R+L   +   R   + +   DRG PS E    +T KV
Sbjct:  967 VEVVDINDNSPQFERPS--YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFF--ELVNRRSG-EITLIKPIPM---KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRA--VSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRI------VGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR----HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIE----LVKA--LDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFPERLFGYIEENRE-PIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKV 1651          

HSP 2 Score: 127.487 bits (319), Expect = 3.259e-29
Identity = 170/679 (25.04%), Postives = 286/679 (42.12%), Query Frame = 1
Query:  340 NDGHFRLL-----DQNKLFYIEEKFGKLRTKSRIDRESI---CKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPE---HSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSD-ANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKM---SYTFTVQVTD--GKHFTSIY-VEVKVLNVNDNSPKISVQSFAGGELLTVSENSE----SGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEA-----RNKFLLKTLKAFDREIGSYQIFTI--KCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNAN-FRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYE---------ISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPE-WIHPDPSL 2256
            N+ H+R++     ++ K F I+E  G++    + DRE I      V+A+     AL     PG        +K  I I D+ND+AP++ +   +  ++  E   H  I       +A DLD+   +    Y +     G + F +R        + SG   ++ V   LD E   QY +++ A DG     +    V I + D+ND++P+F+ Q      + E+  I  ++F   A D D  + ++ + +       DEV   F + + SG + L K+LD +      S+ F VQ  D  G        V+V V ++NDNSP    + F       + EN E     G +   V   D DD +       +I+  IV    ++ E+     +N   +  +++ DREI S + F I  + +D G P +       + + D+NDNAP F       +++E   +G  +    A D D E   N F + L  +S+  +    +  K  S  +   ++   YE         +   V+D      H     V + + D ND++P       H  + E+V  GT I R  A D D  +  +     F+        +   + QDG + V +  LDRE    +   I A DN +        + + ++D+NDN PE +  P P +
Sbjct: 1253 NEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL-----PGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI-----KAHDLDK---HSNLRYHLIGAGGGRIPFGVR--------TDSG---TIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV---FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG-----YIEENREPIHSDGVYFMDVQARDFDDPT---TENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR----HDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTAR-----FRINRQSDPKRQFTIDQDGTLRV-AHTLDREDIAVYNLIIEAYDNSNNI--GRQMVAVYLQDVNDNGPEPYTVPRPCI 1880          

HSP 3 Score: 85.8853 bits (211), Expect = 1.889e-16
Identity = 147/583 (25.21%), Postives = 250/583 (42.88%), Query Frame = 1
Query:  895 VNIEVTDINDHSPRFKNQ-IPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNV--NDNSPKISVQSFAGGELLTVSENS---ESGQHIGAVVVTDADDNSGLLPVFCSI--DKPIVELSPLS-DEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSR----YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRF-DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK----SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNG------SPTLSSSAYIQIEVKDINDNTPEWIHPDPS----LNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY--FITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTH-RLNILVK--DRGNPSLERTLTFKVNIV 2535
            + I V DI D  P F N  +P+   +  N  I  I++ FVA D      +N+ +  +         +F +  KSG ++      YE   +Y  + Q  D     + TS   EV +L +  ++  P+ + Q +     +TVSE++    S   + A      +D     P+  S+  D P  E      D +     L  L  FD +    ++  +K +   E  + S     + I DVNDN P F      A ++E++ +   I ++ A D+DT  N+   + +      NF I S  G+I +K+  +A++ +     Y  +    D  E         + +  E+ ND S  F     Y   + E+   GTP+ +++A+D+D  E+  +        T K    SI +H G+ +  +  V ++ L   +NP     +I  D+G      S T +S A + I ++D+N+N PE+  PD +    +  I    +      ++K EA D D  +N ++ Y  + T+  S R  F ++  TG L       V D  T  R ++ VK  DRG+  L     F V +V
Sbjct:  409 IRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIP---AGSFIVDPKSG-VVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYE----VTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFD-DPALPKLHKLKVT-AREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVK-LRHGVSAADLAEAENP-INLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF--PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES-RKAFVIDRQTGVL-TPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVV 970          

HSP 4 Score: 85.5001 bits (210), Expect = 2.496e-16
Identity = 163/732 (22.27%), Postives = 294/732 (40.16%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTI-----SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQT--FFLKEKSGELILQKSL------DYETKMSYTFTVQVTDGK--------HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIV-ELSPLSDEARNKFLLKTLKA---------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDS--------EVNF--RIESETGKI---------FSKIIFN--AEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKD---IYHFSIYENVNSGTPIDR---VEAKDSDISEINKAIRYNFKPGTD-KSILKHIGVTQDGKIFVR---SSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEW------------IHPDPSLNHINITYHVPVGHEVIKFEAKDLDQ-GSNSELQYFITEPNSGRDI--FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            I I D+ND+ PT+ +   L T Q+ E  P+N       AVD D G DN   +Y++     S N +GE+   +R      L++   NE   +            Y+  +TA D G P  LS    ++I   + ND S  F         + E+    + +    A D   +D + + +SF+        +   F + E +G + L+  +      + E  ++ T  VQ  DG         H +   + + + +VN+N P+         ++  + E +        V V   DD+S       S +  IV  L     E+R  F++              FDRE    +  T+K +D G+ P        + ++D+NDN+P F       ++    AVGT +  + A D D   NA   + L+ D+        +++F   +   +G+I           K IFN  A+++        + ++L+ +      +V LN+ D    +P++          ++ ENV     I R   V + DS  S++   +  +  PG   +S  +     ++G  +V       LD E+  ++T  + A D  S   S+  ++ +EV+D+ND  P++            + P+  L   N       G  ++  +A D D  G  +E+ Y I    +G +   F+++  TG ++         +  + L +   DR   +L
Sbjct:  630 IRIDDVNDNVPTFTR--PLYTAQVREDIPLNQTILKVTAVDKDTG-DNSRITYSVDNHNFSINSNGEISAKVR------LDADQLNERHFV------------YRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQ-DDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFP-DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDS-------SANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNG-------IPEALQSS-----AQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTN-------GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          

HSP 5 Score: 81.6481 bits (200), Expect = 3.686e-15
Identity = 113/419 (26.97%), Postives = 178/419 (42.48%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINS---AFRLPEAVDLDR-GPDNVTKSYTISKNK--DGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLIT--AMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDE---VTQTFFLKEKS-GELILQKSLDYE---TKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFL-----LKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSR----LHILDVNDNAPVFLNEPMRATIKENMAVGTL-IYQLKAQDEDT-ELNANFRFYLQP 1716
            +++ DIND++P + +   L         PI+S    F   +A D D    +N    Y I +NK  +GE  F +             N   +  +  LDRE  S+ + +I   A D GVP   G   V I+VTD+ND++P F+ +     S+ E   I + +  F A D D    +N+ F++  + E +   VT     K+ S G L +++ LDYE    +  +   ++V+DG+H     V V +++ ND++P I      G     V E+   G  IG    TD D          + D     ++  SD  R   +     L+     DRE I  Y +         E   +S+   R    +++ DVNDN P     P     +EN  V  L   +++A D DT E    F   + P
Sbjct: 1534 VNVRDINDNSPIFPE--RLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRI-----------DQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFE-KTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-----GATEHRVREDVPRGTSIGRYTATDRD----------AGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLII-------EAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSP 1915          

HSP 6 Score: 57.3806 bits (137), Expect = 8.146e-8
Identity = 76/332 (22.89%), Postives = 137/332 (41.27%), Query Frame = 1
Query: 1546 TSRLHILDVNDNAPVFLNEP--MRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKI---FSKIIFNAEESSRYEISAYVTD--SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKA---IRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLR----THRLNILVKDRGNP 2496
            T R+H+ D+ D  P F+N P  M A +  N  +G ++YQ  A+DE  + ++N  +  +      +F ++ ++G +   +SK     E    Y ISA   D    + T  ++     L I   ++  P+F K  Y  ++ E+      +  V+A+     E  ++   I Y+ +  T +   K   +     I   +  LD +       + + +        S   + I + D+NDN P +  P   L    +   +P+   ++K  A D D G NS + Y +   N     F +  + G +  K  L    L      +R N+  +D G P
Sbjct:  408 TIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSGVVRTGWSKY----ERGDTYRISAQAMDLSPSDNTTSQLSEVAILEIL-ADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRP---LYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEP 724          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 242.276 bits (617), Expect = 1.223e-64
Identity = 207/719 (28.79%), Postives = 342/719 (47.57%), Query Frame = 1
Query:  385 IEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGN-ELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKH--FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG----VTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDP---SLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR--TLTVHDLRTHRLNILVKDRGN 2493
            I+   G++RTK ++DRE+             +L  +   G+       I+ ++ + D ND+APT+ + +  M ++ PE++P      L  A DLD  P N  +   +S N +   +        SS   + G   L L + G LDRE    Y +LI A+DGG PPL G + VNI + D+ND+ P F NQ     ++ EN  + + +    A D D+ D N L    ++  + +  Q F +  ++G + + K+LD+ETK  +   V   D G+    T+ +V ++V +VNDN P I+V   +      +SE+++ G+ +  + V D D  +    V  +++      + L+    + +L+      DREI S    ++  +D G PP H+S +  L I DVNDN P F  +   A + E    GT + Q+ A D D  LN+   + L    E +   F+I+ +TG I ++   + E     +++    D            V + I D+NDN P FD+  Y+ S+ EN   G  I +V A D D   +N  + Y    G      KH+      +  G+I + + +LD E+  S+ F ++A D G   LS++A I++++ D+NDN P + +P     SL              ++   A D D G+  ++ Y I   N    IF+++ +TG ++V R   L+V     H LNI   D GN
Sbjct:  125 IDRATGEIRTKVKLDRET---------RASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTS--MHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRL-------SSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF-NQSRYFATVPENATVGTSVLQVYASDTDA-DENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFA-LTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSST-ATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEG-----FKHLTEFEVRSASGEICI-AGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEA-GIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 2 Score: 191.045 bits (484), Expect = 1.273e-48
Identity = 181/691 (26.19%), Postives = 310/691 (44.86%), Query Frame = 1
Query:  523 VMIKSIIHILDINDHAPTWNKVNNLMTL-QIPEHSPINSAFRLPEAVDLDRGPDNVTK-SYTI-SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH--FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-------------QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP--NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
             MIK  + + D+ND+ P +      ++L + P+ S   S+  +   V  D    N  + SY I + N+ G  + D           +S  E+ ++   +L    Q  + + I+A DGG    + +  V + + D     P F+ +   N  + E+    +++   +A   D +  + +R+S  S   D     F ++  SG + + K LD+E K      +Q T G+   +    V ++V +VNDN+P+           ++V E++E G  + A    D D  S     +  + +    L   + +AR+  L+ + +  D E        +  +D G P   ++ T  + + DVNDN PVF  +     + E+ ++   I Q+ A D DT  NA   + +               D   +F I   +G I+ +   + E   RY+++   TD+     H    +V + + D NDN P+F K  Y F I EN+  G+ +  V A D D+ E N AIRY+  P  + S   H  VT  G+I  R   LDRE    +   + A D G+P  S+   ++I V D+NDN PE    DP  + +++    P G EV++  A D D G N+ + Y I +   + G  +F ++PT+G +  +  L   +   +RL +   D GNP  E     +V ++
Sbjct:  699 AMIK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRID-----------RSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE-KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVR----ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL--FAIDARSGHLILS-QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKT-RVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE-NAAIRYSLLP-INSSFQVH-PVT--GEISTREP-LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA--DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVL 1356          

HSP 3 Score: 156.762 bits (395), Expect = 5.591e-38
Identity = 144/524 (27.48%), Postives = 239/524 (45.61%), Query Frame = 1
Query:  760 SLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPI--VELSPLSDEARNKFLLKT------LKA-FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGT-FHKVFGKVDLNIEDMNDNSPRF-DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEW--------IHPDPSLNHI 2265
            S+ + SGN   + +   LD E +SQ  + I A  G  PP+ G  +VNIEV D+ND++P F+  + + IS+ E+  + + ++   A D DS  +  + +S +  +   +   F +  +SG LIL + LDYE+   +T  V  TDG      T++ + V V +VNDN P      ++    + VSE+      I  V  +D D  +     +  +D  +  V  S  S +    F +        L+A  DRE       T+  +D G P  H+     + +LD NDN P F        I+EN+  G+++  + A D D   NA  R+ L P +  +F++   TG+I ++   + E    Y++     D  +GT        V +++ D+NDN+P   D      S+ E    GT + RV A D D  + N +I Y+   G D        +     +      LD E+   +   + A D G+P   +   +++EV D+NDN P +        +  D +L H+
Sbjct:  876 SIETNSGN---IRIAKPLDHEAKSQVLLNIQATLGE-PPVYGHTQVNIEVEDVNDNAPEFEASM-VRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL---FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYS----VNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-SFQVHPVTGEISTREPLDRELRELYDLVVEARD--QGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQ-NASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHV 1383          

HSP 4 Score: 142.51 bits (358), Expect = 1.307e-33
Identity = 168/707 (23.76%), Postives = 298/707 (42.15%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTK----SYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGG---VPPLSGELRVNIEVTDINDHSPRF-----KNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSL-----DYETKMSYTFTVQVTDGKH----FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTD--ADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSR-----------------------LHILDVNDNAPVFLNEPMRA-TIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTL-SSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDI-FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            I + D+ND+AP W +  + + LQ+ E +P+ +      A D D G +   +     Y    N+  E    L       ++S +G   +L +   LD E   +Y +++ A+D        L   + V + + D NDH+P F           ++ + + T I  ++   VA D DS D   L +     T       F +  ++G + L KSL     D E    +   +   D        +S+ + + V   ++N P+     +      T+ EN  SG  +  V        +N+ L     S + P    + L      + ++ T   FDRE  +  +  +   D       SS   R                       + + DVNDN+P F        ++ EN   G +I+ + A D D   NA+  + +   +  N F I+S +G++ ++ + + E+ SRY +    +D  +    +    + + +ED NDN+PRF    Y  S+ E+   GT + ++ A D+D+  +N  + Y+    T         +     +     +LDRE   S+ F ++A D G   + S++  +QI V DINDN P      +I   P+L        +  G  ++K +A D D G+N+E+ Y +   NS     F++ P+TG+L   ++L     +   L ++ +D+GNP
Sbjct: 1473 IEVADVNDNAPEWPQ--DPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSL-----FRMDSLTG---ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRA----TILENVPSGSFVLQVTAKSLHGAENANL-----SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPL-DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLG-VNARLVYSLANETQW----QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL--------IQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNP 2142          

HSP 5 Score: 140.969 bits (354), Expect = 3.293e-33
Identity = 167/680 (24.56%), Postives = 278/680 (40.88%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNN----LMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSG--NELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD--------------------------GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN----------SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHV------PVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR 2430
            + ILD NDHAP +   N+      +L I + + I        AVD D G DN   +Y I+   +GE +F         +NS++G    +  +     D EK  ++ ++I A D G P P    L +++ V   +++ PRF   +    ++ EN    S +    A+ +  ++  NL +   +   +++   F +  + G +  +   D E++ SY   V V D                          G+HF    + + V +VNDNSP+    S  G   L+V ENSE G  I  VV +D D+            G L    SID    ELS               +  DRE  S     I+ SD G+P     + +  + + D NDNAP F       +++E+  +GT + Q+ A D D  +NA   + L  +++  F I+ ++G I +    + E  + Y      TD            V +N+ D+NDN P F++  Y   +   +  G  + +V+A D+D+   N  I Y+     + ++     +         S  L  E        ++A D G+P  SS   I++ + +    T       P L   N TY V      P G  +++  A   D G   ++Q+     N    I  L+  +G + V +
Sbjct: 1590 LRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEITGG-NGEGRF--------RINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAV-YRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYG---LSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS--------------ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGA-NAEIVYSLN-AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGT-------PVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNED-GILSLDSLSGEIRVNK 2226          

HSP 6 Score: 133.265 bits (334), Expect = 7.854e-31
Identity = 166/695 (23.88%), Postives = 292/695 (42.01%), Query Frame = 1
Query:  532 KSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAV--------VVTDADDNS----GLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEP--PKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL----------QPDSEVNFRIESETGKIFSKIIFNAEESSRYEI-------SAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRF------DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKS---ILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSP-TLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            + I+ +LD ND+ P + K  +    +I E+    S   +  A DLD G             ++  +++ L  I  S        E+S      LDRE +  Y +++ A D G P  S  + V I V+D+ND++P   +     +S+ E     + +    A D D     ++ +S +   + +    F +   SG +  +  LD+E +  Y   V  +DG +    T   + V+VL++NDN P  +  S     +  V E++  G  +G++        VV ++ + S     +      + K ++E +   D  R+   L   +  DRE+ S     I+  DT     P+ S+ T ++ + DVNDNAP +  +P+   + E   VGT+I+   A D DT  N + ++ L          Q  +   FR++S TG +  +   + E    Y +       S+ VT+ L+ +       V L I D ND++P F              I +    G  +  + A D D  + N  + Y    G  +    I    G+ +  K    +++ D EK   F   I A D+G P    SS  + + V+  ++N P ++    ++    I  +VP G  V++  AK L    N+ L Y I       D+F ++   G +  +         ++ L + V+D
Sbjct: 1138 RVIVRVLDANDNDPKFQK--SKYEFRIEENLRRGSVVGVVTASDLDLG-------------ENAAIRYSLLPINSSFQVHPVTGEIS--TREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSL----VFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA--FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSV-----TVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGD-NGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATE-DVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQ---AVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPA-GVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRD 1798          

HSP 7 Score: 125.561 bits (314), Expect = 1.642e-28
Identity = 152/583 (26.07%), Postives = 247/583 (42.37%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPIN-ISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQS----FAGGELLTVSENSESGQ---HIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD-----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDI-YHFSIYENVNSGTPIDRVEAKDSDISEI-NKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNP-SFTFYIIAID-NGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHIN-ITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP---NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGN 2493
            +LDRE +  Y++ I A D GVP ++G   + +++ D+ND+ P F    P N +++ E T + ++I    A D+D+  A   R    ST + E    F L   SG+L+L++ LDYE +  Y   V  +D  H     + V+V + NDN+P    Q     FA   L  +SE SES      +  V  TDAD       V   I+      S           +  L+      G Y +  I   D G+P   SS   R+   D       FL    RA I E   +G+++ QL     D  L       +  + E  F +      +  K + + E +  Y++   ++       +          V + I D NDN P FD+   Y   I E       I +++A D+D     N  + Y+   G D+ +     VT  G +FV +++LD +    S+   I A D +    L S    ++E+ D NDN P++    P   +++ +  + PVG  V +  A DLD+G   +L Y I       S   +F+++  +G +           + + + +L  D G 
Sbjct: 2385 VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP---PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFA--ILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRII-AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-----IIAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVT--GVLFV-NNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG 2948          

HSP 8 Score: 103.219 bits (256), Expect = 1.019e-21
Identity = 129/462 (27.92%), Postives = 200/462 (43.29%), Query Frame = 1
Query:  370 NKLFYIEEKFGKLRTKSRIDRESICKQV------DANPDCKIALFILYHPGKRTTKPVMIKS----------IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF----TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEAR---NKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPV--FLNEPMRATIKENMAVGTLIYQLKAQDED 1677
            N LF+++ + G + T+ + DRES    V      DAN    ++   +    +R++  +   S           I + D+ND++P + +  +   L +PE+S          A DLD GP N    Y+I+    G          K S++S SG ELS      LDRE+ S+Y + I A D G P    G   + I V D ND++PRFK       S+ E+  + + +    A D D      L +S  + T+ +    F +  +SG +     LD E + SY F V  TDG  +     ++ V++ VL++NDN P      + G     V    + GQ +  V   DAD  +    V+ S++    E S +S + R   +   L   ++   E G      +   D G PP+ S     L I +     PV  F NE  R  +KEN   GT + Q+ A   D
Sbjct: 1764 NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRK--QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGLSVPENSE-PGVIHTVVASDLDEGP-NADLIYSITGGNLGN---------KFSIDSSSG-ELS---ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLS-KYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIG----QVPALIQPGQTLLKVQALDADLGANAEIVY-SLN---AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 9 Score: 98.2117 bits (243), Expect = 3.509e-20
Identity = 74/275 (26.91%), Postives = 126/275 (45.82%), Query Frame = 1
Query: 1723 EVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG-VTQDGKIFVR---SSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRD-IFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            E +  I+  TG+I +K+  + E  + Y + A     L G   +V     + ++D NDN+P F +   H    EN         + A+D D+   N   RYN   G      +      +DG +++    S  LDRE  P ++  I A+D G+P L     + I ++D+NDN P +   + S     +  +  VG  V++  A D D   N  ++Y I    S ++ +F+++P TG++Y+ + L       H L ++ KD G   LE T    + +
Sbjct:  120 ETDLAIDRATGEIRTKVKLDRETRASYSLVAI---PLSGRNIRVL----VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF---NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRV 383          

HSP 10 Score: 84.7297 bits (208), Expect = 5.479e-16
Identity = 180/763 (23.59%), Postives = 307/763 (40.24%), Query Frame = 1
Query:  274 VEECSNNSIVTDLNNRFHSNFNNDGHFR--LLDQN--KLFYIEEKF-GKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELR--VNIEVTDINDHSPRFKNQ--------IPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTV-------SENSESGQHIGAVVVT---DADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSR------LHILDVNDNAPVF-LNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDS---EVNFRIESETGKIFSKIIFNAEESSR-YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPG-TDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKD-----INDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTL 2436
            V E +N        + F S+  ++   R  ++D N    F IE  F G +RT   +DRE   + +      K+ +        + T    I+  + I+D+ND+ PT+   NNL+T  + E + + +      A D+D  P        ++     E   D+  +   +L+  SG    L++   LD E Q +Y++ + A D      + E R  + + V D ND++P F  Q        +P    + E+ +++  +    A D DS + NN +  ++     E  Q  F    S  ++          MS       + G +F  I  +        +S  + VQ+   G   +        ++ SE+   +G+VV+    DA D S  L +    ++   EL  L  +A     +  +K  DRE        +  S    PP  SS  S       + ILD NDN P+F  +    A I E   +   I QL+A D D E   N        S   E  F I+  TG +F     + +  ++ YE+     DS             L + D NDN P+F    Y   + EN   G+ + R  A D D     + + Y+  P  +D+S  K   V  +  +   +   D E+   +   ++A D G    S +  ++IE +D       + T  ++ P            +P G+ V +  A D D G +  + Y ++ P+S    F++  ++G++ +KR L
Sbjct: 2331 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDRE--IRDI-----YKLKIIATDEGVPQMTGTATIR--VQIVDVNDNQPTFPP-NNLVT--VSEATELGAVITSISANDVDTYP-------ALTYRLGAESTVDIENMSIFALDRYSGK---LVLKRRLDYELQQEYELDVIASDA-----AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADS-EGNNSKVIYII----EPAQEGFSVHPSNGVV-------SVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAP-LGSVVLQLGQDALDQS--LAIIAGNEESAFEL--LQSKA-----IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQ-LNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLP--------AAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH---FKVNRSSGAVLIKRKL 3032          

HSP 11 Score: 79.7221 bits (195), Expect = 1.816e-14
Identity = 65/243 (26.75%), Postives = 117/243 (48.15%), Query Frame = 1
Query: 1819 VTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGT-DKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS----GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVN 2529
            V  + +  F   + ++ + +ED NDNSP+F +  +  ++ E  N GT + +V A DSD    N  +RY+   G  D + +     +      VR++  LDRE    +   IIA D G P ++ +A I++++ D+NDN P +    P  N + ++    +G  +    A D+D  +   L Y +   ++       IF L+  +G L +KR L     + + L+++  D  + +    LT +VN
Sbjct: 2293 VARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPAFSG----IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF----PPNNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEA-RTVLTVRVN 2523          

HSP 12 Score: 79.337 bits (194), Expect = 2.299e-14
Identity = 141/580 (24.31%), Postives = 246/580 (42.41%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRF-KNQIPINISLHENTAINSIIFVFVAE----DIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS--LDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGL---LPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNE---------PMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKI---FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRV--EAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTF-YIIAIDNGSP-----TLSSSAYIQIEVKDINDNTPEWIHPDPSLNH-INITYHVPVGHEVIKFEAKDLDQGS--NSELQYFITEPNSGRD--IFQLEPTTGSLYVKRTL 2436
            L   + ++ +V++ A     P L+    + IE+ D ND+SP+F + Q    +S   N         FVA+    D D+     LR+  +    D      F+ E +   I++ +  LD E +  Y   +  TD    +   +  + V++++VNDN P     +F    L+TVSE +E G  I ++   D D    L   L    ++D   + +  L D    K +LK  +  D E+       +  SD     + +  T R++  D NDNAPVFL +         P  + I E+++V   +  + A D D+E N +   Y+   ++  F +    G +    S++      S  Y +     D+ +    K    + +   D      +F ++ Y   I E    G+ + ++  +A D  ++ I          G ++S  + +      K  V    LDRE+N  +    +++  +G P       SS   + I + D NDN P +   D S  +   I+   P+ + + + +A D DQ +  NSE+ Y IT   SG D  +F ++  TG L+V   L
Sbjct: 2280 LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKG------TFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP-----TFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFAL-DRYSGKLVLK--RRLDYELQQEYELDVIASDAAHEAR-TVLTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPAL-KSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAII---------AGNEESAFELL----QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF---DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDIT---SGNDEHMFTIDLVTGVLFVNNRL 2818          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 242.276 bits (617), Expect = 1.223e-64
Identity = 207/719 (28.79%), Postives = 342/719 (47.57%), Query Frame = 1
Query:  385 IEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGN-ELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKH--FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG----VTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDP---SLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR--TLTVHDLRTHRLNILVKDRGN 2493
            I+   G++RTK ++DRE+             +L  +   G+       I+ ++ + D ND+APT+ + +  M ++ PE++P      L  A DLD  P N  +   +S N +   +        SS   + G   L L + G LDRE    Y +LI A+DGG PPL G + VNI + D+ND+ P F NQ     ++ EN  + + +    A D D+ D N L    ++  + +  Q F +  ++G + + K+LD+ETK  +   V   D G+    T+ +V ++V +VNDN P I+V   +      +SE+++ G+ +  + V D D  +    V  +++      + L+    + +L+      DREI S    ++  +D G PP H+S +  L I DVNDN P F  +   A + E    GT + Q+ A D D  LN+   + L    E +   F+I+ +TG I ++   + E     +++    D            V + I D+NDN P FD+  Y+ S+ EN   G  I +V A D D   +N  + Y    G      KH+      +  G+I + + +LD E+  S+ F ++A D G   LS++A I++++ D+NDN P + +P     SL              ++   A D D G+  ++ Y I   N    IF+++ +TG ++V R   L+V     H LNI   D GN
Sbjct:  125 IDRATGEIRTKVKLDRET---------RASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTS--MHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRL-------SSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF-NQSRYFATVPENATVGTSVLQVYASDTDA-DENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFA-LTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSST-ATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEG-----FKHLTEFEVRSASGEICI-AGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEA-GIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN 804          

HSP 2 Score: 191.045 bits (484), Expect = 1.273e-48
Identity = 181/691 (26.19%), Postives = 310/691 (44.86%), Query Frame = 1
Query:  523 VMIKSIIHILDINDHAPTWNKVNNLMTL-QIPEHSPINSAFRLPEAVDLDRGPDNVTK-SYTI-SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH--FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-------------QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP--NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
             MIK  + + D+ND+ P +      ++L + P+ S   S+  +   V  D    N  + SY I + N+ G  + D           +S  E+ ++   +L    Q  + + I+A DGG    + +  V + + D     P F+ +   N  + E+    +++   +A   D +  + +R+S  S   D     F ++  SG + + K LD+E K      +Q T G+   +    V ++V +VNDN+P+           ++V E++E G  + A    D D  S     +  + +    L   + +AR+  L+ + +  D E        +  +D G P   ++ T  + + DVNDN PVF  +     + E+ ++   I Q+ A D DT  NA   + +               D   +F I   +G I+ +   + E   RY+++   TD+     H    +V + + D NDN P+F K  Y F I EN+  G+ +  V A D D+ E N AIRY+  P  + S   H  VT  G+I  R   LDRE    +   + A D G+P  S+   ++I V D+NDN PE    DP  + +++    P G EV++  A D D G N+ + Y I +   + G  +F ++PT+G +  +  L   +   +RL +   D GNP  E     +V ++
Sbjct:  699 AMIK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRID-----------RSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE-KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVR----ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL--FAIDARSGHLILS-QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKT-RVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE-NAAIRYSLLP-INSSFQVH-PVT--GEISTREP-LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA--DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVL 1356          

HSP 3 Score: 156.762 bits (395), Expect = 5.591e-38
Identity = 144/524 (27.48%), Postives = 239/524 (45.61%), Query Frame = 1
Query:  760 SLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPI--VELSPLSDEARNKFLLKT------LKA-FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGT-FHKVFGKVDLNIEDMNDNSPRF-DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEW--------IHPDPSLNHI 2265
            S+ + SGN   + +   LD E +SQ  + I A  G  PP+ G  +VNIEV D+ND++P F+  + + IS+ E+  + + ++   A D DS  +  + +S +  +   +   F +  +SG LIL + LDYE+   +T  V  TDG      T++ + V V +VNDN P      ++    + VSE+      I  V  +D D  +     +  +D  +  V  S  S +    F +        L+A  DRE       T+  +D G P  H+     + +LD NDN P F        I+EN+  G+++  + A D D   NA  R+ L P +  +F++   TG+I ++   + E    Y++     D  +GT        V +++ D+NDN+P   D      S+ E    GT + RV A D D  + N +I Y+   G D        +     +      LD E+   +   + A D G+P   +   +++EV D+NDN P +        +  D +L H+
Sbjct:  876 SIETNSGN---IRIAKPLDHEAKSQVLLNIQATLGE-PPVYGHTQVNIEVEDVNDNAPEFEASM-VRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL---FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYS----VNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-SFQVHPVTGEISTREPLDRELRELYDLVVEARD--QGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQ-NASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHV 1383          

HSP 4 Score: 142.51 bits (358), Expect = 1.307e-33
Identity = 168/707 (23.76%), Postives = 298/707 (42.15%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTK----SYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGG---VPPLSGELRVNIEVTDINDHSPRF-----KNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSL-----DYETKMSYTFTVQVTDGKH----FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTD--ADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSR-----------------------LHILDVNDNAPVFLNEPMRA-TIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTL-SSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDI-FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            I + D+ND+AP W +  + + LQ+ E +P+ +      A D D G +   +     Y    N+  E    L       ++S +G   +L +   LD E   +Y +++ A+D        L   + V + + D NDH+P F           ++ + + T I  ++   VA D DS D   L +     T       F +  ++G + L KSL     D E    +   +   D        +S+ + + V   ++N P+     +      T+ EN  SG  +  V        +N+ L     S + P    + L      + ++ T   FDRE  +  +  +   D       SS   R                       + + DVNDN+P F        ++ EN   G +I+ + A D D   NA+  + +   +  N F I+S +G++ ++ + + E+ SRY +    +D  +    +    + + +ED NDN+PRF    Y  S+ E+   GT + ++ A D+D+  +N  + Y+    T         +     +     +LDRE   S+ F ++A D G   + S++  +QI V DINDN P      +I   P+L        +  G  ++K +A D D G+N+E+ Y +   NS     F++ P+TG+L   ++L     +   L ++ +D+GNP
Sbjct: 1473 IEVADVNDNAPEWPQ--DPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSL-----FRMDSLTG---ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRA----TILENVPSGSFVLQVTAKSLHGAENANL-----SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPL-DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLG-VNARLVYSLANETQW----QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL--------IQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNP 2142          

HSP 5 Score: 140.969 bits (354), Expect = 3.293e-33
Identity = 167/680 (24.56%), Postives = 278/680 (40.88%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNN----LMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSG--NELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD--------------------------GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN----------SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHV------PVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR 2430
            + ILD NDHAP +   N+      +L I + + I        AVD D G DN   +Y I+   +GE +F         +NS++G    +  +     D EK  ++ ++I A D G P P    L +++ V   +++ PRF   +    ++ EN    S +    A+ +  ++  NL +   +   +++   F +  + G +  +   D E++ SY   V V D                          G+HF    + + V +VNDNSP+    S  G   L+V ENSE G  I  VV +D D+            G L    SID    ELS               +  DRE  S     I+ SD G+P     + +  + + D NDNAP F       +++E+  +GT + Q+ A D D  +NA   + L  +++  F I+ ++G I +    + E  + Y      TD            V +N+ D+NDN P F++  Y   +   +  G  + +V+A D+D+   N  I Y+     + ++     +         S  L  E        ++A D G+P  SS   I++ + +    T       P L   N TY V      P G  +++  A   D G   ++Q+     N    I  L+  +G + V +
Sbjct: 1590 LRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEITGG-NGEGRF--------RINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAV-YRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYG---LSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS--------------ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGA-NAEIVYSLN-AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGT-------PVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNED-GILSLDSLSGEIRVNK 2226          

HSP 6 Score: 133.265 bits (334), Expect = 7.854e-31
Identity = 166/695 (23.88%), Postives = 292/695 (42.01%), Query Frame = 1
Query:  532 KSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAV--------VVTDADDNS----GLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEP--PKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL----------QPDSEVNFRIESETGKIFSKIIFNAEESSRYEI-------SAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRF------DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKS---ILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSP-TLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            + I+ +LD ND+ P + K  +    +I E+    S   +  A DLD G             ++  +++ L  I  S        E+S      LDRE +  Y +++ A D G P  S  + V I V+D+ND++P   +     +S+ E     + +    A D D     ++ +S +   + +    F +   SG +  +  LD+E +  Y   V  +DG +    T   + V+VL++NDN P  +  S     +  V E++  G  +G++        VV ++ + S     +      + K ++E +   D  R+   L   +  DRE+ S     I+  DT     P+ S+ T ++ + DVNDNAP +  +P+   + E   VGT+I+   A D DT  N + ++ L          Q  +   FR++S TG +  +   + E    Y +       S+ VT+ L+ +       V L I D ND++P F              I +    G  +  + A D D  + N  + Y    G  +    I    G+ +  K    +++ D EK   F   I A D+G P    SS  + + V+  ++N P ++    ++    I  +VP G  V++  AK L    N+ L Y I       D+F ++   G +  +         ++ L + V+D
Sbjct: 1138 RVIVRVLDANDNDPKFQK--SKYEFRIEENLRRGSVVGVVTASDLDLG-------------ENAAIRYSLLPINSSFQVHPVTGEIS--TREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSL----VFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA--FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSV-----TVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGD-NGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATE-DVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQ---AVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPA-GVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRD 1798          

HSP 7 Score: 125.561 bits (314), Expect = 1.642e-28
Identity = 152/583 (26.07%), Postives = 247/583 (42.37%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPIN-ISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQS----FAGGELLTVSENSESGQ---HIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD-----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDI-YHFSIYENVNSGTPIDRVEAKDSDISEI-NKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNP-SFTFYIIAID-NGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHIN-ITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP---NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGN 2493
            +LDRE +  Y++ I A D GVP ++G   + +++ D+ND+ P F    P N +++ E T + ++I    A D+D+  A   R    ST + E    F L   SG+L+L++ LDYE +  Y   V  +D  H     + V+V + NDN+P    Q     FA   L  +SE SES      +  V  TDAD       V   I+      S           +  L+      G Y +  I   D G+P   SS   R+   D       FL    RA I E   +G+++ QL     D  L       +  + E  F +      +  K + + E +  Y++   ++       +          V + I D NDN P FD+   Y   I E       I +++A D+D     N  + Y+   G D+ +     VT  G +FV +++LD +    S+   I A D +    L S    ++E+ D NDN P++    P   +++ +  + PVG  V +  A DLD+G   +L Y I       S   +F+++  +G +           + + + +L  D G 
Sbjct: 2385 VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP---PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFA--ILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRII-AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-----IIAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVT--GVLFV-NNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG 2948          

HSP 8 Score: 103.219 bits (256), Expect = 1.019e-21
Identity = 129/462 (27.92%), Postives = 200/462 (43.29%), Query Frame = 1
Query:  370 NKLFYIEEKFGKLRTKSRIDRESICKQV------DANPDCKIALFILYHPGKRTTKPVMIKS----------IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF----TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEAR---NKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPV--FLNEPMRATIKENMAVGTLIYQLKAQDED 1677
            N LF+++ + G + T+ + DRES    V      DAN    ++   +    +R++  +   S           I + D+ND++P + +  +   L +PE+S          A DLD GP N    Y+I+    G          K S++S SG ELS      LDRE+ S+Y + I A D G P    G   + I V D ND++PRFK       S+ E+  + + +    A D D      L +S  + T+ +    F +  +SG +     LD E + SY F V  TDG  +     ++ V++ VL++NDN P      + G     V    + GQ +  V   DAD  +    V+ S++    E S +S + R   +   L   ++   E G      +   D G PP+ S     L I +     PV  F NE  R  +KEN   GT + Q+ A   D
Sbjct: 1764 NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRK--QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGLSVPENSE-PGVIHTVVASDLDEGP-NADLIYSITGGNLGN---------KFSIDSSSG-ELS---ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLS-KYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIG----QVPALIQPGQTLLKVQALDADLGANAEIVY-SLN---AENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 9 Score: 98.2117 bits (243), Expect = 3.509e-20
Identity = 74/275 (26.91%), Postives = 126/275 (45.82%), Query Frame = 1
Query: 1723 EVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG-VTQDGKIFVR---SSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRD-IFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            E +  I+  TG+I +K+  + E  + Y + A     L G   +V     + ++D NDN+P F +   H    EN         + A+D D+   N   RYN   G      +      +DG +++    S  LDRE  P ++  I A+D G+P L     + I ++D+NDN P +   + S     +  +  VG  V++  A D D   N  ++Y I    S ++ +F+++P TG++Y+ + L       H L ++ KD G   LE T    + +
Sbjct:  120 ETDLAIDRATGEIRTKVKLDRETRASYSLVAI---PLSGRNIRVL----VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF---NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRV 383          

HSP 10 Score: 84.7297 bits (208), Expect = 5.479e-16
Identity = 180/763 (23.59%), Postives = 307/763 (40.24%), Query Frame = 1
Query:  274 VEECSNNSIVTDLNNRFHSNFNNDGHFR--LLDQN--KLFYIEEKF-GKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELR--VNIEVTDINDHSPRFKNQ--------IPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTV-------SENSESGQHIGAVVVT---DADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSR------LHILDVNDNAPVF-LNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDS---EVNFRIESETGKIFSKIIFNAEESSR-YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPG-TDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKD-----INDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTL 2436
            V E +N        + F S+  ++   R  ++D N    F IE  F G +RT   +DRE   + +      K+ +        + T    I+  + I+D+ND+ PT+   NNL+T  + E + + +      A D+D  P        ++     E   D+  +   +L+  SG    L++   LD E Q +Y++ + A D      + E R  + + V D ND++P F  Q        +P    + E+ +++  +    A D DS + NN +  ++     E  Q  F    S  ++          MS       + G +F  I  +        +S  + VQ+   G   +        ++ SE+   +G+VV+    DA D S  L +    ++   EL  L  +A     +  +K  DRE        +  S    PP  SS  S       + ILD NDN P+F  +    A I E   +   I QL+A D D E   N        S   E  F I+  TG +F     + +  ++ YE+     DS             L + D NDN P+F    Y   + EN   G+ + R  A D D     + + Y+  P  +D+S  K   V  +  +   +   D E+   +   ++A D G    S +  ++IE +D       + T  ++ P            +P G+ V +  A D D G +  + Y ++ P+S    F++  ++G++ +KR L
Sbjct: 2331 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDRE--IRDI-----YKLKIIATDEGVPQMTGTATIR--VQIVDVNDNQPTFPP-NNLVT--VSEATELGAVITSISANDVDTYP-------ALTYRLGAESTVDIENMSIFALDRYSGK---LVLKRRLDYELQQEYELDVIASDA-----AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADS-EGNNSKVIYII----EPAQEGFSVHPSNGVV-------SVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAP-LGSVVLQLGQDALDQS--LAIIAGNEESAFEL--LQSKA-----IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQ-LNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLP--------AAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH---FKVNRSSGAVLIKRKL 3032          

HSP 11 Score: 79.7221 bits (195), Expect = 1.816e-14
Identity = 65/243 (26.75%), Postives = 117/243 (48.15%), Query Frame = 1
Query: 1819 VTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGT-DKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS----GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVN 2529
            V  + +  F   + ++ + +ED NDNSP+F +  +  ++ E  N GT + +V A DSD    N  +RY+   G  D + +     +      VR++  LDRE    +   IIA D G P ++ +A I++++ D+NDN P +    P  N + ++    +G  +    A D+D  +   L Y +   ++       IF L+  +G L +KR L     + + L+++  D  + +    LT +VN
Sbjct: 2293 VARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPAFSG----IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF----PPNNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEA-RTVLTVRVN 2523          

HSP 12 Score: 79.337 bits (194), Expect = 2.299e-14
Identity = 141/580 (24.31%), Postives = 246/580 (42.41%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRF-KNQIPINISLHENTAINSIIFVFVAE----DIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS--LDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGL---LPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNE---------PMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKI---FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRV--EAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTF-YIIAIDNGSP-----TLSSSAYIQIEVKDINDNTPEWIHPDPSLNH-INITYHVPVGHEVIKFEAKDLDQGS--NSELQYFITEPNSGRD--IFQLEPTTGSLYVKRTL 2436
            L   + ++ +V++ A     P L+    + IE+ D ND+SP+F + Q    +S   N         FVA+    D D+     LR+  +    D      F+ E +   I++ +  LD E +  Y   +  TD    +   +  + V++++VNDN P     +F    L+TVSE +E G  I ++   D D    L   L    ++D   + +  L D    K +LK  +  D E+       +  SD     + +  T R++  D NDNAPVFL +         P  + I E+++V   +  + A D D+E N +   Y+   ++  F +    G +    S++      S  Y +     D+ +    K    + +   D      +F ++ Y   I E    G+ + ++  +A D  ++ I          G ++S  + +      K  V    LDRE+N  +    +++  +G P       SS   + I + D NDN P +   D S  +   I+   P+ + + + +A D DQ +  NSE+ Y IT   SG D  +F ++  TG L+V   L
Sbjct: 2280 LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKG------TFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP-----TFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFAL-DRYSGKLVLK--RRLDYELQQEYELDVIASDAAHEAR-TVLTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPAL-KSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAII---------AGNEESAFELL----QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF---DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDIT---SGNDEHMFTIDLVTGVLFVNNRL 2818          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 207.994 bits (528), Expect = 7.337e-54
Identity = 187/668 (27.99%), Postives = 302/668 (45.21%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPI-NISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP-NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +I + D ND+ P ++  N   +  + E+S    +     A D D GP+   + Y  S  ++ +  FD+ +         SG    + +L  LDRE QS+Y   + A D G P    ++ V I++ D ND++P FK  +PI  +S+ EN    +++   +  D    D       F   + D+  Q  F   KSGEL + K LD E  M Y  ++  TDGK      VE+ V ++NDN+P      +     ++ +E+   G  +  V   D D  S L   F    K   + S      +   +LK   A DRE            D  +  +       + + D+NDN P+F     R ++ E+  + TLI ++ A D+D  +N   ++ L  ++   F+I   TG I      + E  S + ++    D      H +   V +NI D+NDN P F    Y   I EN   GT + +V A   DI  +N  I Y    G ++   K    T D    V ++ LD E +  +   I AID G+P LS++AY+ I + DINDN+P ++    +L  IN+   + VG +++  +A D D   N  + Y I    N G+  F ++P  G++ V R L    +  + L I   D+G+P    ++   +NI+
Sbjct: 2847 LIDVRDENDNYPKFD--NTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIY--------SG---WITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK--LPIEGLSVFENALPGTVLINLLLID---PDIEKQEMDFFIVSGDKQAQ--FQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYH----ISTNESISIGTTLVEVKAIDFDFQSKLR--FYLSGKGADDFSI----GKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSI-ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIG-VNADIHYFIMSGNEQGKFKMDSTTGD---LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQ---NLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININIL 3474          

HSP 2 Score: 150.214 bits (378), Expect = 5.840e-36
Identity = 170/705 (24.11%), Postives = 298/705 (42.27%), Query Frame = 1
Query:  604 LQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGG--VPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYET-KMSYTFTVQVTDG----KHFTSIYVEVKVLNVNDNSP---------KISVQSFAGGELLTVSENSESGQHIGAVVVTDA--------DDNSGLLPVFCSIDKP-----IVELSPLSDEARNKFLLKTLKAFDREIGS-----YQIFTIKCSDTGEPPKHSSYTSRLHILDV--------------------NDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQ-PDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFK-PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + IPE +PIN      +  D D G + +     +  N+  E +          +N  SG    L     LD EK+S Y + ++A+D            +V I V D+ND+ P F+N   + IS++EN    S +    A+D DS + + + +S  +         F +   SG +     LD+ET K +Y   ++ +D     +  T I + + V ++NDN P         K++  +  G E+   S        I +  ++D         D  SG L + C + K      I+++S       +  L+  +     ++G      +   + +C +TG   + +   S     +V                    N + P F+N P   +I E++ +G  +  ++A+D D   N    F +   D +  FRI+ + G++      + E  + Y ++  V D L          + + I D+NDN P   K +  F + E+   GT +  + A D+D S IN  + Y      +D ++    G  +  K       LDREK  ++  +I A D GSP LSS A + + V D+NDN P     E+I          +   +P G  +   EA D D G N+E+Q+ + E     ++F+++  TG++  +  L   + + H L +   D G+PSL   ++  + I+
Sbjct:  407 VSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFR----------INPDSG---MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKV-ISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLN----AVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYD-LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTVNATTGCLRLNK------PLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYI--------FKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMII 1077          

HSP 3 Score: 148.673 bits (374), Expect = 1.510e-35
Identity = 157/573 (27.40%), Postives = 252/573 (43.98%), Query Frame = 1
Query:  835 YQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQV---TDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNF--KPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            YQ  + A D G P    E+ V+IE+ + + + P F+    + + + E+T   +++              N  F F S   D   Q  F+   SGELILQ++LD E + S+   V     T    F    V + V + NDN PK     ++     +V+ENSE    +  V  TDAD   +G +  +   D     +  + D       +  L + DRE+ S   F +  +D G P   +     + I+D NDNAPVF       ++ EN   GT++  L   D D E      F +  D +  F+I  ++G++F     + E+   Y +S   TD   G F      V+++++D+NDN+P   K  YH S  E+++ GT +  V+A D D       +R+    K   D SI K  G+ +       +S LDRE  P +       D    T    + I I V DINDN P +     +   +++     +   + K  A D D G N +++Y +   N   D F++  +TG + + ++L    +    L +  +D G P L    T  VNI+
Sbjct: 2729 YQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKS-SVLLKIIESTPPGTVLTKLHM-------IGNYTFKF-SIAAD---QDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSA----SVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE--NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQI-GKSGELFIAKPLDREQLMFYNLSIIATD---GKF-TAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ---SKLRFYLSGKGADDFSIGKESGILK------VASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGEN--HDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNIL 3264          

HSP 4 Score: 147.902 bits (372), Expect = 2.534e-35
Identity = 180/682 (26.39%), Postives = 310/682 (45.45%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFR----------LPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPL--SGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS---LDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTD--ADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-FDREIGS-YQIFTIKCS---DTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSR-YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPID-RVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            IIHILD ND+ P +  V N     +PE + I S               +  D D G + + + + +        K D          S +G   ++ +L  LD E  + Y   +T  D G P L  +    V I V ++ND  P F N+  +N++L   T  N  +    A+D   +D + LRF  +    +E  Q     EK   +I  ++   L+ E    Y   V+ +DG     + V++KVL+  D++     +S+      +  EN+     IG V V     D+N         ++  I+  + L D   +   LKT    FDRE+   Y++F    S   D        + TS  + +LDVNDN P+F+N P  AT+  +   GT+I Q+KA D D+  N   R+ L+  +   F+++ ++G++   I  + E  +R YE++    D   G       +  L ++ ++ + P F+K  Y  S+ E+V   + +   +EA+    S + +++ Y     +    + +      G IFV  ++LD EK  S    I A D+ S  + +   + + + D+ND  PE    +  + ++ I  +   G +++K  A D D G+N++L Y+I   N     ++F ++ T G+LY+K  L    ++ H + + VKD G+PSL
Sbjct: 1802 IIHILDANDNIPYF--VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKID----------STTG---AIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-NERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQI----EKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYR----FSAFENNTKVATIGLVNVIGNTLDEN---------VEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGEL--SIKQHVEGHNRNYELTVAAYD---GAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE----SPLGRSLIYTISSESQSFEIDY----NTGSIFV-VNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEI---ESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSL 2429          

HSP 5 Score: 142.124 bits (357), Expect = 1.848e-33
Identity = 148/609 (24.30%), Postives = 266/609 (43.68%), Query Frame = 1
Query:  727 MKFDLRVIMKSSLNSKSGNELS-------LIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG-KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPN---SGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            + FD +  ++  L+ K  ++ S       L V   LDRE   +Y+++    DG          + I V DIND+ P F +     +S+ E+  +N++I    A D D      +++S +    D     F + + +G + L KSLD ET   +  TV+  D    K  +   V V +L++NDN P+ S++ ++      + EN+  G  +  V  T  D     + V   I   I     +S   + KF + +           D E+  +   TI+  D G PP  ++    + ILD+NDN+P FL    R  + E++ VG+ I  +KA DED+++N    + ++    +  F I+ + G I      + E  S Y +     D  +G   +     +++NI D NDN+P F    Y   + EN   G      +  D+D +       ++ + G +  + +   + QDG +   +S+ +      F   +   DNG+P L S A++ +++ + +   P     + ++N     +    G  + K  A D D+    EL +  ++ P+       +F +   TG +Y    L   D+  ++LN+ V D
Sbjct: 3092 IDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF-SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHD----YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYS----CKILENATHGTEVCKVYATSID-----IGVNADIHYFI-----MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD--QGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFR---LEQDGSLRT-ASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFS---GAFIGKVHASDQDK--YDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNL---DIGLYKLNVSVSD 3667          

HSP 6 Score: 140.584 bits (353), Expect = 4.695e-33
Identity = 188/720 (26.11%), Postives = 314/720 (43.61%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK--HFTS-IYVEVKVLNVNDN--SPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADD---NSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKI-FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSA---YIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            D + +F I+   G+L+    +DRE   + V       I ++ L +P K T+K + I     ILD+ND+ P   K   L T ++ E + I +      A D D G  N   +Y +S                 ++N+ +G    L +   LDREKQ  Y + ITA DGG P LS E  V + V D+ND++P F  Q  I   + E+    +++ V  A D D      ++FS    T+DE  + F + + +G +  Q  LDYE K  +   V   DG     TS + + + +++VN+N  +P+     + G     V EN   G  +  V   D D    NS +       D   + +  ++D+      + +L   D E  ++   T+   D    P  +     + + + NDN P+         + E       I  LKA D D +      + +   + V  F I+S+TG I  ++   + E  + + +   ++D+          ++ +++ D+NDNSP FD+ +Y   +  +      I +V A DSD  E N  I Y+ K G  K+  +    +Q G I + +  LD +    F  +I A DNG P  S +A    + + V   + N P  I    S N +++T +   G  V +  A D D   N +L Y I+  N   + F +    G++ + + L     +++ L I V D
Sbjct:  815 DYDSVFRIDPDRGELQIIGYLDRERQNEYV-----LNITVYDLGNPTKSTSKMLPIT----ILDVNDNRPVIQKT--LATFRLTESARIGTVVHCLHATDADSGI-NAQVTYALSVE-----------CSDFTVNATTG---CLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYI-FKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDE--ELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEG----KVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDG--LGIFAVNDQGS----ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSST-SRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGE-NGRITYSIKSGKGKNKFRID--SQRGHIHI-AKPLDSDN--EFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAP-LIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDD-NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD 1483          

HSP 7 Score: 138.272 bits (347), Expect = 2.308e-32
Identity = 176/733 (24.01%), Postives = 333/733 (45.43%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSR-IDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDI---NDHSPRFKNQIPINI-SLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLL-PVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPV---GHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            F I+ K G ++T  R +DRE+  + +      ++A+     P   +T  +    ++ +LDIND++P +++   +  +Q+P  + +N +     A+D D G +N   +Y+I   K G+ KF         ++S+ G+   + +   LD +  +++++ I A D G+P  S   RVNI V  +   + ++P    +   N+  L EN     ++   +A D    D N+  +  +S   D+   TF++ + +G ++L K LDYET+ SY  T+ VTDG       + V+V+++NDN P+ +   +     + +SEN E    I  +  TD D++  L   +  + D   + L  +   + N  + + L   D E  +  I  +   D G P K +     +++ D ND+ P F  + +++ + E+ A+G+ + +++A D D+  NA  ++  +  +    F I+   G I      N  +   Y +     D            V + +    ++ P+F  +     I+EN+  GT + +V A+ S       +I +N   G   +I +   +     + V +  +D E    F   +   +  +   SS   I I + D NDN P     E++   P    I  +Y + V     + +  + KD D G N  ++Y I + +  ++ F+++ TTG++ + R L       +  ++ V D G P L  T T  V I
Sbjct: 1241 FEIDSKTGVIKTTERKLDRENQAEHI-----LEVAISDNGSPVLSSTSRI----VVSVLDINDNSPEFDQ--RVYKVQVPSSATVNQSIFQVHAIDSDSG-ENGRITYSIKSGK-GKNKF--------RIDSQRGH---IHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVD----DDNDQLWYNISNGNDD--NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYH----VNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRL---DFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQI-PVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSS------SSIFFNIISG---NINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAE--SSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIG-SYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD-DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTI 1920          

HSP 8 Score: 122.094 bits (305), Expect = 1.991e-27
Identity = 161/682 (23.61%), Postives = 295/682 (43.26%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVA----EDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL---QPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFI-TEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + I+D+ND  P     +++  L IPE++   +      A D D G  N   SY I ++ +G+   +L  I     +   GN   L +   LD E+   + +++   D G P LS    V I V D+ND++P F     +  S     ++ ++   FVA     D D SD ++L +  +   E    QT+ + + +G + LQ  L++  K S    + V+DG H     +++ +L  N  SP     ++       V EN   G +I  V  +D D        + ++   IV     S+E +  FL+            FDRE     +  +K SD G   K    + ++ ++DVNDN P FL +  +  +   +     I  +KA+D+D   N +  F +     D  V     I  +TG I  K    +   + Y+     +D  E  FH     V + I + + N P F+K      I E+   GT + ++          N   +++     D     H  ++  G++ ++ + LDRE+  S    ++A  +  P   + A + I+V+D NDN P++   D +    ++  +      ++K  A D D G N +++Y++ ++  + ++IF ++  +G + +  +L       +   ++  D G+P  +  +   + IV
Sbjct: 2329 VSIMDVNDCYPEIE--SDIYNLTIPENASFGTQILKINATDNDSGA-NAKLSYYI-ESINGQNNSELFYI-----DVTDGN---LYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCF-----VEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNE---LQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEA----QVPENLLHGHNIITVKASDGD-----FGTYANLYYEIV-----SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEV-PVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG------NYTFKFSIAADQD-----HFMISDSGELILQQT-LDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF---DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIV 2958          

HSP 9 Score: 114.39 bits (285), Expect = 5.053e-25
Identity = 146/588 (24.83%), Postives = 247/588 (42.01%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAM----DGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF--------TSIYVEVKVLNVNDNSPKISVQSFAG----------GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLE-GTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQD--GKIFVRSSQLDREK-NPSFTFYIIAIDNGSPTLSSSAY-IQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            +L+REK  +Y + + A     D  V     E  ++I+V D ND SP F       + + E+T     I    A+D D      + +S L  +E      F +   +GE+ L + L Y     +  TV   D   +        +   V + V  VN  +P+I  ++F+           G +    +++    +IG + + D + D + LL    + D+  +EL+  +   +  F+                 T+   D G P + +  +  + I   + N P+F  E    +I E   +   + +LK  D D   NA     +   +E + FRI  ++G +++    +AE+ S Y ++    D    G+  +   KV ++++DMNDN P F+      SI EN  +G+ + ++ AKD D  E N  I Y+       + L  +    D    I   +S LD E    ++   I A D G P    +   + I VKDINDN P++   +    +  +T   P+G EV    A D D G    + Y +++ N     F L+PT+GSL +   L    L    L +   D
Sbjct:  136 VLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFY-PTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSE-----YFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYN--------------LTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGE-NSYISYSI------ANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNC---YGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNED-GCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 10 Score: 110.153 bits (274), Expect = 1.006e-23
Identity = 156/582 (26.80%), Postives = 268/582 (46.05%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSL-DYETKMSYTFTVQ----VTDG------KHFTSIYVEVKVLNVNDNSPK-ISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAV-GTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKP--GTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLER 2508
            IL+ E    Y + + A DG     S  L V I+V    D +  F+ +     +   NT + +I  V V   I ++   N+ +  L+ T     Q F +   SG L     + D E K  Y   V+    + DG      +  TSI  ++ VL+VNDN P  +++  +A     TVS +   G  I  V   D D       V   + K   EL  L  ++    + + ++  +R   +Y++ T+   D    P  S    ++ ++D   + PVF  +    ++KE++ +   L   ++A+   + L  +  + +  +S+ +F I+  TG IF     + E+ S +++S   TDSL G + +V   + ++I D+ND  P  + DIY+ +I EN + GT I ++ A D+D S  N  + Y  +   G + S L +I VT DG +++++  LD E+       +   D+GSP+LSS + + I VKD+NDN P ++ P        ++     G  V   +A D D      L+Y I   N  +  + ++  TG + ++  L   D  +  LNI V D  + +  R
Sbjct: 1993 ILNNENDRDYALHVRASDG---IFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNV---IGNTLDENVEYRILNPT-----QLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSI--DISVLDVNDNCPLFVNMPYYA-----TVSIDDPKGTIIMQVKAIDLDSAENG-EVRYELKKGNGELFKLDRKSGELSIKQHVEGHNR---NYEL-TVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE---SPLGRSLIYTISSESQ-SFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV--LSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDND-SGANAKLSYYIESINGQNNSELFYIDVT-DGNLYLKTP-LDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS---YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQ-TYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYAR 2536          

HSP 11 Score: 102.834 bits (255), Expect = 1.491e-21
Identity = 102/380 (26.84%), Postives = 165/380 (43.42%), Query Frame = 1
Query: 1288 LTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDK---PIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL----KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDN--TPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGS-NSELQYFITEPNSGRDIFQL 2397
            L+++E+ + G+ +  +   D D       VF   D     +  + P   E      L+ +   DRE  +  +  I   D G P K +S    + ILDVNDN PV         + E+  +GT+++ L A D D+ +NA   + L  +   +F + + TG +      + E+   Y +     D            V + ++D+NDN+P F    Y F + E++  GT +  +EA D DI   N  I+++ K  T    L    KH G  +          LD E        + AID G P+L+S   I I + D+N+N   PE+   D  +    +  + P G  V+   A+D+D    NS++ Y IT    G  IF +
Sbjct:  779 LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGE------LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECS-DFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE-ALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGP-NAEIQFSLKEETQDEELFRIDKHTGAIR------TQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEF---DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT-GGDGLGIFAV 1139          

HSP 12 Score: 59.3066 bits (142), Expect = 2.592e-8
Identity = 79/292 (27.05%), Postives = 130/292 (44.52%), Query Frame = 1
Query:  361 LDQNKLFYIEEKFGKLRTKSRIDRES----ICKQVDANPDCKIALFI----LYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFD-LRVIMKSSLNSKSGNELSLIVLGILDREKQSQ-YQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFT 1203
            L +N L Y+E   G    + RI+ +S      KQ+DA       L +      + G R      +K  I + D+ND+ P +  VN +++  I E++   S      A D D G +N   SY+I+       + D    I+K++               +LD E   + Y+++I A D G+P     E++++I V DIND+ P+F+ ++     + ++  + + +FV  A D D+ D  + R S     ED     F L   SG L +   L   T  +    V  TDG HF+
Sbjct:  429 LGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVK--ISVQDMNDNDPIFENVNKVIS--INENNLAGSFVVKLTAKDRDSG-ENSYISYSIANLNAVPFEIDHFSGIVKTT--------------SLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE-RVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLS--DGNED---GCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFS 695          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 207.994 bits (528), Expect = 7.337e-54
Identity = 187/668 (27.99%), Postives = 302/668 (45.21%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPI-NISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP-NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +I + D ND+ P ++  N   +  + E+S    +     A D D GP+   + Y  S  ++ +  FD+ +         SG    + +L  LDRE QS+Y   + A D G P    ++ V I++ D ND++P FK  +PI  +S+ EN    +++   +  D    D       F   + D+  Q  F   KSGEL + K LD E  M Y  ++  TDGK      VE+ V ++NDN+P      +     ++ +E+   G  +  V   D D  S L   F    K   + S      +   +LK   A DRE            D  +  +       + + D+NDN P+F     R ++ E+  + TLI ++ A D+D  +N   ++ L  ++   F+I   TG I      + E  S + ++    D      H +   V +NI D+NDN P F    Y   I EN   GT + +V A   DI  +N  I Y    G ++   K    T D    V ++ LD E +  +   I AID G+P LS++AY+ I + DINDN+P ++    +L  IN+   + VG +++  +A D D   N  + Y I    N G+  F ++P  G++ V R L    +  + L I   D+G+P    ++   +NI+
Sbjct: 2847 LIDVRDENDNYPKFD--NTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIY--------SG---WITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK--LPIEGLSVFENALPGTVLINLLLID---PDIEKQEMDFFIVSGDKQAQ--FQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYH----ISTNESISIGTTLVEVKAIDFDFQSKLR--FYLSGKGADDFSI----GKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSI-ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIG-VNADIHYFIMSGNEQGKFKMDSTTGD---LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQ---NLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININIL 3474          

HSP 2 Score: 150.214 bits (378), Expect = 5.840e-36
Identity = 170/705 (24.11%), Postives = 298/705 (42.27%), Query Frame = 1
Query:  604 LQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGG--VPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYET-KMSYTFTVQVTDG----KHFTSIYVEVKVLNVNDNSP---------KISVQSFAGGELLTVSENSESGQHIGAVVVTDA--------DDNSGLLPVFCSIDKP-----IVELSPLSDEARNKFLLKTLKAFDREIGS-----YQIFTIKCSDTGEPPKHSSYTSRLHILDV--------------------NDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQ-PDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFK-PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + IPE +PIN      +  D D G + +     +  N+  E +          +N  SG    L     LD EK+S Y + ++A+D            +V I V D+ND+ P F+N   + IS++EN    S +    A+D DS + + + +S  +         F +   SG +     LD+ET K +Y   ++ +D     +  T I + + V ++NDN P         K++  +  G E+   S        I +  ++D         D  SG L + C + K      I+++S       +  L+  +     ++G      +   + +C +TG   + +   S     +V                    N + P F+N P   +I E++ +G  +  ++A+D D   N    F +   D +  FRI+ + G++      + E  + Y ++  V D L          + + I D+NDN P   K +  F + E+   GT +  + A D+D S IN  + Y      +D ++    G  +  K       LDREK  ++  +I A D GSP LSS A + + V D+NDN P     E+I          +   +P G  +   EA D D G N+E+Q+ + E     ++F+++  TG++  +  L   + + H L +   D G+PSL   ++  + I+
Sbjct:  407 VSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFR----------INPDSG---MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKV-ISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLN----AVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYD-LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTVNATTGCLRLNK------PLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYI--------FKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMII 1077          

HSP 3 Score: 148.673 bits (374), Expect = 1.510e-35
Identity = 157/573 (27.40%), Postives = 252/573 (43.98%), Query Frame = 1
Query:  835 YQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQV---TDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNF--KPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            YQ  + A D G P    E+ V+IE+ + + + P F+    + + + E+T   +++              N  F F S   D   Q  F+   SGELILQ++LD E + S+   V     T    F    V + V + NDN PK     ++     +V+ENSE    +  V  TDAD   +G +  +   D     +  + D       +  L + DRE+ S   F +  +D G P   +     + I+D NDNAPVF       ++ EN   GT++  L   D D E      F +  D +  F+I  ++G++F     + E+   Y +S   TD   G F      V+++++D+NDN+P   K  YH S  E+++ GT +  V+A D D       +R+    K   D SI K  G+ +       +S LDRE  P +       D    T    + I I V DINDN P +     +   +++     +   + K  A D D G N +++Y +   N   D F++  +TG + + ++L    +    L +  +D G P L    T  VNI+
Sbjct: 2729 YQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKS-SVLLKIIESTPPGTVLTKLHM-------IGNYTFKF-SIAAD---QDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSA----SVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE--NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQI-GKSGELFIAKPLDREQLMFYNLSIIATD---GKF-TAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ---SKLRFYLSGKGADDFSIGKESGILK------VASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGEN--HDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNIL 3264          

HSP 4 Score: 147.902 bits (372), Expect = 2.534e-35
Identity = 180/682 (26.39%), Postives = 310/682 (45.45%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFR----------LPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPL--SGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS---LDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTD--ADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-FDREIGS-YQIFTIKCS---DTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSR-YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPID-RVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            IIHILD ND+ P +  V N     +PE + I S               +  D D G + + + + +        K D          S +G   ++ +L  LD E  + Y   +T  D G P L  +    V I V ++ND  P F N+  +N++L   T  N  +    A+D   +D + LRF  +    +E  Q     EK   +I  ++   L+ E    Y   V+ +DG     + V++KVL+  D++     +S+      +  EN+     IG V V     D+N         ++  I+  + L D   +   LKT    FDRE+   Y++F    S   D        + TS  + +LDVNDN P+F+N P  AT+  +   GT+I Q+KA D D+  N   R+ L+  +   F+++ ++G++   I  + E  +R YE++    D   G       +  L ++ ++ + P F+K  Y  S+ E+V   + +   +EA+    S + +++ Y     +    + +      G IFV  ++LD EK  S    I A D+ S  + +   + + + D+ND  PE    +  + ++ I  +   G +++K  A D D G+N++L Y+I   N     ++F ++ T G+LY+K  L    ++ H + + VKD G+PSL
Sbjct: 1802 IIHILDANDNIPYF--VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKID----------STTG---AIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-NERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQI----EKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYR----FSAFENNTKVATIGLVNVIGNTLDEN---------VEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGEL--SIKQHVEGHNRNYELTVAAYD---GAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE----SPLGRSLIYTISSESQSFEIDY----NTGSIFV-VNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEI---ESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSL 2429          

HSP 5 Score: 142.124 bits (357), Expect = 1.848e-33
Identity = 148/609 (24.30%), Postives = 266/609 (43.68%), Query Frame = 1
Query:  727 MKFDLRVIMKSSLNSKSGNELS-------LIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG-KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPN---SGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            + FD +  ++  L+ K  ++ S       L V   LDRE   +Y+++    DG          + I V DIND+ P F +     +S+ E+  +N++I    A D D      +++S +    D     F + + +G + L KSLD ET   +  TV+  D    K  +   V V +L++NDN P+ S++ ++      + EN+  G  +  V  T  D     + V   I   I     +S   + KF + +           D E+  +   TI+  D G PP  ++    + ILD+NDN+P FL    R  + E++ VG+ I  +KA DED+++N    + ++    +  F I+ + G I      + E  S Y +     D  +G   +     +++NI D NDN+P F    Y   + EN   G      +  D+D +       ++ + G +  + +   + QDG +   +S+ +      F   +   DNG+P L S A++ +++ + +   P     + ++N     +    G  + K  A D D+    EL +  ++ P+       +F +   TG +Y    L   D+  ++LN+ V D
Sbjct: 3092 IDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF-SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHD----YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYS----CKILENATHGTEVCKVYATSID-----IGVNADIHYFI-----MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD--QGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFR---LEQDGSLRT-ASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFS---GAFIGKVHASDQDK--YDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNL---DIGLYKLNVSVSD 3667          

HSP 6 Score: 140.584 bits (353), Expect = 4.695e-33
Identity = 188/720 (26.11%), Postives = 314/720 (43.61%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK--HFTS-IYVEVKVLNVNDN--SPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADD---NSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKI-FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSA---YIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            D + +F I+   G+L+    +DRE   + V       I ++ L +P K T+K + I     ILD+ND+ P   K   L T ++ E + I +      A D D G  N   +Y +S                 ++N+ +G    L +   LDREKQ  Y + ITA DGG P LS E  V + V D+ND++P F  Q  I   + E+    +++ V  A D D      ++FS    T+DE  + F + + +G +  Q  LDYE K  +   V   DG     TS + + + +++VN+N  +P+     + G     V EN   G  +  V   D D    NS +       D   + +  ++D+      + +L   D E  ++   T+   D    P  +     + + + NDN P+         + E       I  LKA D D +      + +   + V  F I+S+TG I  ++   + E  + + +   ++D+          ++ +++ D+NDNSP FD+ +Y   +  +      I +V A DSD  E N  I Y+ K G  K+  +    +Q G I + +  LD +    F  +I A DNG P  S +A    + + V   + N P  I    S N +++T +   G  V +  A D D   N +L Y I+  N   + F +    G++ + + L     +++ L I V D
Sbjct:  815 DYDSVFRIDPDRGELQIIGYLDRERQNEYV-----LNITVYDLGNPTKSTSKMLPIT----ILDVNDNRPVIQKT--LATFRLTESARIGTVVHCLHATDADSGI-NAQVTYALSVE-----------CSDFTVNATTG---CLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYI-FKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDE--ELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEG----KVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDG--LGIFAVNDQGS----ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSST-SRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGE-NGRITYSIKSGKGKNKFRID--SQRGHIHI-AKPLDSDN--EFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAP-LIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDD-NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD 1483          

HSP 7 Score: 138.272 bits (347), Expect = 2.308e-32
Identity = 176/733 (24.01%), Postives = 333/733 (45.43%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSR-IDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDI---NDHSPRFKNQIPINI-SLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLL-PVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPV---GHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            F I+ K G ++T  R +DRE+  + +      ++A+     P   +T  +    ++ +LDIND++P +++   +  +Q+P  + +N +     A+D D G +N   +Y+I   K G+ KF         ++S+ G+   + +   LD +  +++++ I A D G+P  S   RVNI V  +   + ++P    +   N+  L EN     ++   +A D    D N+  +  +S   D+   TF++ + +G ++L K LDYET+ SY  T+ VTDG       + V+V+++NDN P+ +   +     + +SEN E    I  +  TD D++  L   +  + D   + L  +   + N  + + L   D E  +  I  +   D G P K +     +++ D ND+ P F  + +++ + E+ A+G+ + +++A D D+  NA  ++  +  +    F I+   G I      N  +   Y +     D            V + +    ++ P+F  +     I+EN+  GT + +V A+ S       +I +N   G   +I +   +     + V +  +D E    F   +   +  +   SS   I I + D NDN P     E++   P    I  +Y + V     + +  + KD D G N  ++Y I + +  ++ F+++ TTG++ + R L       +  ++ V D G P L  T T  V I
Sbjct: 1241 FEIDSKTGVIKTTERKLDRENQAEHI-----LEVAISDNGSPVLSSTSRI----VVSVLDINDNSPEFDQ--RVYKVQVPSSATVNQSIFQVHAIDSDSG-ENGRITYSIKSGK-GKNKF--------RIDSQRGH---IHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVD----DDNDQLWYNISNGNDD--NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYH----VNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRL---DFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQI-PVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSS------SSIFFNIISG---NINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAE--SSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIG-SYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD-DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTI 1920          

HSP 8 Score: 122.094 bits (305), Expect = 1.991e-27
Identity = 161/682 (23.61%), Postives = 295/682 (43.26%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVA----EDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL---QPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFI-TEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + I+D+ND  P     +++  L IPE++   +      A D D G  N   SY I ++ +G+   +L  I     +   GN   L +   LD E+   + +++   D G P LS    V I V D+ND++P F     +  S     ++ ++   FVA     D D SD ++L +  +   E    QT+ + + +G + LQ  L++  K S    + V+DG H     +++ +L  N  SP     ++       V EN   G +I  V  +D D        + ++   IV     S+E +  FL+            FDRE     +  +K SD G   K    + ++ ++DVNDN P FL +  +  +   +     I  +KA+D+D   N +  F +     D  V     I  +TG I  K    +   + Y+     +D  E  FH     V + I + + N P F+K      I E+   GT + ++          N   +++     D     H  ++  G++ ++ + LDRE+  S    ++A  +  P   + A + I+V+D NDN P++   D +    ++  +      ++K  A D D G N +++Y++ ++  + ++IF ++  +G + +  +L       +   ++  D G+P  +  +   + IV
Sbjct: 2329 VSIMDVNDCYPEIE--SDIYNLTIPENASFGTQILKINATDNDSGA-NAKLSYYI-ESINGQNNSELFYI-----DVTDGN---LYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCF-----VEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNE---LQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEA----QVPENLLHGHNIITVKASDGD-----FGTYANLYYEIV-----SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEV-PVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG------NYTFKFSIAADQD-----HFMISDSGELILQQT-LDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF---DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIV 2958          

HSP 9 Score: 114.39 bits (285), Expect = 5.053e-25
Identity = 146/588 (24.83%), Postives = 247/588 (42.01%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAM----DGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF--------TSIYVEVKVLNVNDNSPKISVQSFAG----------GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLE-GTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQD--GKIFVRSSQLDREK-NPSFTFYIIAIDNGSPTLSSSAY-IQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            +L+REK  +Y + + A     D  V     E  ++I+V D ND SP F       + + E+T     I    A+D D      + +S L  +E      F +   +GE+ L + L Y     +  TV   D   +        +   V + V  VN  +P+I  ++F+           G +    +++    +IG + + D + D + LL    + D+  +EL+  +   +  F+                 T+   D G P + +  +  + I   + N P+F  E    +I E   +   + +LK  D D   NA     +   +E + FRI  ++G +++    +AE+ S Y ++    D    G+  +   KV ++++DMNDN P F+      SI EN  +G+ + ++ AKD D  E N  I Y+       + L  +    D    I   +S LD E    ++   I A D G P    +   + I VKDINDN P++   +    +  +T   P+G EV    A D D G    + Y +++ N     F L+PT+GSL +   L    L    L +   D
Sbjct:  136 VLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFY-PTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSE-----YFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYN--------------LTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGE-NSYISYSI------ANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNC---YGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNED-GCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 10 Score: 110.153 bits (274), Expect = 1.006e-23
Identity = 156/582 (26.80%), Postives = 268/582 (46.05%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSL-DYETKMSYTFTVQ----VTDG------KHFTSIYVEVKVLNVNDNSPK-ISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAV-GTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKP--GTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLER 2508
            IL+ E    Y + + A DG     S  L V I+V    D +  F+ +     +   NT + +I  V V   I ++   N+ +  L+ T     Q F +   SG L     + D E K  Y   V+    + DG      +  TSI  ++ VL+VNDN P  +++  +A     TVS +   G  I  V   D D       V   + K   EL  L  ++    + + ++  +R   +Y++ T+   D    P  S    ++ ++D   + PVF  +    ++KE++ +   L   ++A+   + L  +  + +  +S+ +F I+  TG IF     + E+ S +++S   TDSL G + +V   + ++I D+ND  P  + DIY+ +I EN + GT I ++ A D+D S  N  + Y  +   G + S L +I VT DG +++++  LD E+       +   D+GSP+LSS + + I VKD+NDN P ++ P        ++     G  V   +A D D      L+Y I   N  +  + ++  TG + ++  L   D  +  LNI V D  + +  R
Sbjct: 1993 ILNNENDRDYALHVRASDG---IFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNV---IGNTLDENVEYRILNPT-----QLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSI--DISVLDVNDNCPLFVNMPYYA-----TVSIDDPKGTIIMQVKAIDLDSAENG-EVRYELKKGNGELFKLDRKSGELSIKQHVEGHNR---NYEL-TVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE---SPLGRSLIYTISSESQ-SFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV--LSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDND-SGANAKLSYYIESINGQNNSELFYIDVT-DGNLYLKTP-LDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS---YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQ-TYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYAR 2536          

HSP 11 Score: 102.834 bits (255), Expect = 1.491e-21
Identity = 102/380 (26.84%), Postives = 165/380 (43.42%), Query Frame = 1
Query: 1288 LTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDK---PIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL----KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDN--TPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGS-NSELQYFITEPNSGRDIFQL 2397
            L+++E+ + G+ +  +   D D       VF   D     +  + P   E      L+ +   DRE  +  +  I   D G P K +S    + ILDVNDN PV         + E+  +GT+++ L A D D+ +NA   + L  +   +F + + TG +      + E+   Y +     D            V + ++D+NDN+P F    Y F + E++  GT +  +EA D DI   N  I+++ K  T    L    KH G  +          LD E        + AID G P+L+S   I I + D+N+N   PE+   D  +    +  + P G  V+   A+D+D    NS++ Y IT    G  IF +
Sbjct:  779 LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGE------LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECS-DFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE-ALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGP-NAEIQFSLKEETQDEELFRIDKHTGAIR------TQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEF---DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT-GGDGLGIFAV 1139          

HSP 12 Score: 59.3066 bits (142), Expect = 2.592e-8
Identity = 79/292 (27.05%), Postives = 130/292 (44.52%), Query Frame = 1
Query:  361 LDQNKLFYIEEKFGKLRTKSRIDRES----ICKQVDANPDCKIALFI----LYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFD-LRVIMKSSLNSKSGNELSLIVLGILDREKQSQ-YQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFT 1203
            L +N L Y+E   G    + RI+ +S      KQ+DA       L +      + G R      +K  I + D+ND+ P +  VN +++  I E++   S      A D D G +N   SY+I+       + D    I+K++               +LD E   + Y+++I A D G+P     E++++I V DIND+ P+F+ ++     + ++  + + +FV  A D D+ D  + R S     ED     F L   SG L +   L   T  +    V  TDG HF+
Sbjct:  429 LGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVK--ISVQDMNDNDPIFENVNKVIS--INENNLAGSFVVKLTAKDRDSG-ENSYISYSIANLNAVPFEIDHFSGIVKTT--------------SLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE-RVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLS--DGNED---GCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFS 695          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 207.994 bits (528), Expect = 7.533e-54
Identity = 187/668 (27.99%), Postives = 302/668 (45.21%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPI-NISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEP-NSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +I + D ND+ P ++  N   +  + E+S    +     A D D GP+   + Y  S  ++ +  FD+ +         SG    + +L  LDRE QS+Y   + A D G P    ++ V I++ D ND++P FK  +PI  +S+ EN    +++   +  D    D       F   + D+  Q  F   KSGEL + K LD E  M Y  ++  TDGK      VE+ V ++NDN+P      +     ++ +E+   G  +  V   D D  S L   F    K   + S      +   +LK   A DRE            D  +  +       + + D+NDN P+F     R ++ E+  + TLI ++ A D+D  +N   ++ L  ++   F+I   TG I      + E  S + ++    D      H +   V +NI D+NDN P F    Y   I EN   GT + +V A   DI  +N  I Y    G ++   K    T D    V ++ LD E +  +   I AID G+P LS++AY+ I + DINDN+P ++    +L  IN+   + VG +++  +A D D   N  + Y I    N G+  F ++P  G++ V R L    +  + L I   D+G+P    ++   +NI+
Sbjct: 2847 LIDVRDENDNYPKFD--NTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIY--------SG---WITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK--LPIEGLSVFENALPGTVLINLLLID---PDIEKQEMDFFIVSGDKQAQ--FQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYH----ISTNESISIGTTLVEVKAIDFDFQSKLR--FYLSGKGADDFSI----GKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSI-ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIG-VNADIHYFIMSGNEQGKFKMDSTTGD---LVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQ---NLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININIL 3474          

HSP 2 Score: 150.214 bits (378), Expect = 5.891e-36
Identity = 170/705 (24.11%), Postives = 298/705 (42.27%), Query Frame = 1
Query:  604 LQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGG--VPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYET-KMSYTFTVQVTDG----KHFTSIYVEVKVLNVNDNSP---------KISVQSFAGGELLTVSENSESGQHIGAVVVTDA--------DDNSGLLPVFCSIDKP-----IVELSPLSDEARNKFLLKTLKAFDREIGS-----YQIFTIKCSDTGEPPKHSSYTSRLHILDV--------------------NDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQ-PDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFK-PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + IPE +PIN      +  D D G + +     +  N+  E +          +N  SG    L     LD EK+S Y + ++A+D            +V I V D+ND+ P F+N   + IS++EN    S +    A+D DS + + + +S  +         F +   SG +     LD+ET K +Y   ++ +D     +  T I + + V ++NDN P         K++  +  G E+   S        I +  ++D         D  SG L + C + K      I+++S       +  L+  +     ++G      +   + +C +TG   + +   S     +V                    N + P F+N P   +I E++ +G  +  ++A+D D   N    F +   D +  FRI+ + G++      + E  + Y ++  V D L          + + I D+NDN P   K +  F + E+   GT +  + A D+D S IN  + Y      +D ++    G  +  K       LDREK  ++  +I A D GSP LSS A + + V D+NDN P     E+I          +   +P G  +   EA D D G N+E+Q+ + E     ++F+++  TG++  +  L   + + H L +   D G+PSL   ++  + I+
Sbjct:  407 VSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFR----------INPDSG---MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKV-ISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLN----AVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYD-LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTVNATTGCLRLNK------PLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYI--------FKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMII 1077          

HSP 3 Score: 148.673 bits (374), Expect = 1.524e-35
Identity = 157/573 (27.40%), Postives = 252/573 (43.98%), Query Frame = 1
Query:  835 YQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQV---TDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNF--KPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            YQ  + A D G P    E+ V+IE+ + + + P F+    + + + E+T   +++              N  F F S   D   Q  F+   SGELILQ++LD E + S+   V     T    F    V + V + NDN PK     ++     +V+ENSE    +  V  TDAD   +G +  +   D     +  + D       +  L + DRE+ S   F +  +D G P   +     + I+D NDNAPVF       ++ EN   GT++  L   D D E      F +  D +  F+I  ++G++F     + E+   Y +S   TD   G F      V+++++D+NDN+P   K  YH S  E+++ GT +  V+A D D       +R+    K   D SI K  G+ +       +S LDRE  P +       D    T    + I I V DINDN P +     +   +++     +   + K  A D D G N +++Y +   N   D F++  +TG + + ++L    +    L +  +D G P L    T  VNI+
Sbjct: 2729 YQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKS-SVLLKIIESTPPGTVLTKLHM-------IGNYTFKF-SIAAD---QDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSA----SVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE--NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQI-GKSGELFIAKPLDREQLMFYNLSIIATD---GKF-TAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ---SKLRFYLSGKGADDFSIGKESGILK------VASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGEN--HDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNIL 3264          

HSP 4 Score: 147.902 bits (372), Expect = 2.622e-35
Identity = 180/682 (26.39%), Postives = 310/682 (45.45%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFR----------LPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPL--SGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS---LDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTD--ADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-FDREIGS-YQIFTIKCS---DTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSR-YEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPID-RVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            IIHILD ND+ P +  V N     +PE + I S               +  D D G + + + + +        K D          S +G   ++ +L  LD E  + Y   +T  D G P L  +    V I V ++ND  P F N+  +N++L   T  N  +    A+D   +D + LRF  +    +E  Q     EK   +I  ++   L+ E    Y   V+ +DG     + V++KVL+  D++     +S+      +  EN+     IG V V     D+N         ++  I+  + L D   +   LKT    FDRE+   Y++F    S   D        + TS  + +LDVNDN P+F+N P  AT+  +   GT+I Q+KA D D+  N   R+ L+  +   F+++ ++G++   I  + E  +R YE++    D   G       +  L ++ ++ + P F+K  Y  S+ E+V   + +   +EA+    S + +++ Y     +    + +      G IFV  ++LD EK  S    I A D+ S  + +   + + + D+ND  PE    +  + ++ I  +   G +++K  A D D G+N++L Y+I   N     ++F ++ T G+LY+K  L    ++ H + + VKD G+PSL
Sbjct: 1802 IIHILDANDNIPYF--VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKID----------STTG---AIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF-NERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQI----EKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYR----FSAFENNTKVATIGLVNVIGNTLDEN---------VEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGEL--SIKQHVEGHNRNYELTVAAYD---GAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE----SPLGRSLIYTISSESQSFEIDY----NTGSIFV-VNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEI---ESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSL 2429          

HSP 5 Score: 141.739 bits (356), Expect = 1.881e-33
Identity = 148/609 (24.30%), Postives = 266/609 (43.68%), Query Frame = 1
Query:  727 MKFDLRVIMKSSLNSKSGNELS-------LIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG-KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPN---SGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            + FD +  ++  L+ K  ++ S       L V   LDRE   +Y+++    DG          + I V DIND+ P F +     +S+ E+  +N++I    A D D      +++S +    D     F + + +G + L KSLD ET   +  TV+  D    K  +   V V +L++NDN P+ S++ ++      + EN+  G  +  V  T  D     + V   I   I     +S   + KF + +           D E+  +   TI+  D G PP  ++    + ILD+NDN+P FL    R  + E++ VG+ I  +KA DED+++N    + ++    +  F I+ + G I      + E  S Y +     D  +G   +     +++NI D NDN+P F    Y   + EN   G      +  D+D +       ++ + G +  + +   + QDG +   +S+ +      F   +   DNG+P L S A++ +++ + +   P     + ++N     +    G  + K  A D D+    EL +  ++ P+       +F +   TG +Y    L   D+  ++LN+ V D
Sbjct: 3092 IDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF-SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHD----YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYS----CKILENATHGTEVCKVYATSID-----IGVNADIHYFI-----MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD--QGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFR---LEQDGSLRT-ASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFS---GAFIGKVHASDQDK--YDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNL---DIGLYKLNVSVSD 3667          

HSP 6 Score: 140.584 bits (353), Expect = 5.025e-33
Identity = 188/720 (26.11%), Postives = 314/720 (43.61%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK--HFTS-IYVEVKVLNVNDN--SPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADD---NSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKI-FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSA---YIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            D + +F I+   G+L+    +DRE   + V       I ++ L +P K T+K + I     ILD+ND+ P   K   L T ++ E + I +      A D D G  N   +Y +S                 ++N+ +G    L +   LDREKQ  Y + ITA DGG P LS E  V + V D+ND++P F  Q  I   + E+    +++ V  A D D      ++FS    T+DE  + F + + +G +  Q  LDYE K  +   V   DG     TS + + + +++VN+N  +P+     + G     V EN   G  +  V   D D    NS +       D   + +  ++D+      + +L   D E  ++   T+   D    P  +     + + + NDN P+         + E       I  LKA D D +      + +   + V  F I+S+TG I  ++   + E  + + +   ++D+          ++ +++ D+NDNSP FD+ +Y   +  +      I +V A DSD  E N  I Y+ K G  K+  +    +Q G I + +  LD +    F  +I A DNG P  S +A    + + V   + N P  I    S N +++T +   G  V +  A D D   N +L Y I+  N   + F +    G++ + + L     +++ L I V D
Sbjct:  815 DYDSVFRIDPDRGELQIIGYLDRERQNEYV-----LNITVYDLGNPTKSTSKMLPIT----ILDVNDNRPVIQKT--LATFRLTESARIGTVVHCLHATDADSGI-NAQVTYALSVE-----------CSDFTVNATTG---CLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYI-FKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDE--ELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEG----KVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDG--LGIFAVNDQGS----ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSST-SRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGE-NGRITYSIKSGKGKNKFRID--SQRGHIHI-AKPLDSDN--EFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAP-LIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDD-NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD 1483          

HSP 7 Score: 138.272 bits (347), Expect = 2.251e-32
Identity = 176/733 (24.01%), Postives = 333/733 (45.43%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSR-IDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDI---NDHSPRFKNQIPINI-SLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLL-PVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTP-----EWIHPDPSLNHINITYHVPV---GHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            F I+ K G ++T  R +DRE+  + +      ++A+     P   +T  +    ++ +LDIND++P +++   +  +Q+P  + +N +     A+D D G +N   +Y+I   K G+ KF         ++S+ G+   + +   LD +  +++++ I A D G+P  S   RVNI V  +   + ++P    +   N+  L EN     ++   +A D    D N+  +  +S   D+   TF++ + +G ++L K LDYET+ SY  T+ VTDG       + V+V+++NDN P+ +   +     + +SEN E    I  +  TD D++  L   +  + D   + L  +   + N  + + L   D E  +  I  +   D G P K +     +++ D ND+ P F  + +++ + E+ A+G+ + +++A D D+  NA  ++  +  +    F I+   G I      N  +   Y +     D            V + +    ++ P+F  +     I+EN+  GT + +V A+ S       +I +N   G   +I +   +     + V +  +D E    F   +   +  +   SS   I I + D NDN P     E++   P    I  +Y + V     + +  + KD D G N  ++Y I + +  ++ F+++ TTG++ + R L       +  ++ V D G P L  T T  V I
Sbjct: 1241 FEIDSKTGVIKTTERKLDRENQAEHI-----LEVAISDNGSPVLSSTSRI----VVSVLDINDNSPEFDQ--RVYKVQVPSSATVNQSIFQVHAIDSDSG-ENGRITYSIKSGK-GKNKF--------RIDSQRGH---IHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVD----DDNDQLWYNISNGNDD--NTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYH----VNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRL---DFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQI-PVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSS------SSIFFNIISG---NINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAE--SSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIG-SYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD-DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTI 1920          

HSP 8 Score: 122.094 bits (305), Expect = 2.026e-27
Identity = 161/682 (23.61%), Postives = 295/682 (43.26%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVA----EDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKA-------FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL---QPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFI-TEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + I+D+ND  P     +++  L IPE++   +      A D D G  N   SY I ++ +G+   +L  I     +   GN   L +   LD E+   + +++   D G P LS    V I V D+ND++P F     +  S     ++ ++   FVA     D D SD ++L +  +   E    QT+ + + +G + LQ  L++  K S    + V+DG H     +++ +L  N  SP     ++       V EN   G +I  V  +D D        + ++   IV     S+E +  FL+            FDRE     +  +K SD G   K    + ++ ++DVNDN P FL +  +  +   +     I  +KA+D+D   N +  F +     D  V     I  +TG I  K    +   + Y+     +D  E  FH     V + I + + N P F+K      I E+   GT + ++          N   +++     D     H  ++  G++ ++ + LDRE+  S    ++A  +  P   + A + I+V+D NDN P++   D +    ++  +      ++K  A D D G N +++Y++ ++  + ++IF ++  +G + +  +L       +   ++  D G+P  +  +   + IV
Sbjct: 2329 VSIMDVNDCYPEIE--SDIYNLTIPENASFGTQILKINATDNDSGA-NAKLSYYI-ESINGQNNSELFYI-----DVTDGN---LYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCF-----VEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNE---LQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEA----QVPENLLHGHNIITVKASDGD-----FGTYANLYYEIV-----SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEV-PVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG------NYTFKFSIAADQD-----HFMISDSGELILQQT-LDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF---DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIV 2958          

HSP 9 Score: 114.39 bits (285), Expect = 4.805e-25
Identity = 146/588 (24.83%), Postives = 247/588 (42.01%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAM----DGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF--------TSIYVEVKVLNVNDNSPKISVQSFAG----------GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLE-GTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQD--GKIFVRSSQLDREK-NPSFTFYIIAIDNGSPTLSSSAY-IQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            +L+REK  +Y + + A     D  V     E  ++I+V D ND SP F       + + E+T     I    A+D D      + +S L  +E      F +   +GE+ L + L Y     +  TV   D   +        +   V + V  VN  +P+I  ++F+           G +    +++    +IG + + D + D + LL    + D+  +EL+  +   +  F+                 T+   D G P + +  +  + I   + N P+F  E    +I E   +   + +LK  D D   NA     +   +E + FRI  ++G +++    +AE+ S Y ++    D    G+  +   KV ++++DMNDN P F+      SI EN  +G+ + ++ AKD D  E N  I Y+       + L  +    D    I   +S LD E    ++   I A D G P    +   + I VKDINDN P++   +    +  +T   P+G EV    A D D G    + Y +++ N     F L+PT+GSL +   L    L    L +   D
Sbjct:  136 VLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFY-PTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSE-----YFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYN--------------LTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGE-NSYISYSI------ANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNC---YGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNED-GCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 10 Score: 110.153 bits (274), Expect = 9.889e-24
Identity = 156/582 (26.80%), Postives = 268/582 (46.05%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSL-DYETKMSYTFTVQ----VTDG------KHFTSIYVEVKVLNVNDNSPK-ISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAV-GTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKP--GTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLER 2508
            IL+ E    Y + + A DG     S  L V I+V    D +  F+ +     +   NT + +I  V V   I ++   N+ +  L+ T     Q F +   SG L     + D E K  Y   V+    + DG      +  TSI  ++ VL+VNDN P  +++  +A     TVS +   G  I  V   D D       V   + K   EL  L  ++    + + ++  +R   +Y++ T+   D    P  S    ++ ++D   + PVF  +    ++KE++ +   L   ++A+   + L  +  + +  +S+ +F I+  TG IF     + E+ S +++S   TDSL G + +V   + ++I D+ND  P  + DIY+ +I EN + GT I ++ A D+D S  N  + Y  +   G + S L +I VT DG +++++  LD E+       +   D+GSP+LSS + + I VKD+NDN P ++ P        ++     G  V   +A D D      L+Y I   N  +  + ++  TG + ++  L   D  +  LNI V D  + +  R
Sbjct: 1993 ILNNENDRDYALHVRASDG---IFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNV---IGNTLDENVEYRILNPT-----QLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSI--DISVLDVNDNCPLFVNMPYYA-----TVSIDDPKGTIIMQVKAIDLDSAENG-EVRYELKKGNGELFKLDRKSGELSIKQHVEGHNR---NYEL-TVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE---SPLGRSLIYTISSESQ-SFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVV--LSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDND-SGANAKLSYYIESINGQNNSELFYIDVT-DGNLYLKTP-LDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPS---YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQ-TYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYAR 2536          

HSP 11 Score: 102.834 bits (255), Expect = 1.491e-21
Identity = 102/380 (26.84%), Postives = 165/380 (43.42%), Query Frame = 1
Query: 1288 LTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDK---PIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL----KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDN--TPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGS-NSELQYFITEPNSGRDIFQL 2397
            L+++E+ + G+ +  +   D D       VF   D     +  + P   E      L+ +   DRE  +  +  I   D G P K +S    + ILDVNDN PV         + E+  +GT+++ L A D D+ +NA   + L  +   +F + + TG +      + E+   Y +     D            V + ++D+NDN+P F    Y F + E++  GT +  +EA D DI   N  I+++ K  T    L    KH G  +          LD E        + AID G P+L+S   I I + D+N+N   PE+   D  +    +  + P G  V+   A+D+D    NS++ Y IT    G  IF +
Sbjct:  779 LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGE------LQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECS-DFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE-ALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGP-NAEIQFSLKEETQDEELFRIDKHTGAIR------TQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEF---DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT-GGDGLGIFAV 1139          

HSP 12 Score: 59.3066 bits (142), Expect = 2.727e-8
Identity = 79/292 (27.05%), Postives = 130/292 (44.52%), Query Frame = 1
Query:  361 LDQNKLFYIEEKFGKLRTKSRIDRES----ICKQVDANPDCKIALFI----LYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFD-LRVIMKSSLNSKSGNELSLIVLGILDREKQSQ-YQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFT 1203
            L +N L Y+E   G    + RI+ +S      KQ+DA       L +      + G R      +K  I + D+ND+ P +  VN +++  I E++   S      A D D G +N   SY+I+       + D    I+K++               +LD E   + Y+++I A D G+P     E++++I V DIND+ P+F+ ++     + ++  + + +FV  A D D+ D  + R S     ED     F L   SG L +   L   T  +    V  TDG HF+
Sbjct:  429 LGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVK--ISVQDMNDNDPIFENVNKVIS--INENNLAGSFVVKLTAKDRDSG-ENSYISYSIANLNAVPFEIDHFSGIVKTT--------------SLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE-RVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLS--DGNED---GCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFS 695          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 265.774 bits (678), Expect = 1.776e-73
Identity = 212/734 (28.88%), Postives = 354/734 (48.23%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKS-RIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            +RL+ +     L  +    G++ T S RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   +    +G+  F L ++      +  G +   LIV   LDRE++  Y + +   DGG P  S    + + VTD+ND+ P FK +  I + + EN+ + + +    A D D      +++ F +       + F L   +G + +Q+ LD E    +  TV  +DG    +   + + V +VNDN+P I ++   S   G ++ +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E     IF I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  + A DED+  NA   + L P++   F ++ +TG + +  +F+ EE  R+  +    D+           V + I D NDNSP+F  + + F + EN+   + +  +   D+D  E N  +R +     +  IL       D  +   +   DRE+  S+TF + A+DNGSP  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N  R +F+++P TG++ ++   T+ D+  HRL + + D G P    TL  
Sbjct:   64 YRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFR---LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELL----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK-ESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQ-AAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILNDNENFILD-----PDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV-RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 99.3673 bits (246), Expect = 1.532e-20
Identity = 88/331 (26.59%), Postives = 154/331 (46.53%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L     ++   A     +R   +       R+ S TG+IF+        K+     F   E S +EI   +   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   +   D G+P  SS+A +Q+ V D+NDN P +     S   ++I  + PVG  V++ +A D D G+N+E++Y      S   R +F L  TTG + V+R L   +   H+L +L  D  +     T+T  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-FEIEVVI---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKE---SQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 266.159 bits (679), Expect = 2.424e-73
Identity = 212/734 (28.88%), Postives = 354/734 (48.23%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKS-RIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            +RL+ +     L  +    G++ T S RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   +    +G+  F L ++      +  G +   LIV   LDRE++  Y + +   DGG P  S    + + VTD+ND+ P FK +  I + + EN+ + + +    A D D      +++ F +       + F L   +G + +Q+ LD E    +  TV  +DG    +   + + V +VNDN+P I ++   S   G ++ +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E     IF I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  + A DED+  NA   + L P++   F ++ +TG + +  +F+ EE  R+  +    D+           V + I D NDNSP+F  + + F + EN+   + +  +   D+D  E N  +R +     +  IL       D  +   +   DRE+  S+TF + A+DNGSP  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N  R +F+++P TG++ ++   T+ D+  HRL + + D G P    TL  
Sbjct:   64 YRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFR---LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELL----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK-ESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQ-AAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILNDNENFILD-----PDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV-RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 99.7525 bits (247), Expect = 1.316e-20
Identity = 88/331 (26.59%), Postives = 154/331 (46.53%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L     ++   A     +R   +       R+ S TG+IF+        K+     F   E S +EI   +   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   +   D G+P  SS+A +Q+ V D+NDN P +     S   ++I  + PVG  V++ +A D D G+N+E++Y      S   R +F L  TTG + V+R L   +   H+L +L  D  +     T+T  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-FEIEVVI---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKE---SQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 266.159 bits (679), Expect = 2.435e-73
Identity = 212/734 (28.88%), Postives = 354/734 (48.23%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKS-RIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            +RL+ +     L  +    G++ T S RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   +    +G+  F L ++      +  G +   LIV   LDRE++  Y + +   DGG P  S    + + VTD+ND+ P FK +  I + + EN+ + + +    A D D      +++ F +       + F L   +G + +Q+ LD E    +  TV  +DG    +   + + V +VNDN+P I ++   S   G ++ +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E     IF I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  + A DED+  NA   + L P++   F ++ +TG + +  +F+ EE  R+  +    D+           V + I D NDNSP+F  + + F + EN+   + +  +   D+D  E N  +R +     +  IL       D  +   +   DRE+  S+TF + A+DNGSP  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N  R +F+++P TG++ ++   T+ D+  HRL + + D G P    TL  
Sbjct:   64 YRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFR---LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELL----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK-ESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQ-AAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILNDNENFILD-----PDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV-RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 99.3673 bits (246), Expect = 1.536e-20
Identity = 88/331 (26.59%), Postives = 154/331 (46.53%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L     ++   A     +R   +       R+ S TG+IF+        K+     F   E S +EI   +   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   +   D G+P  SS+A +Q+ V D+NDN P +     S   ++I  + PVG  V++ +A D D G+N+E++Y      S   R +F L  TTG + V+R L   +   H+L +L  D  +     T+T  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-FEIEVVI---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKE---SQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 266.159 bits (679), Expect = 2.435e-73
Identity = 212/734 (28.88%), Postives = 354/734 (48.23%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKS-RIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            +RL+ +     L  +    G++ T S RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   +    +G+  F L ++      +  G +   LIV   LDRE++  Y + +   DGG P  S    + + VTD+ND+ P FK +  I + + EN+ + + +    A D D      +++ F +       + F L   +G + +Q+ LD E    +  TV  +DG    +   + + V +VNDN+P I ++   S   G ++ +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E     IF I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  + A DED+  NA   + L P++   F ++ +TG + +  +F+ EE  R+  +    D+           V + I D NDNSP+F  + + F + EN+   + +  +   D+D  E N  +R +     +  IL       D  +   +   DRE+  S+TF + A+DNGSP  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N  R +F+++P TG++ ++   T+ D+  HRL + + D G P    TL  
Sbjct:   64 YRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFR---LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELL----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK-ESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVM-LSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQ-AAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVRLSILNDNENFILD-----PDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV-RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 99.3673 bits (246), Expect = 1.536e-20
Identity = 88/331 (26.59%), Postives = 154/331 (46.53%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNS--GRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L     ++   A     +R   +       R+ S TG+IF+        K+     F   E S +EI   +   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   +   D G+P  SS+A +Q+ V D+NDN P +     S   ++I  + PVG  V++ +A D D G+N+E++Y      S   R +F L  TTG + V+R L   +   H+L +L  D  +     T+T  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-FEIEVVI---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKE---SQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 267.7 bits (683), Expect = 1.400e-72
Identity = 238/812 (29.31%), Postives = 386/812 (47.54%), Query Frame = 1
Query:  181 VMLKIVYTSITYLILFMVKR--ITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVT-KSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSF-AGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKPIVELSPLSDEARNKFLLKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSR-LHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKV-FGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGK 2577
            + L    T +  L+ + + R  ++S++  E  ++EE    + V  +  +    F     +R  +Q+KLF I    G + T S IDRE +       P   I + +L     + T P  ++  I +LDIND+AP +   + +++ +  E +       L  A D D G + V   +Y I    D + KF L + +  S     G  L L+  G LDRE    YQ+LI   D G P   G L+VN+ + DIND+ P F ++     S+ E+ A+ S +    A D+D  +  N   ++L    DE T  F +  K+G +++++ LDYETK  Y+ T+   D      +T     VK+L+VNDN P +  + F    +  +V EN++ G  +  + V+D+D ++    +  SI            S    N  L+K     DRE I SY + T+  SD G+P   SS+ S  + + D+ND+ P+F     R  I E++  G+ I  + A D D+  NAN R+ L   + +  F I   +G + S    N E +S  EI   ++   +G   K+ + K+ +NI D+ND  P F ++ YH SI E+  +G+ +  + A DSD+   N  IR++F   T  S      +         S++LDRE+  S+  YI A D+G+P L S   + I +KD+NDN+P +    P     NI  + P G  V    A D D G N  ++Y IT  +S +  F +  T+G +     L   +   ++L +   D G     R+ T  +  V  ++T     +FG+
Sbjct:   13 MALSGTSTHLVLLVFWTLSRCSVSSQVRQEFEVLEEQPVGTYVGTIETK--PAFT----YRFSEQHKLFSINATTGVIYTSSVIDREVL-------PGNIINVVVL---SSQPTYPTEVR--IVVLDINDNAPVFPDASIVVSFK--EDASSGRQVILDTATDADIGSNGVDHTTYRIISGND-QRKFRLDITVNPS---GEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHE-QYQTSVFEDAAVGSSVLQIAASDLD--EGANAEITYL---LDEGTP-FQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNL-TVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETAS--EIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGP-NGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFY---PMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSK--FHISSTSGKVTTLVALDREEKTAYQLQVTATDGGG---LRSHTPAIVTVTVVDTQDNPLVFGQ 781          

HSP 2 Score: 184.111 bits (466), Expect = 2.670e-46
Identity = 170/596 (28.52%), Postives = 284/596 (47.65%), Query Frame = 1
Query:  793 LIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLL-----KTLKA-FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQ-PDSEVNFRIESETGKIFSKIIFNAEESSRYEISAY----VTDSLEGTFH--KVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            +  LG++DRE+Q+ YQ+ + A  G V   +GE  VNI V D+ND++P F + +  ++S  EN A    IF   A D D +    + +S     +      F + EK G + L   L+  T  SY   V  +D    +  +S+++ + V +VNDN+P     S+     +T+ E+         V  TD D           ++  IV    +S   R+ F +       +KA  DRE+       +   D       +S    + + D+NDN P+F +       +E    G L+ ++ A+D+D   N+  R+  + P S  NF + + TG + S +  + E   R   +A     V  S +G     K   KV + I+D+NDN P+F KDIY  SI E+  + T + RV A D D ++ N  + Y+   G ++   K   +  +        +LD E  PS++  IIA D+GS  LSS+  + I V D NDN+P +  P  +L+ +++  ++ +G  V    A D D GSN+++ Y I+  N+    F + P TGS+++ + L       ++LN+  KD G PS   ++   +++
Sbjct:  832 ITALGLIDREEQAFYQLRVIARAGEV---TGETLVNITVKDLNDNAPNFMHSVE-HVSAVENWATGHHIFQAKASDPDEATNGMIVYSL----KQNPKGLFHIHEKHGLISLTGPLEVTTS-SYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYE----VTILESEPVNSRFFRVEATDKDSG---------VNGEIV-YDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQS--NFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENK-NGLVHYDITEGNEE---KQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSF--PKSTLS-VDVLENMRIGELVASVTATDSDSGSNADITYSISATNN-HGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHV 1394          

HSP 3 Score: 182.185 bits (461), Expect = 1.013e-45
Identity = 193/745 (25.91%), Postives = 319/745 (42.82%), Query Frame = 1
Query:  358 LLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIK--SIIHILDINDHAPTWNKVNNLMT----LQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLI-VLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVE--VKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLL-------KTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSI--LKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            LLD+   F I+ K G +  K  +D E+           K    +  H        +  +  + + +LD+ND+ P   K     T      + E++ + +   L    D D    N   S +I    + +  FD+        +S     LSLI V  +LDRE+ S Y + ++  D G P   S    + I V DINDH P F+  +   + + E+    S I    A D DS    NLR+S +S         F + E SG +     L+ ET       +   D G      Y +  V + +VND  P  +  ++     ++++E+S +G  +  +  TD+D     L    +I       +P+SD+  NKF L        T    DRE  S  +  I+ +D+G PP HS     + + DVNDN+PVF      A IKEN   G+ +  + A D D   N   ++ +       F I S +GK+ + +  + EE + Y++    TD   G        V + + D  DN   F +  Y F ++ENV  GT I  V A   D   ++  I Y    G  +S+  +K   +T  G I       DRE+     FY + +   +  ++    + I VKD+NDN P ++H   S+ H++   +   GH + + +A D D+ +N  + Y + +   G  +F +    G + +   L V    +++L ++  D G P    +L   +++
Sbjct:  282 LLDEGTPFQIDPKAGTVVIKEGLDYET-----------KREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVV-KFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNE-QRHFDV--------HSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAV-YRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNS---LGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYH----VSITEHSPAGSELVVLSATDSD-----LGPNGTIRFSFDSETPVSDQ--NKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDG-GGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVD---LHTNITYLIASGDQRSLFGIKAGQITALGLI-------DREEQ---AFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMH---SVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKG--LFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRTSSLFLTISV 970          

HSP 4 Score: 173.326 bits (438), Expect = 5.282e-43
Identity = 189/692 (27.31%), Postives = 307/692 (44.36%), Query Frame = 1
Query:  529 IKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGEL---------LTVSENSESGQHIGAVVVTDADDNSGLLPVFCS---IDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFY-LQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG-KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVH--------DLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            ++   ++LD+NDH P +N  +++ T  I E     ++     A D D G  +   +       DG+           S+N  +G    +I   +LDRE ++ YQ+L+ A DGG P PLS    V++ V DIND+ PRF +  P    +  +T+  S++F     D DS   + L +S      ++    F +    G +   + L   +++  TFTV V DG             N   +S  ++V+   GG+           T  EN  +   +    VT +   +G L  + +   +D     +  LS E      L   K  D E     +  I+  D G PP  +     + +LDVNDN PVF  EP  A I EN++   ++  + A D+D+  N    +  +  + E +F I   TG+I +    + E+ ++Y +    TD   G   K    KV +++ D+NDN+PRF K I+  ++ EN   G  + RV   D D +  N   RY+    TD S L  I     G I + S  L+RE    +   + A D+G    + S  + I V DINDN P +  P   L++  +T    +G  V +  A D D+G N ++ YFI    S  + F++  ++G +++K+ L           ++  H   +   DRG   L    T  +N+V
Sbjct: 1897 VRVYFNLLDVNDHPPLFN--SSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQF----------SINPSTG---LIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHH-PYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEK----FKIDPIRGAITASEKLTGSSEV--TFTVHVKDGG-----------TNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNTIV--TKVTGSSPRAGPLSYYIASGNLDNAF-HIDQLSGE------LSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLV-VSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATD--RGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDED-AGANAISRYSI---TDAS-LPFIIHPSTGDITI-SRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELT---EIGSIVTQVSATDPDEGFNGKIFYFI---RSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVV 2527          

HSP 5 Score: 172.94 bits (437), Expect = 8.298e-43
Identity = 183/751 (24.37%), Postives = 325/751 (43.28%), Query Frame = 1
Query:  304 TDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVM---IKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD-SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFK-PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPT-LSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +DL       F+ D    + DQNK F ++   G+L T + +DRE            + + ++LY     +  P +    K  I + D+ND++P +  +     ++  E+ P  S+     A D D G +   K Y I+     +            ++S SG   +L+ L   DRE+++ YQ+ +TA DGG         V + V D  D+ P    Q   +  + EN  + +II    A  +D     +   ++L  + D   Q      K+G++     +D E +  Y   V    G+      V + V ++NDN+P          E ++  EN  +G HI     +D D+ +  + V+     P      L        L+      +    SYQ+  +  SD G P + SS    + + DVNDNAPVF       TI E+  V +  ++++A D+D+ +N    +  +  ++   F I  + G+++ K   + E   RY +     D ++E     V   V + ++D+NDN P F+   Y F   E    G  + RV A+D D    N  +RY+F+ P ++  +    GV        R S + +     F+F +++ D G P  L   A +Q+ ++DINDN P++      +   +I        ++++  A D+D+  N  + Y ITE N  +  F ++  +G + +   L      ++ L I+ +D G+  L  T    ++++
Sbjct:  594 SDLGPNGTIRFSFDSETPVSDQNK-FRLDSTSGRLSTSTELDRE------------EESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIK--ENEPSGSSVTTVTASDPDLGRNGTVK-YAITAGDSSKFH----------ISSTSGKVTTLVAL---DREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDN-PLVFGQKDYSFVMFENVPVGTIIGTVSATTVDL----HTNITYLIASGD---QRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNF----MHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNP----KGLFHIHEKHGLISLTGPLEVTTSSYQL-EVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPD-GQLYIKADLDREVQDRYSLLVVAKDRAVESLSASV--NVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGP-NSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTK---DIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQ-FSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVL 1290          

HSP 6 Score: 169.474 bits (428), Expect = 1.016e-41
Identity = 183/736 (24.86%), Postives = 312/736 (42.39%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKP---VMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFR-----LPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQI------FTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQD-EDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDI-SEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            F+I++  G+L  +  +D E+I K            ++L+   +    P      K  I +LD+ND+ P +         Q P H+ I          +  A+D D GP+   +   I  NK+             ++N  +G    +     LDREK +QY + + A D G+PP S  ++V I V D+ND++PRF      + ++ EN  +   +      D D+      R+S       + +  F +   +G++ + + L+ E    Y   V   D     S  V + V ++NDN+P+ S  S+     L   E +E G  +  V  TD D+  +G +  F         ++  S E    F+ + L+ +    G   I      F +  SD G  P  S  T  ++++D NDN P F +      + +++ VGT + ++ A D +D  LN+   + +   +  N FR++ +TG +       A+ +  Y +    +D            V + + + N ++P F ++    ++ E +  GT I  + A+D D   ++N  I YN   G D  +     V     +   +  LD E        + A D G    +S   + I+V D+NDN P +   DP      +  +VP G  V+K  A D D GSN+ + Y I   +S  D+F ++P TG +  +  L     + + L   VK    P  ER     VNI
Sbjct: 2165 FHIDQLSGELSIRKPLDYENIEK------------YVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFE--------QEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSF----------NINRATGE---IRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKI--FSATVPENAPVGFTVTRVTTTDEDAGANAISRYSIT-----DASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSY----YLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEI---FIKQQLR-YQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRT-TVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFS---VHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVF---DPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDS--DLFIIDPNTGIITTQGFLDYEAKQVYHLT--VKAFNVPDEERCSFAYVNI 2841          

HSP 7 Score: 164.851 bits (416), Expect = 2.139e-40
Identity = 177/695 (25.47%), Postives = 297/695 (42.73%), Query Frame = 1
Query:  508 RTTKPVMIKS--IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKS--YTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRF-KNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSF-LSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS---IYVEVKVLNVNDNSPKIS-VQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFC--SIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDED-TELNANFRFYLQPDSEVNFRIESETGKIF--SKIIFNAEESSRYEISAYVTDSLEGT-FHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSN-SELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            R  KP+M ++  +I+++D ND+ PT+   +       P    +    RL +    D+    +     Y IS               K  L+ ++G   S+ V   L  +    Y + ITA D G PPLS    V I VT+ N H+P F +NQ+ + +S  E   + + I    A D D     N   ++ +S+  D+    F +  ++G L L K+LDYETK  +   V  TDG        + V ++V +VNDN P    V+ F       V EN  SG  +  +  TD D  S  L  +   S D  +  + P      N  ++ T    D E       T+K  +  +  + S     + +   N+  P F+++     I E    GT++ ++ A D D  E    +        +  F I  +TG+I+    +    EE    ++ A    S+ G    +V   V++ + D ND  P F +++Y   + E ++ G  +  V A+DSD   +    R+ +    +          Q G++ V +S+LDRE  P +   I+A+D+GSP  + SA + + ++DINDN P  +       +  +  +   G  V+   ++D D   N     Y +    +    F + P TG L   R +    +    L++L+KD G P +  T T  + +  Q
Sbjct: 2511 RGIKPLMSETTVMINVVDSNDNPPTFESPSYFT----PVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSN---------KFRLDKQTG---SVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVS--EALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDD--GLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFP-----VVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDP------NTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVL--VNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSD--SVPSWSRFTYAIAANHERNTFTINPQTGQVSV-ASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLV-----TTYGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISP-TGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQ 3162          

HSP 8 Score: 141.354 bits (355), Expect = 3.257e-33
Identity = 156/568 (27.46%), Postives = 253/568 (44.54%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK-HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLL-PVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREI-GSYQIFTIKCSDTGEP-PKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            LDRE++S+Y +L+ A DG     S ++ VNI V+DINDH+P F   +  +  + E+ +  SI+   +A D DS     + +S     ED+   TF L   +G   + ++LD+ET+  +  TV+  DG    +S+ V   +L+VND+ P  +   +      ++ E+  +G  +  V   D D  ++S LL  V  S       ++P +       L+ T    DRE   SYQ+  +  SD G+P P  SS T  + + D+NDN P F + P    I  + + G+L++ +   DED+  N+   + L   +   F+I+   G I +        SS    + +V D   GT  K              + P        F+  EN     P + +  K +  S     + Y    G   +   HI     G++ +R   LD E    +  +I A D G P  S+   ++I V D+NDN P +   +P   H  I  ++     V+   A D D G N +L+Y I + N   + F +   TG +   R L    +  + L +   DRG P
Sbjct: 1771 LDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSRSV-YSFDIPEDMSPGSIVAAILASDGDSGVNGEITYS---VEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYT----TSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQFSINPSTG------LIITSSLLDRETRASYQLLVV-ASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTG--SSEVTFTVHVKDG--GTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPEN----QPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAF-HID-QLSGELSIRKP-LDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVF-EQEPF--HAEILENLSP-QRVLVVSALDQDSGPNGQLEYAIIDGNK-ENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMP 2304          

HSP 9 Score: 129.028 bits (323), Expect = 2.347e-29
Identity = 143/583 (24.53%), Postives = 260/583 (44.60%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPD-NVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFK--NQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQ---VTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD---DNSGLLPVFC-------SIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELN-ANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDL-NIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPE 2232
            I + + N H P +++  N +T+ + E   + +A R   A D D+    N   +Y IS   D  +          S++S++G    L +   LD E + ++++ ++A DGG    +  + VNI+VTD+ND+ P F      P+   + EN    + +    A D DS   +N   +++  + D  +  F +   +G +  Q  LDYE K  Y  TV+   V D +  +  YV +++   N+  P+   + +       +SE +  G  +G V  +D D   D      +F        SI+K   ++       R K    +LK   +  GS     I+ +D  E          + +LD ND  PVF  E     + E ++ G L+  + A+D D+  + + F + +  + E N F I  +TG++      + E    Y ++    DS  G+       + +  +ED+NDN P       +  + EN  +GTP+  + ++D D++       Y+    +  +   +  ++  G++   S ++DRE+   F   ++  D+G P +SS+  + I+V D NDN  E
Sbjct: 2630 IAVTEENHHTPEFSQ--NQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGL---------FSVHSQTG---VLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPV---VQENVPSGTTVVKMNATDKDS--GSNALMAYVIQSSD--SDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQY----YFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGS-----IRGADIDE------VLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDS--GSPAATGSAILIVTLEDINDNGPTLVTT--YGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLV--STGAASSYFTISPTGEL-TTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNPSE 3168          

HSP 10 Score: 128.642 bits (322), Expect = 2.665e-29
Identity = 164/677 (24.22%), Postives = 289/677 (42.69%), Query Frame = 1
Query:  400 GKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKS-SLNSKSGNELSLIVL---GILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF---TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGL---LPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNA--NFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD-SLEGTFHK-VFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPG-TDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHV-PVGHEVIKFEAKDLDQGSNSELQYFITEPNSG 2379
            G+L  K+ +DRE            + +L ++       +    +   I + DIND+ P +N  N +   +  E     +      A D D GP++             E+++       +  LN+ +G   S + L    ++ +   + +   + + D G+P PL  + +V + + DIND+ P+F   I    S+ E+    + +    A D+D +    + +     TE    + F +   SG++ L   LDYET  SY+  +   D       ++  + + VL+ NDNSP     + +    + V EN   G+ + +V  TD+D  S       +  + +     +SP      + FL+K L   D E  S     +   D+G P + SS    +H+ D NDN PVF    +  +I EN+ + T +  + A D D ++N    +   LQ     +FRI+S +G I++    + E S+ +E++   TD ++   F +     V + + D NDN P F           N+  G+ +  V A D D    N  + Y    G +D  I+        G I + +SQL   K   ++  + A D+G+   SS   + I ++  +   P +  P     +I I     P G  VI  +A    +G+ ++++YFI    SG
Sbjct: 1034 GQLYIKADLDREV---------QDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHFE--EEQERGALVGRVFAEDKDFGPNS-------------EVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDI-YQASIAESAQNMTQLLRVSASDVDENKNGLVHYDI---TEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLS----VDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISP---NTGSIFLVKKL---DYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQ-NALVAESNIVIGSILTTVLAFDPD-EGANGEVEYELVRGDSDTFIMDRY----SGDIRL-ASQLIPSK-LIYSLMVSATDHGTDRKSSRTELTIILQGTDG--PVFSQP----KYITILKEGQPAGTNVISLDASS-PRGAGTKVEYFIVSVRSG 1657          

HSP 11 Score: 122.865 bits (307), Expect = 1.682e-27
Identity = 167/672 (24.85%), Postives = 272/672 (40.48%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNK-------DGEM--KFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQ---IPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN---SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQ-GSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPS 2499
            I + DIND+AP ++K +    L  PE + I S      A D D G +     +  S+ +        GE+  K  LR    S  N+ + N  S IV                TA D G+ PL  E  V I V D ND+ P F++     P+  S+   T    ++ V   +  D    + + ++    +    +  F L +++G + +  SL  +T   Y   +  +D  +        V++ V   N ++P+ S         +TVSE    G  I  +   D D +   +GL+    S        S  S       +L   K  D E        +  +D G   K S  T  + + DVNDN PVF        ++EN+  GT + ++ A D+D+  NA   + +Q      F I+  TG I ++   + E    Y ++    + +       F  V++ ++  N+  PRF    Y+F I E    GT +  V A D D+ E    + Y    G  +     I   + G+I+V S  LDREK    +  ++A + GS   +    + + +  ++ N P     +  L  + +   +  G  V    A+D D   S S   Y I   N  R+ F + P TG + V   L    +  + L IL  D G+P+
Sbjct: 2413 IFVTDINDNAPRFSKPS--YYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIV----------------TASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGT---RLLKVTAYDKKDFGLNSEIEYAI---SGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVT----VTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTG----VLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFN-VPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGE--DGVVYYLIFGRSRKRGFSIN-KKTGQIYV-SGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDPPVFTQE--LYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAA-NHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPA 3044          

HSP 12 Score: 120.168 bits (300), Expect = 9.599e-27
Identity = 166/707 (23.48%), Postives = 295/707 (41.73%), Query Frame = 1
Query:  439 ICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTK-SYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELR------VNIEVTDINDHSPRFKNQIPINISLHE-NTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEA-------RNKFLLKTLKAFDREIGS----YQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPS 2499
            + K++D        L +      R ++   I  IIH+ D ND+ P +   +   +  IPE+ PI+++     A D D   + + + S  +   + G  + D          S SG    +     +DRE  + +++ I A D  VP    E R      V I VTD ND+ P F +Q   N  + E N  I SI+   +A D D      + +  +    D    TF +   SG++ L   L   +K+ Y+  V  TD G    S   E+ ++    + P  S   +    +  + E   +G +   V+  DA    G       ++  IV +      A       R+  +++T    DRE GS      ++ I+ +D  +P    +  S L   D      + L   +R  I +  A G               NA   + +   ++ +FRI+ E+G++ +    + E  S+Y +     D  + +   ++  V++ + D+ND++P F + +Y F I E+++ G+ +  + A D D S +N  I Y+ +   + S      +T    +F  +  LD E  P F   + A D G    SSS  +   + D+ND+ P +   + S+   +I   +  G  V+   A D D G++S L   +   + G   F + P+TG +     L      +++L ++  D G P+
Sbjct: 1358 LVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKS--IPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRID----------SVSG---VIYTNKDIDREFSNLFELTIKATDQAVP---AEFRRFALKNVTIWVTDQNDNIPTFISQ---NALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSD----TFIMDRYSGDIRLASQL-IPSKLIYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKY----ITILKEGQPAGTN---VISLDASSPRG---AGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDLYLLDVYAIE-TDAKQPRTQHAEVSFL--FDFFFKVMLLLKGNLREHISQTCAEGA--------------NALVTYAIISGADDSFRIDPESGELSATRRLDRERRSKYSLLVRADDGQQSS--DIW--VNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGD-SGVNGEITYSVEEDDEDSTFLLNPIT---GVFNVTRALDFETQPFFILTVRAADGGG--RSSSVRVYFNLLDVNDHPPLF---NSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSV-HLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPT 1997          

HSP 13 Score: 95.5153 bits (236), Expect = 3.229e-19
Identity = 115/498 (23.09%), Postives = 211/498 (42.37%), Query Frame = 1
Query: 1045 LRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTL-------KAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDED-----TELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITY--HVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            + ++ +S  +D    +F +  +SGEL   + LD E +  Y+  V+  DG+  + I+V + V ++ND++P  S   ++      + E+   G  + A++ +D D  SG+           +  S   D+  + FLL  +       +A D E   + I T++ +D G   + SS     ++LDVND+ P+F +     +I E+++ G  +  + A D D     T LN+    +L    +  F I   TG I +  + + E  + Y++    +D  + T       V + + D+NDN PRF    Y   I  + ++G+ +  V   D D S  N  + Y+   G +    K   +         S +L      +FT ++   D G+   + S  + +      D       P   L     T+  + P    V K        G    L Y+I   N   + F ++  +G L +++ L   ++  + L I  +D+G P
Sbjct: 1744 VTYAIISGADD----SFRIDPESGELSATRRLDRERRSKYSLLVRADDGQQSSDIWVNITVSDINDHTPTFSRSVYS----FDIPEDMSPGSIVAAILASDGD--SGV--------NGEITYSVEEDDEDSTFLLNPITGVFNVTRALDFETQPFFILTVRAADGGG--RSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNS---VHLS-GGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDED-SGSNSQLHYSLT-GRNSEKFK---IDPIRGAITASEKLTGSSEVTFTVHV--KDGGTNPKTDSTTVTVRFVTGGD------FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAG---PLSYYIASGNL-DNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFP 2200          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 264.618 bits (675), Expect = 1.100e-72
Identity = 225/839 (26.82%), Postives = 391/839 (46.60%), Query Frame = 1
Query:  175 MTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGH-FRLLDQNKLFYIEEKFGKL-RTKSRIDRESI--CKQVDANPDC----KIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGH---EVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERT--LTFKVN--IVQQ--IETYHGLSLFGKFEGD 2589
            + + +K   T+    + F +  + S   +   + EE   N ++  L + +   + +  H ++L   +    ++ K G +  T++ IDRES+  C+ ++    C    ++++  L  P      P ++   I I+DIND+ P +N  + ++TL IPE++ I   F +P A D D G + V+ SY +    + +  F L+V        +   +  LIV+G+LDRE++  Y + I   DGG P  +    + I + D ND++P+F+ ++     L EN+ +   +    A D D      + +SF   + D V +   L   +G + +Q  +D E   +  F+V   D           V + + + NDN P I ++ F      G +  +SE+      +  V V+D D+  +  +    + D P  + ++S    +++ K+ L+T  A D E        I   D+G PP  S+ + ++ + DVNDNAPVF    M     EN  +  L+ ++ A D D+  N+   + + PD      F I  ++G+I    + + E+   Y+      D    SL+GT       V + + D NDN P+F  + Y+FS+ EN+   +P+  V   D+D  E N  I  + +P + + ++      Q+G   + SS   DRE   ++TF + A+D G P  SS   + I V D NDN P  + P    ++I+  Y  P  H    V    A+D+D G N+EL Y I   N   ++FQ+    G + +++ +       HRL + V D+G PS   T  + F +N  +  Q  +ET  G S F   + D
Sbjct:   41 LKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDY--GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSP-----VPRLLDGQIEIMDINDNTPNFN--SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVS-SYELIVGPEAQDLFGLQVA-----EDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFE-KMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT-----ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGE-NAHIHLSVEPESGEFVI------QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP----SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNP-FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQFTPLDID 845          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 263.848 bits (673), Expect = 2.025e-72
Identity = 225/839 (26.82%), Postives = 391/839 (46.60%), Query Frame = 1
Query:  175 MTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGH-FRLLDQNKLFYIEEKFGKL-RTKSRIDRESI--CKQVDANPDC----KIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGH---EVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERT--LTFKVN--IVQQ--IETYHGLSLFGKFEGD 2589
            + + +K   T+    + F +  + S   +   + EE   N ++  L + +   + +  H ++L   +    ++ K G +  T++ IDRES+  C+ ++    C    ++++  L  P      P ++   I I+DIND+ P +N  + ++TL IPE++ I   F +P A D D G + V+ SY +    + +  F L+V        +   +  LIV+G+LDRE++  Y + I   DGG P  +    + I + D ND++P+F+ ++     L EN+ +   +    A D D      + +SF   + D V +   L   +G + +Q  +D E   +  F+V   D           V + + + NDN P I ++ F      G +  +SE+      +  V V+D D+  +  +    + D P  + ++S    +++ K+ L+T  A D E        I   D+G PP  S+ + ++ + DVNDNAPVF    M     EN  +  L+ ++ A D D+  N+   + + PD      F I  ++G+I    + + E+   Y+      D    SL+GT       V + + D NDN P+F  + Y+FS+ EN+   +P+  V   D+D  E N  I  + +P + + ++      Q+G   + SS   DRE   ++TF + A+D G P  SS   + I V D NDN P  + P    ++I+  Y  P  H    V    A+D+D G N+EL Y I   N   ++FQ+    G + +++ +       HRL + V D+G PS   T  + F +N  +  Q  +ET  G S F   + D
Sbjct:   41 LKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDY--GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSP-----VPRLLDGQIEIMDINDNTPNFN--SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVS-SYELIVGPEAQDLFGLQVA-----EDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFE-KMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT-----ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGE-NAHIHLSVEPESGEFVI------QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP----SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNP-FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQFTPLDID 845          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 265.003 bits (676), Expect = 2.614e-72
Identity = 225/837 (26.88%), Postives = 391/837 (46.71%), Query Frame = 1
Query:  175 MTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGH-FRLLDQNKLFYIEEKFGKL-RTKSRIDRESI--CKQVDANPDC----KIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERT--LTFKVN--IVQQ--IETYHGLSLFGKFEGD 2589
            + + +K   T+    + F +  + S   +   + EE   N ++  L + +   + +  H ++L   +    ++ K G +  T++ IDRES+  C+ ++    C    ++++  L  P      P ++   I I+DIND+ P +N  + ++TL IPE++ I   F +P A D D G + V+ SY +    + +  F L+V        +   +  LIV+G+LDRE++  Y + I   DGG P  +    + I + D ND++P+F+ ++     L EN+ +   +    A D D      + +SF   + D V +   L   +G + +Q  +D E   +  F+V   D           V + + + NDN P I ++ F      G +  +SE+      +  V V+D D+      V C +  D P  + ++S    +++ K+ L+T  A D E        I   D+G PP  S+ + ++ + DVNDNAPVF    M     EN  +  L+ ++ A D D+  N+   + + PD      F I  ++G+I    + + E+   Y+      D    SL+GT       V + + D NDN P+F  + Y+FS+ EN+   +P+  V   D+D  E N  I  + +P + + ++      Q+G   + SS   DRE   ++TF + A+D G P  SS   + I V D NDN P  + P  ++++  +T     G  V    A+D+D G N+EL Y I   N   ++FQ+    G + +++ +       HRL + V D+G PS   T  + F +N  +  Q  +ET  G S F   + D
Sbjct:   33 LKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDY--GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSP-----VPRLLDGQIEIMDINDNTPNFN--SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVS-SYELIVGPEAQDLFGLQVA-----EDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFE-KMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAA-VTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT-----ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGE-NAHIHLSVEPESGEFVI------QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPS-NISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNP-FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQFTPLDID 837          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 265.003 bits (676), Expect = 3.039e-72
Identity = 225/837 (26.88%), Postives = 391/837 (46.71%), Query Frame = 1
Query:  175 MTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGH-FRLLDQNKLFYIEEKFGKL-RTKSRIDRESI--CKQVDANPDC----KIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERT--LTFKVN--IVQQ--IETYHGLSLFGKFEGD 2589
            + + +K   T+    + F +  + S   +   + EE   N ++  L + +   + +  H ++L   +    ++ K G +  T++ IDRES+  C+ ++    C    ++++  L  P      P ++   I I+DIND+ P +N  + ++TL IPE++ I   F +P A D D G + V+ SY +    + +  F L+V        +   +  LIV+G+LDRE++  Y + I   DGG P  +    + I + D ND++P+F+ ++     L EN+ +   +    A D D      + +SF   + D V +   L   +G + +Q  +D E   +  F+V   D           V + + + NDN P I ++ F      G +  +SE+      +  V V+D D+      V C +  D P  + ++S    +++ K+ L+T  A D E        I   D+G PP  S+ + ++ + DVNDNAPVF    M     EN  +  L+ ++ A D D+  N+   + + PD      F I  ++G+I    + + E+   Y+      D    SL+GT       V + + D NDN P+F  + Y+FS+ EN+   +P+  V   D+D  E N  I  + +P + + ++      Q+G   + SS   DRE   ++TF + A+D G P  SS   + I V D NDN P  + P  ++++  +T     G  V    A+D+D G N+EL Y I   N   ++FQ+    G + +++ +       HRL + V D+G PS   T  + F +N  +  Q  +ET  G S F   + D
Sbjct:   41 LKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDY--GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSP-----VPRLLDGQIEIMDINDNTPNFN--SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVS-SYELIVGPEAQDLFGLQVA-----EDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFE-KMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAA-VTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT-----ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGE-NAHIHLSVEPESGEFVI------QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPS-NISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNP-FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQFTPLDID 845          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 264.233 bits (674), Expect = 3.525e-72
Identity = 225/837 (26.88%), Postives = 391/837 (46.71%), Query Frame = 1
Query:  175 MTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGH-FRLLDQNKLFYIEEKFGKL-RTKSRIDRESI--CKQVDANPDC----KIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERT--LTFKVN--IVQQ--IETYHGLSLFGKFEGD 2589
            + + +K   T+    + F +  + S   +   + EE   N ++  L + +   + +  H ++L   +    ++ K G +  T++ IDRES+  C+ ++    C    ++++  L  P      P ++   I I+DIND+ P +N  + ++TL IPE++ I   F +P A D D G + V+ SY +    + +  F L+V        +   +  LIV+G+LDRE++  Y + I   DGG P  +    + I + D ND++P+F+ ++     L EN+ +   +    A D D      + +SF   + D V +   L   +G + +Q  +D E   +  F+V   D           V + + + NDN P I ++ F      G +  +SE+      +  V V+D D+      V C +  D P  + ++S    +++ K+ L+T  A D E        I   D+G PP  S+ + ++ + DVNDNAPVF    M     EN  +  L+ ++ A D D+  N+   + + PD      F I  ++G+I    + + E+   Y+      D    SL+GT       V + + D NDN P+F  + Y+FS+ EN+   +P+  V   D+D  E N  I  + +P + + ++      Q+G   + SS   DRE   ++TF + A+D G P  SS   + I V D NDN P  + P  ++++  +T     G  V    A+D+D G N+EL Y I   N   ++FQ+    G + +++ +       HRL + V D+G PS   T  + F +N  +  Q  +ET  G S F   + D
Sbjct:   41 LKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDY--GYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSP-----VPRLLDGQIEIMDINDNTPNFN--SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVS-SYELIVGPEAQDLFGLQVA-----EDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFE-KMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAA-VTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGT-----ASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGE-NAHIHLSVEPESGEFVI------QNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPS-NISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNP-FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVETLLGHSQFTPLDID 845          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 258.07 bits (658), Expect = 1.108e-70
Identity = 219/765 (28.63%), Postives = 358/765 (46.80%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CK-QVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVE--VKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG--VTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N+++  L   +     + GH   L+    +  ++ K G +  T++ IDRE +  C+ Q+  NP C +   +      +   P +++  I + DIND+ P  N  + ++TL IPE++ I S F +P A D D GP+ V  SY +    + +  F L+V        +   +  LIV+G LDRE+   Y + I   DGG PP +    + + V D ND++P+F+        L EN+ I   +    A D D      + ++F    E  V +   L   +G + +Q  +D E   +  F+V   D G    S   +  V V ++NDN+P I ++          +  +SE+      +  V V+D D+      V C +  D P  + + S    +++ K+ L+T    D E        I   D+G PP  S+ + ++ ++DVNDNAPVF          EN   G ++ ++ A D D+  NA   + L+P+      F I  E G+I  K   + E+   YE+     D    SL+GT       V +N+ D NDN P+F    Y+FS+ EN+ + +P+  V   D D  E N  ++         S+ +  G  V Q+G   + SS   DRE+  ++TF + A+D G P  S+   + I V D NDN P +I    + +H  +T    +G  V +  A+D+D G N+EL Y I   N    +FQ+   +G++ +++ +       HRL + V DRG P
Sbjct:   44 EEQPPNTLIGSLAADY--GLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNP-CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP--NFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVA-SYELQAGPEAQELFGLQVA-----EDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPT-YEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA-VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGT-----ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE-NARVQL--------SVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-FITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNP-YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 778          

HSP 2 Score: 155.992 bits (393), Expect = 5.233e-38
Identity = 129/458 (28.17%), Postives = 207/458 (45.20%), Query Frame = 1
Query: 1216 EVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP----IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSP----RFDKDIYH----FSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK--HIGVTQDGKIFVRSSQ-LDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++V ++NDN+P  +         L + EN+  G      + TD D     +  +     P    +  L    D+   +  L  +   DRE       TIK  D G PP+ SS   R+ +LD NDNAP F      A + EN  +G  + Q+KA D D   NA   +      EV     R++  TG I  +   + E+ S    S    D    T      +V + ++DMNDN+P    R    + H     +I E+V   T +  V+  D D  E N A+           + +    G     K F++++  LD EK   +T  I+A+D+G+P LSS+  ++++V D+NDN P +     S+  +    +   G  V +  A D D GSN+EL Y +    + + +F + P  G + VK +L      ++ L ++  DRG+PSL+ T T  VN++
Sbjct:  133 QIEVQDINDNTPNFASPVIT----LAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ---SITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVL 581          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 258.07 bits (658), Expect = 1.108e-70
Identity = 219/765 (28.63%), Postives = 358/765 (46.80%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CK-QVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVE--VKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG--VTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N+++  L   +     + GH   L+    +  ++ K G +  T++ IDRE +  C+ Q+  NP C +   +      +   P +++  I + DIND+ P  N  + ++TL IPE++ I S F +P A D D GP+ V  SY +    + +  F L+V        +   +  LIV+G LDRE+   Y + I   DGG PP +    + + V D ND++P+F+        L EN+ I   +    A D D      + ++F    E  V +   L   +G + +Q  +D E   +  F+V   D G    S   +  V V ++NDN+P I ++          +  +SE+      +  V V+D D+      V C +  D P  + + S    +++ K+ L+T    D E        I   D+G PP  S+ + ++ ++DVNDNAPVF          EN   G ++ ++ A D D+  NA   + L+P+      F I  E G+I  K   + E+   YE+     D    SL+GT       V +N+ D NDN P+F    Y+FS+ EN+ + +P+  V   D D  E N  ++         S+ +  G  V Q+G   + SS   DRE+  ++TF + A+D G P  S+   + I V D NDN P +I    + +H  +T    +G  V +  A+D+D G N+EL Y I   N    +FQ+   +G++ +++ +       HRL + V DRG P
Sbjct:   44 EEQPPNTLIGSLAADY--GLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNP-CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP--NFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVA-SYELQAGPEAQELFGLQVA-----EDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPT-YEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA-VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGT-----ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE-NARVQL--------SVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-FITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNP-YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 778          

HSP 2 Score: 155.992 bits (393), Expect = 5.233e-38
Identity = 129/458 (28.17%), Postives = 207/458 (45.20%), Query Frame = 1
Query: 1216 EVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP----IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSP----RFDKDIYH----FSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK--HIGVTQDGKIFVRSSQ-LDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++V ++NDN+P  +         L + EN+  G      + TD D     +  +     P    +  L    D+   +  L  +   DRE       TIK  D G PP+ SS   R+ +LD NDNAP F      A + EN  +G  + Q+KA D D   NA   +      EV     R++  TG I  +   + E+ S    S    D    T      +V + ++DMNDN+P    R    + H     +I E+V   T +  V+  D D  E N A+           + +    G     K F++++  LD EK   +T  I+A+D+G+P LSS+  ++++V D+NDN P +     S+  +    +   G  V +  A D D GSN+EL Y +    + + +F + P  G + VK +L      ++ L ++  DRG+PSL+ T T  VN++
Sbjct:  133 QIEVQDINDNTPNFASPVIT----LAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ---SITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVL 581          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 242.276 bits (617), Expect = 3.035e-66
Identity = 204/712 (28.65%), Postives = 340/712 (47.75%), Query Frame = 1
Query:  412 TKSRIDRESICKQVD--ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPI-VELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            T +RIDRE +C         +C   L ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D G + V + Y +    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + V+D+ND+ P FK +  + + + EN  + + +    A D D      +R+ F +       + F L   +G + +Q+SLD E    +  TV  +DG    +   V + V +VNDN P I ++         + +SE       I  + V+D D D +G   V C I++ +   L  + D   N++LL+T    D E      F I  SD+G+P  + +   R+ + D NDN P+F    +  ++ EN   G  +  + A DED+  NA+  + L P++   F ++ +TG + +  +FN EE  R+  +    D+           V + + D NDNSP+F  + + F + EN+   + +  +   D D  E NKA+  +     +  +L  + GV +    F      DRE+  S+TF + A D G P  SS+A + I V D+NDN+P  I P  + +   +      G  V +  A D+D G N+EL+Y I   N+ + +F+++P TG++ ++      D+  HRL + + D G P    TL  
Sbjct:   88 TSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR---LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFPIPSATDPDTGFNGV-QHYEL---LNGQSVFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFK-EGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNG--KVICFIEREVPFHLKAVYD---NQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ-AAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILNDNENFVLDPYSGVIKSNVSF------DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN-KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVL 769          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 242.276 bits (617), Expect = 1.719e-65
Identity = 220/757 (29.06%), Postives = 356/757 (47.03%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG---GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK-SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   D       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP A+D D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDRE++  Y + +   DGG P  S    + + V D ND+ P F  +  I +S+ EN  I S +    A D D  +   + F F +   +   + F L   +G + +++ LD E   S+   V  TDG    +   V V V ++NDN P I ++       G +L +SEN+     I  + V D D +++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  ++ EN + G  + ++ A D D+  NA   + L  D+   F ++  TG + +    + E+  +Y  +    D+           V + + D NDNSP F  + Y+F + E++     +  +   D D  E N A+  +     D+ +I    GV +    F      DRE+  S+TFY+ A D G  + SS+A + I V D+NDN P +I P  + +   +      G  V K  A D D G N+E+ Y I   N+ + +F +E T+G++ +K    V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDE-IFRLVKIRFLIE--DINDNAPLFP--TTVINISIPENSAINSRYSLPAAIDPDIGINGV-QNYQLIKSQN---IFGLDVI-----ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEK-EIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVL-LSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPF-RLRPV---FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMS-NATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGE-NSAVTLSILDVNDQFTIDPQSGVIRPNISF------DRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNT-KGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 95.5153 bits (236), Expect = 2.263e-19
Identity = 89/329 (27.05%), Postives = 142/329 (43.16%), Query Frame = 1
Query: 1597 NEPMRATIKENMAVGTLIYQLKAQ---DEDTELNANFRFYLQPDSEVNFRIESETGKIF------------SKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKI--FVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITE--PNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            N  +R  + EN+ +G L+  L      D+       F+   +       RIE  TG+IF            + I+ +A     YE+   V    +  F  V  K+   IED+NDN+P F   + + SI EN    +      A D DI  IN    Y      +   L  I   +  K+   +   +LDRE+  ++   +   D G P  SS+A +Q+ V D NDN P +I  +     ++I  + P+G  V +  A D D G N+ + ++ +    N  + +F L  TTG + VK  L   +  +H+L +L  D G+     T+   V
Sbjct:   27 NYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDAR--CFYEVEVAVLP--DEIFRLV--KIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKE---IEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNV 345          

HSP 3 Score: 85.1149 bits (209), Expect = 3.912e-16
Identity = 100/389 (25.71%), Postives = 169/389 (43.44%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFT---SIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNAN 1695
            +I + D ND+AP + +  + ++L +PE++   +      A D D G  N   SY +  +   E   D R  + +++               LDREKQ +Y   + A D G+PPL     V + V D ND+SP F +    N  + E+   +  + +    D D  + + +  S L     +V   F +  +SG +    S D E + SYTF V+  DG   +   +  V + V++VNDN P I +   +      V  ++  G  +  VV  D DD      V  SI     +   + ++      LK  K    ++G +++  +K +D G+P       S  ++++VN     F+NE        ++   TLIY+L  +  D   N N
Sbjct:  453 LIKVKDENDNAPVFTQ--SFISLSVPENNSPGAQLTKISATDADSG-QNAEISYMLGFDAPPEFNLDQRTGILTAVKK-------------LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHN-EYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL-----DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKP-IFIDPPSNYSFEWVLPSTNPGTVVFKVVAID-DDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKE-KCMVSDLGLHRVI-VKANDLGQP------DSLFNVVNVN----FFINE--------SVPNATLIYELVRRSIDAPANQN 797          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 243.817 bits (621), Expect = 1.791e-65
Identity = 204/712 (28.65%), Postives = 340/712 (47.75%), Query Frame = 1
Query:  412 TKSRIDRESICKQVD--ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPI-VELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            T +RIDRE +C         +C   L ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D G + V + Y +    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + V+D+ND+ P FK +  + + + EN  + + +    A D D      +R+ F +       + F L   +G + +Q+SLD E    +  TV  +DG    +   V + V +VNDN P I ++         + +SE       I  + V+D D D +G   V C I++ +   L  + D   N++LL+T    D E      F I  SD+G+P  + +   R+ + D NDN P+F    +  ++ EN   G  +  + A DED+  NA+  + L P++   F ++ +TG + +  +FN EE  R+  +    D+           V + + D NDNSP+F  + + F + EN+   + +  +   D D  E NKA+  +     +  +L  + GV +    F      DRE+  S+TF + A D G P  SS+A + I V D+NDN+P  I P  + +   +      G  V +  A D+D G N+EL+Y I   N+ + +F+++P TG++ ++      D+  HRL + + D G P    TL  
Sbjct:   88 TSNRIDREKLCAGASYAEENECFFELEVVILPNDFFR---LIKIKIIVKDTNDNAPMF--PSPVINISIPENTLINSRFPIPSATDPDTGFNGV-QHYEL---LNGQSVFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFK-EGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGK--VICFIEREVPFHLKAVYD---NQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQ-AAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGE-NKAVTLSILNDNENFVLDPYSGVIKSNVSF------DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN-KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVL 769          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 6.101e-71
Identity = 221/765 (28.89%), Postives = 361/765 (47.19%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CK-QVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVE--VKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKP--IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG--VTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N+++  L   +   F + GH   L+    +  ++ K G +  T++ IDRE +  C+ Q+  +P C +   +      +   P +++  I + DIND+ P  N  + ++TL IPE++ I S F +P A D D GP+ V  SY +    + +  F L+V        +   +  LIV+G LDRE+   Y + I   DGG PP +    + + V D ND++P+F+ +      L EN+ I   +    A D D      + ++F    E  V +   L   +G + +Q  +D E   +  F+V   D G +  S   +  V V ++NDN+P I ++          +  +SE+      +  V V+D D+      V C +  D P  + + S    +++ K+ L+T    D E        I   D+G PP  S+ + ++ ++DVNDNAPVF          EN   G +I ++ A D D+  NA   + L+P+      F I  ETG+I  K   + E+   YE+     D    SL+GT       V +N+ D NDN P+F    Y+FS+ EN+ + +P+  V   D D  E N  ++         S+ +  G  V Q+G   + SS   DRE+  ++TF + A+D G P  S+   + I V D NDN P +I    + +H  +T    +G  V +  A+D D G N+EL Y I   N    +FQ+   +G++ +++ +       HRL + V DRG P
Sbjct:   66 EEQPPNTLIGSLAADY--GFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDP-CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTP--NFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVA-SYELQAGPEAQELFGLQVA-----EDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFE-RPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAA-VTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGT-----ATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE-NAQVQL--------SVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-YITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNP-YGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 800          

HSP 2 Score: 158.303 bits (399), Expect = 7.794e-38
Identity = 130/459 (28.32%), Postives = 210/459 (45.75%), Query Frame = 1
Query: 1216 EVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP----IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHK-VFGKVDLNIEDMNDNSP----RFDKDIYH----FSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK--HIGVTQDGKIFVRSSQ-LDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++V ++NDN+P  +         L + EN+  G      + +D D     +  +     P    +  L    D+   +  L  +   DRE       TIK  D G PP+ SS   R+ +LD NDNAP F      A + EN  +G  + Q+KA D D   NA   +      EV     R++  TG I  +   + E+ S    S    D   GT  K    +V + ++DMNDN+P    R    + H     +I E+V   T +  V+  D D  E N A+           + +    G     K F++++  LD EK   +T  I+A+D+G+P LSS+  ++++V D+NDN P +     S+  +    +   G  + +  A D D GSN+EL Y +    + + +F + P TG + VK +L      ++ L ++  DRG+PSL+ T T  VN++
Sbjct:  155 QIEVQDINDNTPNFASPVIT----LAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKD--RGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ---SVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVL 603          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.929e-69
Identity = 223/755 (29.54%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   +       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP AVD D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDREK+  Y + +   DGG P  S    + + VTD ND+ P FK +  I +S+ EN  + + +    A D D  +   + FSF +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V +VNDN P I ++       + + +SEN      I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  +I EN + G  + ++ A D D+  NA   + L PD+   F ++  TG +      + E+  +Y  +    D+           V ++I D NDNSP F  + Y+F + EN+     +  +   D D  + +           D +I    GV +    F      DREK  S+TFY+ A D G  + SSSA + I V D+NDN P +I P  + ++  +      G  V +  A D D G N+E++Y I   N+ RD+F ++  TG++ +     V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-IFRLVKIRFLIE--DINDNAPLFPA--TVINISIPENSAINSKYTLPAAVDPDVGINGV-QNYELIKSQN---MFGLDVI-----ETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPF-RLRPV---FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-TVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF------DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT-RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 4.210e-69
Identity = 219/755 (29.01%), Postives = 347/755 (45.96%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   D       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP  +D D G + V   + I     G+  F L VI      +  G ++  LIV   LDRE++  Y + I   DGG P  S    + + V D ND+ P FK    I +S+ EN  + S +    A D D  +   + F F +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V ++NDN P I ++         + +SEN+     I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  ++ EN + GT + ++ A D D+  NA   + L  D+   F ++  TG + +    + E+  +Y  +    D+           V + + D NDNSP F  + Y+F + EN+     +  +   D D  E +  I        D +I    GV Q    F      DREK  S+TFY+ A D G  + SS+A + I V D+NDN P ++ P  + +   +      G  V    A D D G N+EL+Y +   N+ + +F ++ T+G++ +K      DL  HRL +  KD G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPDRSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVVDAHCFYEVEVAVLPDE-IFRLVKIRFLIE--DINDNAPLFPAT--VINISIPENSAINSRYALPATIDPDTGINGVQNYHLIK----GQSIFGLDVI-----ETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKEN-EIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVPF-RLRPV---FSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPL-MTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISF------DREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNT-KGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          

HSP 2 Score: 78.1814 bits (191), Expect = 3.552e-13
Identity = 92/390 (23.59%), Postives = 162/390 (41.54%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFT---SIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANF 1698
            +I + D ND+AP + +    ++L +PE++   +      A+D D G  N   +Y +  +   E   D R  + +++               LDREKQ +Y   + A D G+PPL     V + V D ND+SP F +    N  + EN   +  + +    D D  + + +  S L   +D     F +  ++G +    S D E + SYTF V+  DG   +   +  V + V++VNDN P   V S +      V  ++  G  +  VV  D D        +  +      L  + D+      LK    F  ++G +++  +K  D G+P    +  +                  +   + E++   TLIY+L  ++ +T +  N 
Sbjct:  453 LIKVKDENDNAPVFTQ--PFLSLSVPENNSPGTQLTKISAMDADSG-RNAEINYLLGFDAPSEFNLDHRTGILTAVKK-------------LDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHN-EYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDD-----FTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPS-SNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLF-IIDQTSGNITLKEKCVF-ADLGLHRL-VVKAKDLGQPDSLFNVVN------------------VNLFVNESVTNATLIYELVRKNIETPVTQNI 798          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.431e-69
Identity = 222/755 (29.40%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   +       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP AVD D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDRE++  Y + +   DGG P  S    + + VTD ND+ P FK +  I +S+ EN  + + +    A D D  +   + FSF +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V +VNDN P I ++       + + +SEN      I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  +I EN + G  + ++ A D D+  NA   + L PD+   F ++  TG +      + E+  +Y  +    D+           V ++I D NDNSP F  + Y+F + EN+     +  +   D D  + +           D +I    GV +    F      DREK  S+TFY+ A D G  + SSSA + I V D+NDN P +I P  + ++  +      G  V +  A D D G N+E++Y I   N+ RD+F ++  TG++ +     V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-IFRLVKIRFLIE--DINDNAPLFPA--TVINISIPENSAINSKYTLPAAVDPDVGTNGV-QNYELIKSQN---IFGLDVI-----ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPF-RLRPV---FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-TVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF------DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNT-RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 6.971e-69
Identity = 222/755 (29.40%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY---------IEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            EE   N ++ DL    + +   +       Q KL Y         IEE  G++  T +RIDRE +C  +  +  C   + +   P +   + V I+ +I   DIND+AP +     ++ + IPE+S INS + LP AVD D G + V ++Y + K+++    F L VI      +  G+++  LIV   LDRE++  Y + +   DGG P  S    + + VTD ND+ P FK +  I +S+ EN  + + +    A D D  +   + FSF +   +   + F L   +G + +++ LD E   ++   V  +DG    +   V V V +VNDN P I ++       + + +SEN      I  + VTD D D++G +  F   + P   L P+     N+FLL+T    D E        +  +D G+PP + S    + + D NDNAPVF    +  +I EN + G  + ++ A D D+  NA   + L PD+   F ++  TG +      + E+  +Y  +    D+           V ++I D NDNSP F  + Y+F + EN+     +  +   D D  + +           D +I    GV +    F      DREK  S+TFY+ A D G  + SSSA + I V D+NDN P +I P  + ++  +      G  V +  A D D G N+E++Y I   N+ RD+F ++  TG++ +     V DL  HR+ +   D G P
Sbjct:   32 EEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDE-IFRLVKIRFLIE--DINDNAPLFPA--TVINISIPENSAINSKYTLPAAVDPDVGTNGV-QNYELIKSQN---IFGLDVI-----ETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK-ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPF-RLRPV---FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-TVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISF------DREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNT-RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A1I8IPY5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 7.348e-112
Identity = 246/750 (32.80%), Postives = 383/750 (51.07%), Query Frame = 1
Query:  379 FYIEEKFG-KLRTKSRIDRESICKQVDA----NPDCKIALFILY----HPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPP-LSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGEL------LTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPI-VELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENM--AVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD-----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNF---KPGTDKSI-LKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTH-RLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            F  E+  G K   KS+IDRES+C +V A     PDCK++L I+      PGK      +++  + ++D+ND+AP WN     ++L++PEHSP+ S F+LP A+D D+ P+N T+ Y +    D   KF L  ++      ++G+ L L +   LDRE  + +Q  + A+DGG P  L+G L VNI V+DIND+ PRF  + P  + + EN+ ++  +    A D D SD   LRF    +    V + F + +++G +   ++LDYE + SY   V VTDGKH     V ++V+N NDN PKI++ SF GG          ++EN+  G  + ++ V DADD    L V C ++ P    + PL   A+  FL+ + +AFDRE        I C+D G P +  S   R+ I D NDN P FL  P+   + EN       ++ +++A+D D+  NA  R+ L   S  +F I+  T  I+++  F+ E   ++ ++ + TD      +EG      G V +NIED+ND  P F    Y F++ EN      +  V A D D  E ++ + Y       G D  +   +  VTQDG+++  S  +DRE   SFTF ++A D        +A++ + + DINDN+P+W+ P      +N++   P+G  V +   KD D G N  + Y +        +F + P    L   +     DL    RL I+  DRG P         + IV++
Sbjct:  226 FVEEQPSGTKCFQKSKIDRESLCSEVGACCPEAPDCKLSLSIIVFDKSQPGKVRE---IVRLDLRVVDLNDNAPRWNSPR--LSLEVPEHSPVGSRFQLPVAMDPDKAPENATQRYELVSGLD---KFQLGYLLADPAGRQAGS-LWLEIRADLDREVAAWHQAELVAVDGGHPAALTGSLTVNISVSDINDNPPRF-GRFPRLVKVAENSPLSRELLRLNATDADDSDMERLRFRLGVSASQSVAEMFRVDKRTGSVWAMRTLDYEERKSYDIPVTVTDGKHSADASVRIEVVNENDNPPKITLVSFGGGGGGSSSGNFELAENAAFGTTVASLDVFDADDKEESLSVACYVEPPTEFGILPLYKSAKRNFLVVSNRAFDREQTPSFTVRISCNDNGTPNRVDSVVMRIDIRDENDNTPEFLQNPLFVLLPENKDPLPAFVLAKMEARDADSGDNAELRYSLDAASSRHFDIDRGTAAIWARRSFDRELEQQFNLTVFATDLGDLPDVEGRRRTATGTVVVNIEDVNDCPPEFSASHYAFAVEENAELTRYLGNVTASDCDAEERHRRVVYRMLGGPSGPDSQLAFNYFRVTQDGRVYTGSQPIDREFRESFTFLVLADDQAG--RRQTAHVTVSILDINDNSPQWVFPSSDTQQVNVSVQQPIGRPVARLRTKDPDYGPNGSVVYSLESHQPPTRLFSVTPEGEILLSGQINPARDLGQFVRLRIVAADRGQPPRSSWANLTIRIVER 963          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A267DUI6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021969g1 PE=4 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 3.914e-110
Identity = 275/865 (31.79%), Postives = 453/865 (52.37%), Query Frame = 1
Query:  199 YTSITYLILFMVKRITSEMSIELY--LVEECSNNSIVTDLNNRFHSNFNNDG-------HFRLLD-QNKLFYIEEKFGKLRTKSRIDRESICKQV-----DANPDCKIALFILYHPGKRTTKPV--MIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSF----------AGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP-IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENM--AVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKV----FGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNF--KPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVH-DLR-THRLNILVKDRGNP-SLERTLTFKVNIVQQIETYHGLSLFGKFEGDXXXXXXXXXXXXXXXXXXXSAIWFLKCGF 2676
            Y +  ++    ++   S+ S  L    VEE  + + + DL +         G        F+ LD + K F+++ K G++  K+RIDRES+C++        NPDCK+ + I      R+      +++  + +LD+ND+AP W   +  + L+I EH+ + S F+LP A D D+ PDN T+ Y ++   D       RV+   S +      L L VL  LDRE +  + ++I A+DGG  PL+G + VN+ +TDIND+ P F ++    +S+ EN  +   +F   A D D+SD  NL + F  +    V   F +  +SG ++  + LDYE+K  Y+  V V+DGKH     +EV++LN+NDN P I+V+S           A    L + EN+  G  I +V V DADD +    V C I+   +  + PL + AR++F + +   FDRE+ S    T+ C D G P + +S  +R+ ++D ND+ P F    + A + EN   ++   + +++A D+D  +NA  R+ L   SE  F I++ TG I+ K  F+ E+ S+  I+ +  D  + +  ++     G V +NI+D+ND  P F +  Y F++ ENV + T + +V A D D  E +++I Y    +PG D S L    V+ DG ++  +  LDRE   S++  ++A D      S +A + I V D+NDN P W++P  +   +NI+ H  VG  V K  A D D+G+N  + Y +        +F +    G L + R++  + D+   H L     D+G+P  L    +  + I +Q    +GL      EG+L+II+ +V++TL++ + LI+AI+FL+C F
Sbjct:   12 YLAWLFVCSLFIELAASQTSFFLRHSFVEEQPSGAKLADLRHLLQLQGGRRGDANLDRCEFQPLDIREKYFFVDSKTGEIFAKARIDRESLCEEAVTCCKGINPDCKLPMTIGMVDPTRSGPAFQEILQVDLDVLDLNDNAPRWT--SPTLLLEISEHTLVGSKFKLPPADDPDKAPDNTTQIYRLASGTDL-----FRVVPVFSPDPAVSVVLLLEVLVDLDRETKPFHTIVIHAVDGGPVPLTGSVTVNVSLTDINDNPPFFTHE-SRTVSIPENYPLEKELFRVTASDRDASDIENLHYRFSLSASKAVLDDFRVDRRSGSIVAVRPLDYESKREYSIPVTVSDGKHLVETTIEVRLLNINDNPPTITVKSILPEQQPSASGAQSSDLFIRENAPIGTLIASVDVKDADDKAMQETVTCFIEPSRLFGMLPLYEAARHQFKIVSNVPFDRELKSMHQATVTCHDNGSPNRDASVQNRIRVIDENDHPPTFRERIVEAQLHENAETSMTKPVIRMEAGDKDEGVNAAIRYSLDTQSEHAFYIDTLTGAIYPKFSFDREKISQVNITVFAKDMGDSSDTELQFTATGTVVVNIQDVNDCDPVFQQRHYSFAVVENVPNRTFVGKVRATDCDAEERHRSIVYRLIRQPG-DPSQLFPFEVSPDGSVYTSTDNLDREARHSYSLRVLADDQAD--RSDTATMSIAVLDLNDNAPRWVYPGGTAPRVNISMHKSVGDTVYKLHASDPDEGNNGTVVYSLVSVQPYDSLFVVS-RAGDLTLGRSIVFNRDVNLLHNLVFNACDQGSPRQLFSVKSMSIFITEQAPNNYGLGSPKTSEGNLIIIVAMVVITLVVSIVLIAAIFFLRCNF 864          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4S2M0G9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004667 PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.259e-104
Identity = 283/1004 (28.19%), Postives = 450/1004 (44.82%), Query Frame = 1
Query:  214 YLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNN--------DGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVD------------------------------ANPDCKIALFILY--HPGK-----RTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNK---------------DGEMKFDLRVIMKSSLN--------------SKSGNELSLIVLGILDREKQS------------------QYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINIS------------LHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGE-----------------------LLTVSENSESGQHIGAVVVTDAD---------DNS--------GLLP-------------------VFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD------------------SLEGTF------HKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITE-----------------------PNS---------GR---------DIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQ 2538
            + + F++ R+ +++++E  +VEE  + + + +LN    S  NN         G F+LL Q  LF +    G+L T+S IDRE IC +                                 +  C I L +L+  HP +     ++ + +++K  + +LDIND+ P+W +  N++ L +PEHSP+ + F LP A D D GP N T SY +++                 +G  + D  +I +S  +              ++    L L V   LD +  S                  Q  + ++A DGG+P  L+G   +NI V DINDHSP FK Q P  +S            + ENT +  +I+V  A D+D SD   L+FS  ++    V   F +   +GE+ L +S DYE + S+T  + VTD KH  ++ + V++ N ND+ P I VQS                             L ++E+   G+ I  V V+D D         DNS           P                   + C I+   + LSPL D A N+F L T  AFDRE  +    T+ C D G+P   S     L I D+ND+AP+F N+ M A +KEN   GT++Y  +A D D  +NA   F L P++   F I+  TG I S   F+ E+ +++ ++  V D                   + G F      H V   + ++I+D+ND  P F   +Y  S+ E+    + + +++A DSD +E N  ++Y  K  T+    +   V+  G I+V    LDRE+ PS+ FY++A+D+G P LSS+  + + V D+NDN P W+ P  +   +N+T   PVG+ V +  A D D+G N E+ Y + +                       PN          GR         ++F+L+  +GS+YV R++   D+ + +L +   D+G P        ++NIV+
Sbjct:   19 FTLQFLLVRMHAQLTMEFTVVEESPSQTFIGNLNTA-PSLLNNMADSQSLVGGTFQLLTQTNLFQLNSSTGELFTRSVIDRERICPEASNVRFVQSDSTARTKLQSERTHDLPVVLDKLGDSICVIQLQVLHFLHPQQVPADVQSHRVLILK--LTVLDINDNPPSWQE--NVIHLSVPEHSPVGTRFPLPTAFDPDCGPTNTTVSYALTEATSDGRSSGIKQVTHYGNGAFQLDTELIQESGFSELNNLMWSQQTMHCTRRMFRLWLRVTRDLDYDDVSTSNRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPIFKIQNPGKLSTGSSTILEDTVEIEENTPVGRVIYVAQASDLDESDKGRLQFSLGTSVSRLVRSAFEVNSNTGEVALLQSPDYEKQKSFTVPLIVTDHKHTANMNLLVRIKNQNDHPPVIVVQSVGNPASTNVDPNYKNTKAIIPYSPTRSVTLHITEHDSPGRFIATVFVSDLDEPDRTEAAYDNSLHITPYQTAAAPPASVLSSTFFEGSSAAENGIRCQINHLGLALSPLFDGAVNQFKLVTRTAFDREQQAEHFATLVCYDRGQPQLSSQLGIHLLIDDINDHAPIFKNQNMVAYLKENEPAGTVVYTAEATDLDLGINAQLHFSLSPENLNEFSIDPITGIIRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDEPINHGIIQVRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVAEDAKINSLVGQIKANDSDATETNNQVQYLIKSQTENDGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATLENLERGGPLTSKMAFIPNRHSNADAKYVGRLGADRPTAGNLFELDSNSGSIYVGRSMGTDDIGSIKLVVEASDKGQPIKVNHRVLQINIVR 1017          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: H2KRD8 (Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN=CLF_106059 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 3.391e-104
Identity = 280/1004 (27.89%), Postives = 445/1004 (44.32%), Query Frame = 1
Query:  214 YLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNN--------DGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVD------------------------------ANPDCKIALFILY--HPGK-----RTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKD---------------GEMKFDLRVIMKSSLNSKSGN--------------ELSLIVLGILDREKQS------------------QYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINIS------------LHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGEL-----------------------LTVSENSESGQHIGAVVVTDADDNSGLLPVF------------------------------------CSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD------------------SLEGTF------HKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITE-----------------------PNS---------GR---------DIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQ 2538
            + + F++ R+ +++++E  +VEE S+ + + +LN    S  NN         G F+LL Q  LFY+    G+L T+S IDRE IC + +                               +  C I L +L+  HP +     ++ + +++K  + +LDIND+ P+W +  N++ L +PEHSP+ + F LP A D D GP N T SY ++                   G  + D  ++ +S  +  S                 L L V    D E  S                  Q  + ++A DGG+P  L+G   +NI V DINDHSP FK Q P  +S            + ENT +  +I+V  A D+D SD   L+FS  ++    V   F +   +GE+ L +S DYE + S+T  + VTD KH  ++ + V++ N ND+ P I VQS                             L ++E+   G+ I  V V+D D+  G    +                                    C I+   + LSPL D A N+F L T  +FDRE  +    T+ C D G P   S     L I D+ND+AP+F N  M A +KEN   GT++Y  +A D D  +NA   F L  D+   F I+  +G I S   F+ E+ +++ ++  V D                   + G F      H V   + ++I+D+ND  P F   +Y  S+ E+    + + +++A DSD +E N  ++Y  K  T+    +   V+  G I+V    LDRE+ PS+ FY++A+D+G P LSS+  + + V D+NDN P W+ P  +   +N+T   PVG+ V +  A D D+G N E+ Y + +                       PN          GR         ++F+L+  +GS+YV R+++  D+ + +L +   D+G P        ++NIV+
Sbjct:   19 FTLQFLLVRMHAQLTMEFTVVEESSSQTFIGNLNTA-SSLLNNVVDSQSLVGGTFQLLTQTNLFYLNSSTGELFTRSVIDRERICPEANNVRFVQSDSSSRTKLQSERTHDLPVVLDKLGDSICVIQLQVLHFMHPQQAPADVQSHRVLILK--LTVLDINDNPPSWQE--NVIHLAVPEHSPVGTRFPLPTAFDPDCGPINTTVSYALTDATSDGRSSGIKQVTHYGHGAFQLDTELVQESGFSELSSLMWSQQTMHCTRRMFRLWLRVTRDFDYEDVSTSSRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPTFKIQNPEKLSAASGTILEDIVEVEENTPVGRVIYVAQASDLDESDKGRLQFSMGTSVSRSVRSAFEVNTNTGEVALLQSPDYEKQKSFTVPLIVTDHKHTATMNLLVRIKNQNDHPPVIVVQSVGNPASTNVDPNYKNTQASIPYSPTRSVNLHITEHDSPGRFIATVFVSDLDEPDGTEAAYDNSLHITPYQTAAAPPASVLSSKFFEASSAAENGIRCQINHLGLALSPLFDGAVNQFKLVTRTSFDREQQAEHFATLVCYDRGHPQLSSQLGIHLLIDDINDHAPIFKNHNMVAYLKENEPAGTVVYTAEATDLDLGINAQLHFSLSSDNLNEFSIDPMSGIIRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDAPTNRGIIQIRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVSEDAKINSLVGQIKANDSDATETNNQVQYLIKSQTENDGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATLENLERGSPLTSKMAFIPNRHSNADAKYVGRLGADRPTAGNLFELDSNSGSIYVGRSMSTDDIGSIKLVVEASDKGQPVKVNHRVLQINIVR 1017          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A564YH37 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5814 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 3.465e-104
Identity = 250/837 (29.87%), Postives = 403/837 (48.15%), Query Frame = 1
Query:  253 MSIELYLVEECSNNSIVTDLNNRFHSNFNNDGH--FRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQV---------------------DANPDCKIALFILYH--PGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKF---------DLRVIMKSSLNSKSGNE----LSLIVLGILDREKQSQYQVLITAMDGGVP-PL----SGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYET----------------------KMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQS----FAGGELLTVSENSESGQHIGAVVVTDADD---------NSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTF------------HKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIG--------------VTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHI---NITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTL 2436
            +S+   L EE    +++  L  +     ++     F  L Q +   + +  G+L  +SRIDRE++C+QV                     D NPDC + L ++    PG  +T+P ++  I +I+DIND+ P W+   + + ++IPEHSPI +  +LPEA D D+  ++    Y +    +    F         D+ ++  +  +S  G      L L +   LDRE++ QY++L+ A DGG   P+    +G L + ++VTDIND +P F  + P  I + E+    + IF  +A+D D SDA  L + F S    EV + F + EK+G + L + LDYE                       ++ Y   V+VTDG HF+   + V++ NVNDN+P I+VQS    +     L +SE+   G  I  + + DAD+           G     C    P   + PL   AR +++L T +  DRE  S    TI C D+G+P         +H+ D+ND+ PVF     ++ I EN+   TLI +++A D D  LNA  R+ ++ D ++    +++  +G+I+S  +F+ E+      +    D   G              H     V + IED+ND  P FD++ Y F + E       +  V A DSD    N  I+Y+     +     H G              +T +G+I+ R+  +DREK P  +F +IA D G P+LS+ A + I V+D+ND++P WI P  S + I   N++ H  VG E+   +A D D G N E++Y I + N  ++ F L+  +G+LY+ + L
Sbjct:   30 ISVIFPLAEEQPPGTLIGSLIEKLGPKLSSPSSVLFTPLGQERYIRLNQTSGQLFVRSRIDREALCEQVGTCCTSSSKSQNAFSHAFENDDPNPDCALHLLVIDQRDPGS-STQPKLVHIIFNIVDINDNPPKWSP--DTLEIEIPEHSPIGTTIQLPEATDPDQCIESAPIRYELIPQIESTSGFSNHESRNIADMFMLSITPTDSSFGASQKLNLQLKINSDLDRERRDQYRLLLIATDGGSKNPVFGDRTGTLNIIVKVTDINDQAPYFPEEHP-TIEISEDVEPRTRIFTMIAKDDDPSDATRLVYRFASMASGEVMRLFSICEKTGTITLNQELDYEVAPLLPDSRSSNSLYNSQGDKAKEVGYIIPVRVTDGVHFSQAELRVRLKNVNDNAPNITVQSHLPRWRNTNDLLLSEDVAVGTMIATITMEDADERWMDNKLGTGGGYSESQCETAHPFFTVQPLYPTARYQYMLVTSRPLDRETKSTHTITIACHDSGQPVLSRGVHVVIHLEDLNDSPPVFSQVLYQSKISENLPFNTLIEKVQATDSDIGLNAAIRYGIKSDVDLGDLVKLDPMSGQIYSATVFDREKMESINFTVIAMDCAGGAMNKSEINNGCSIIHTASASVIIMIEDVNDCVPEFDQNNYEFVVKEGQRPQQSVGSVHATDSDADIKNSRIQYSISESEELQQSDHPGSVNNEGYRASSLFAITSNGEIYTRNLPIDREKTPVLSFTVIASDFGHPSLSAFANVVIRVQDVNDHSPVWIFPQSSSSIIVRANMSSHATVGREIAHLKAIDADSGPNGEIEYTIIKGNE-QEFFALDKASGTLYLAKQL 861          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: ENSAMXT00000036470.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10716691:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000036470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 267.314 bits (682), Expect = 3.065e-74
Identity = 225/789 (28.52%), Postives = 371/789 (47.02%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNN--DGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSI-IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSG-------ELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSID------KPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKII---FNAEESSRYEISAYVTDSLEGT---FHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNF--KPGTDKSILKHIGVTQ-DGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHP---DPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIET 2550
            EE    ++V ++    + N  +     FR++   K F +  K G L    RIDRE++C  +     C +      H       P+ +  I +HI+DIND+AP +     +  L I E S +   F LP A D D G  N  K+Y +S N+     F L V      N +    + L++   LDRE QS   +++TA+DGG PPLSG   + I + D+ND+SP F   +   + + EN A  + +    A D+D    + + ++ +        + F L  +SG       +L+LQK+LD E + +    +   DG       ++ + + V++VNDN+P  S + +     ++V EN+  G  +  +  TD D       V+  I         I  ++ ++ E   K         DRE  +      +  D G  P+ S     + +LDVND+ PV     + +T++E+   GT +  +   D D   N      ++      F +++     +S ++    + E+  +Y ++   TD  +GT      +   VD  I D+NDN+PRF   +  F + EN  SG  I  V A+D D++E N  I Y+   +   D S +  + +    G I+ + S  + E+  SF F + A D+G+P LSS+  + + + D NDN P  + P     SLN  NI Y    G+ V K  A D D G N+ L Y ITEP  G ++F++  ++G +  KR ++ +DL+TH L I V D G PSL  T++  V + + +++
Sbjct:   36 EEVKAGTVVGNVAKDLNINVQDLEARMFRIVSSRKSFDVSLKTGALFVTDRIDREALCSTIKK---CSM------HIEAMAQNPLKLFRIEVHIMDINDNAPLFPVSKQI--LNITELSAVGEKFTLPLAEDPDTG-SNAVKNYKLSPNE----YFSLNV-----QNGEDSGSVELVLQKALDRETQSVIHLILTAIDGGKPPLSGTTEIAILILDVNDNSPVFSQSL-YKVKVKENAAFGTKVLSLSATDLDEGLNSEITYAIIRQGTLSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYK----VSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGEITVK------GPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGP--FALQASYKNYYSLVVNGPLDREDMPQYSVTILATD--KGTPPLSSSIVLAVD--IADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNE-NAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQS-FNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPK-GNNLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAESMDS 783          

HSP 2 Score: 106.686 bits (265), Expect = 7.615e-23
Identity = 115/451 (25.50%), Postives = 195/451 (43.24%), Query Frame = 1
Query:  244 TSEMSIELYLVEECSN---NSIVTDLN-NRFHSNFNNDGHFRLLDQNK-----LFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGK---RTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLS--TTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLT--VSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKP----IVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEP 1527
            T   S E+Y V    N    + V  LN     +  N +  + L+   K     +F I    G++  K  +DRE              A F L+   +    + +    K +I +LD+ND  P  +  +  +T  + E +   +A  L    D D G             K+GE+   ++     +L +   N  SL+V G LDRE   QY V I A D G PPLS  + + +++ D+ND++PRF + + +   + EN+   +II    A+D D ++   + +S ++    +        +   SG++  ++S +YE   S+ F VQ TD       +++ V V +++ NDN P I       G L T  +  ++E+G  +G V   DAD     L  +  I +P    +  +   S E R K  +      D ++ ++ +    C D GEP
Sbjct:  350 TPAFSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGEITVKGPLDRE------------DTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTS--LTSTVREDATTGTAVGLITIADNDIG-------------KNGEVSAKVKGTGPFALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTV-FYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSY-HITEPKGNNLFRIGSSSGEIRTKRRMS-----DNDLKTHPLVITVC-DHGEP 765          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 256.529 bits (654), Expect = 2.550e-70
Identity = 211/735 (28.71%), Postives = 356/735 (48.44%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKS-RIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            +RL+ +   N L  +    G++ T S RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   +    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + VTD+ND+ P FK +  I + + E++ + + +    A D D      +++ F +       + F L   +G + +Q+ LD E   ++  +V  +DG   ++   V + V +VNDN+P I ++   S   G +L +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E     IF I  SD+G+P  + +   R+ + D NDN P+F    +  T+ EN      +  + A DED+  NA   + L P++   F ++ +TG + +  +F+ E+  R+  +    D+           V + I D NDNSP+F  + + F + EN+   + +  +   D+D  E N  +  +     +  IL  + GV +    F      DRE+  S+TF + A+D+G P  SS+A + I V D+NDN P  I+P  + +   +      G  V +  A D D G N+EL+Y I   N+ + +F+++P TG++ ++   T  D   HRL + + D G P    TL  
Sbjct:   64 YRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFR---LIKIKIVVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELV----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFK-ESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVL-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQ-AAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVSLSILNDNENFILDPYTGVIKSNVSF------DREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN-KGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 134.42 bits (337), Expect = 2.072e-31
Identity = 146/575 (25.39%), Postives = 254/575 (44.17%), Query Frame = 1
Query:  889 LRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFL---STTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG----KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLLPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAP----VFLNEPMRATI--KENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIF-SKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHIN--ITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++ I V D ND++P F + + INIS+ ENT INS   +  A D D    +  ++  +   S    ++ +T    EK  +LI+Q++LD E K +Y   ++V DG    K  T+I ++V V +VNDN P            + + E+S  G  +  +  TDAD   N+ +  +F +      ++SP +   R  F       L+   +  DRE  +    ++  SD       ++ T  +++ DVNDNAP     ++  P   T+   E   V T I  +   D+DT++N     +++ D   + +   +   +  +  + + E +  Y      +DS + + ++    V + +ED NDN P F + +   ++ EN      +  + A D D S  N  I Y   P      L +  GV    ++F      DRE    F F + A DNG+  L S A + + + D NDN+P++ H     NH    ++ ++P    V      D D G N+ +   I   N     F L+P TG +    +       ++  ++   D G+P         +N++
Sbjct:  125 IKIKIVVKDTNDNAPMFPSPV-INISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETP-EGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAI-LQVTVTDVNDNRPVFKESQIE----VHIPESSPVGTSVVQLQATDADVGANAEIKYMFGT------QVSPAT---RRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVT--INVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQT-ALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDED-SGRNAEIVYQLGPNASFFDLDRKTGVLTASRVF------DREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTH-----NHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNEN---FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVI 665          

HSP 3 Score: 104.76 bits (260), Expect = 2.632e-22
Identity = 91/328 (27.74%), Postives = 152/328 (46.34%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKI--FVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPNSG-RDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L     +T   A+    +R   +       R+ S TG+IF+        K+     +   E S +EI   +   L   + ++  K+ + ++D NDN+P F   + + SI EN    +      A D D+   N   +Y    G     L  +   +  K    +    LDRE+  ++   I   D GSP  SS+A +Q+ V D+NDN P +     S   ++I    PVG  V++ +A D D G+N+E++Y F T+ +   R +F L  TTG + V+R L   +   H+L++L  D  + S   T+T  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECS-FEIEVVI---LPNDYFRLI-KIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKE---SQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 256.529 bits (654), Expect = 3.533e-70
Identity = 211/735 (28.71%), Postives = 356/735 (48.44%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKS-RIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            +RL+ +   N L  +    G++ T S RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   +    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + VTD+ND+ P FK +  I + + E++ + + +    A D D      +++ F +       + F L   +G + +Q+ LD E   ++  +V  +DG   ++   V + V +VNDN+P I ++   S   G +L +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E     IF I  SD+G+P  + +   R+ + D NDN P+F    +  T+ EN      +  + A DED+  NA   + L P++   F ++ +TG + +  +F+ E+  R+  +    D+           V + I D NDNSP+F  + + F + EN+   + +  +   D+D  E N  +  +     +  IL  + GV +    F      DRE+  S+TF + A+D+G P  SS+A + I V D+NDN P  I+P  + +   +      G  V +  A D D G N+EL+Y I   N+ + +F+++P TG++ ++   T  D   HRL + + D G P    TL  
Sbjct:   64 YRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFR---LIKIKIVVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELV----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFK-ESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVL-LSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQ-AAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVSLSILNDNENFILDPYTGVIKSNVSF------DREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN-KGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 134.806 bits (338), Expect = 1.815e-31
Identity = 146/575 (25.39%), Postives = 254/575 (44.17%), Query Frame = 1
Query:  889 LRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFL---STTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG----KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLLPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAP----VFLNEPMRATI--KENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIF-SKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHIN--ITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +++ I V D ND++P F + + INIS+ ENT INS   +  A D D    +  ++  +   S    ++ +T    EK  +LI+Q++LD E K +Y   ++V DG    K  T+I ++V V +VNDN P            + + E+S  G  +  +  TDAD   N+ +  +F +      ++SP +   R  F       L+   +  DRE  +    ++  SD       ++ T  +++ DVNDNAP     ++  P   T+   E   V T I  +   D+DT++N     +++ D   + +   +   +  +  + + E +  Y      +DS + + ++    V + +ED NDN P F + +   ++ EN      +  + A D D S  N  I Y   P      L +  GV    ++F      DRE    F F + A DNG+  L S A + + + D NDN+P++ H     NH    ++ ++P    V      D D G N+ +   I   N     F L+P TG +    +       ++  ++   D G+P         +N++
Sbjct:  125 IKIKIVVKDTNDNAPMFPSPV-INISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETP-EGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAI-LQVTVTDVNDNRPVFKESQIE----VHIPESSPVGTSVVQLQATDADVGANAEIKYMFGT------QVSPAT---RRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVT--INVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQT-ALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDED-SGRNAEIVYQLGPNASFFDLDRKTGVLTASRVF------DREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTH-----NHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNEN---FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVI 665          

HSP 3 Score: 104.76 bits (260), Expect = 2.909e-22
Identity = 91/328 (27.74%), Postives = 152/328 (46.34%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKI--FVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPNSG-RDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L     +T   A+    +R   +       R+ S TG+IF+        K+     +   E S +EI   +   L   + ++  K+ + ++D NDN+P F   + + SI EN    +      A D D+   N   +Y    G     L  +   +  K    +    LDRE+  ++   I   D GSP  SS+A +Q+ V D+NDN P +     S   ++I    PVG  V++ +A D D G+N+E++Y F T+ +   R +F L  TTG + V+R L   +   H+L++L  D  + S   T+T  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECS-FEIEVVI---LPNDYFRLI-KIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKE---SQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 252.292 bits (643), Expect = 2.122e-68
Identity = 211/715 (29.51%), Postives = 347/715 (48.53%), Query Frame = 1
Query:  376 LFYIEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKIS---VQSFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            L  +E   G++  T +RIDRE +C  V     C   + +   P +   + V I+ +I   DIND+AP +   + ++ + IPE++ IN+ + +P A D D G + + + Y + K   G ++F L +I      +  G++   LIV   LDRE +  + + I   DGG PP S    + + V+D+ND+ P FK+   + +++ EN  + + +    A D D      + FSF +       + F +   +G + +++ LD E+   +   V  +DG    S   V V V +VNDN P I    + +   G +L +SEN+     I  + VTD D D +G +  +   D P   L P+ ++   +FLL+T    D E        I  SD+G+PP ++S    + I D NDNAPVF    ++ +I EN   GT + ++ A D D+  NA   + L PD+   F I+  +G +      + E+  +Y  +    D+           V L ++D NDNSP F    Y+F + EN+     +  +   D+D  + N  +  +   G D  I+    GV +    F      DRE+  S+TF + A+D+G    +S A + I V D+NDN P ++ P  + ++  + +    G  V +  A D D G N+ELQY I    S R +F ++ TTG++ ++  +   D   HRL + VKD G P
Sbjct:   74 LVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDE-IFRLVKIRFLIE--DINDNAPLFQ--STVINISIPENTAINNRYPVPSAFDPDVGINGI-QHYELVKV--GALEFGLDII-----ETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS-EVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVL-LSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPF-RLKPVFND---QFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNV-TVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGD-NAIVTLSIINGKDNFIIDPKTGVIKPNITF------DREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIG-GSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 760          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 248.825 bits (634), Expect = 1.527e-67
Identity = 210/715 (29.37%), Postives = 346/715 (48.39%), Query Frame = 1
Query:  376 LFYIEEKFGKL-RTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKIS---VQSFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            L  +E   G++  T +RIDRE +C  V     C   + +   P +   + V I+ +I   DIND+AP +   + ++ + IPE++ IN+ + +P A D D G + + + Y + K+     +F L +I      +  G++   LIV   LDRE +  + + I   DGG PP S    + + V+D+ND+ P FK+   + +++ EN  + + +    A D D      + FSF +       + F +   +G + +++ LD E+   +   V  +DG    S   V V V +VNDN P I    + +   G +L +SEN+     I  + VTD D D +G +  +   D P   L P+ ++   +FLL+T    D E        I  SD+G+PP ++S    + I D NDNAPVF    ++ +I EN   GT + ++ A D D+  NA   + L PD+   F I+  +G +      + E+  +Y  +    D+           V L ++D NDNSP F    Y+F + EN+     +  +   D+D  + N  +  +   G D  I+    GV +    F      DRE+  S+TF + A+D+G    +S A + I V D+NDN P ++ P  + ++  + +    G  V +  A D D G N+ELQY I    S R +F ++ TTG++ ++  +   D   HRL + VKD G P
Sbjct:  114 LVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDE-IFRLVKIRFLIE--DINDNAPLFQ--STVINISIPENTAINNRYPVPSAFDPDVGINGI-QHYELVKSVS---EFGLDII-----ETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDS-EVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVL-LSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPF-RLKPVFND---QFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNV-TVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGD-NAIVTLSIINGKDNFIIDPKTGVIKPNITF------DREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIG-GSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 223.016 bits (567), Expect = 3.877e-60
Identity = 205/726 (28.24%), Postives = 336/726 (46.28%), Query Frame = 1
Query:  376 LFYIEEKFGKLRTKSR-IDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELS-LIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVT-----QTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAG--GELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDS----LEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPV-----GHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRG 2490
            L  +  + G+L    R +DRE++C   D   +C + + +   P +      +I+  I++ DIND+AP +     ++T+ +PE++P    F +  A D D   + V +   +  +      F+L V       + +G ++  L+V   LDRE++  Y++ + A+DGG PP SG   + I VTD ND+SP F +Q  +N+ + EN+ + + +    A D D+     + +   ++T    +     + F L + SG + +   L+ E    Y   +  TD        +  V V V +VNDNSP I ++        ++ +SE S     +  + V+D D  +    V C I  P V          N++LL+T +  D E  +  +  IK +D G      + +  + +LD NDNAPVF     + ++ EN  +G  +  + A D D + NA   ++L PD+   F ++ ETG I      + E+ + Y  +    D     LEG        V +N+ D+NDN PRF    + F + ENV   + +  V   DSD  E N  +R +   GTD   L    +  +  +   +   DRE+   +   + A D G P  SS+  + I V DINDN+P  + P PS    N TY   V     G  V +  A D D   N+EL+Y I   N   ++F ++P  G++ +   LT      HRL + V D G
Sbjct:   85 LVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAF--AAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVT-----ETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVF-DQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGA-VTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGN-----ATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGE-NGRVRLSIL-GTDNRQL--FSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMP-PS----NTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNP-HNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 117.857 bits (294), Expect = 5.069e-27
Identity = 141/544 (25.92%), Postives = 224/544 (41.18%), Query Frame = 1
Query: 1042 NLRFSF---LSTTEDEVTQTFFLKEKSGELILQ-KSLDYETKMS------------YTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGEL-LTVSENSESGQHIGAVVVTDADDNSG------LLPV-FCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN---------FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFD-KDIYH-----FSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQ-LDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPV------GHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            NL  ++   LS  ED       +  ++GEL    + +D E                    + V  G  F  I V + V ++NDN+P     +FA   L ++V EN+ +G+        D D  +       LLP    ++    + ++  ++  +  +L+   K+ DRE        ++  D G PP   S   R+++ D NDN+PVF    +   I EN  VGT + QL A D D   NA   + L   +            FR++  +G +    + N EES  Y I    TD            V + + D+NDNSP  + +DI         I E  +   P+  +   D DI        Y + P     + K   +T   +  + + + LD E    +   I A D G+ +LS +  + I++ D NDN P +  P         TY V V      G  +I   A D D   N+E+ YF+  P++   +F ++P TG + +   L       +   IL KD+G P LE   T  VN++
Sbjct:   66 NLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAP-----AFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLV-VRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDK-GPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKK---LTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEP---------TYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLG-PDA-PTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVL 588          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 1.112e-56
Identity = 201/764 (26.31%), Postives = 330/764 (43.19%), Query Frame = 1
Query:  376 LFYIEEKFGKLRTKSRIDRESICKQVDANPD-CKIALFI------LYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKS-----------GNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS---LDYETKMSYTFTVQVTDGKHFT---SIYVEVKVLNVNDNSPKISVQSFAGGEL----LTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEP--------MRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--------FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRF------DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRS-SQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEV-IKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLER 2508
            L  + E  G+L    R+DRE++C +    PD C+   F+          G+ ++   ++   + + DINDHAP +   +  + + I E   +     LP A+D D G +++ + Y IS      ++     +++S  +              G+   L +   LDRE    Y++L+   DGG P LSG + + I V D ND++P F +     + + E++ + + +    A D D+     + +SF +      TQ     + +  L+  ++   LD ET   +   V   DG   +   S+ V V++ + NDN+P   V +  G  L    + + EN  SG  +  + V+D D  +SG + V           + L+   + +FLLKT +  D E       ++  +D G P         + ++D+NDN PVF+N             +++EN   GT++  L A D D+  N    F L   SE+         F +   TG++      + E+  RYE+S    D       K    V + + D NDN+P F         +Y F + E  + GT +  V   D D  + N  +  N         +   G T  G   VR+   LDRE    +   + A+D+G P LS+S  + I V D NDN P    P+ +    ++    P G  V +   A D+D G N    Y I   N  + IF L   +G+L + RT++  D   HRL + V+DRG     R
Sbjct:   73 LCIVNELSGELSVALRLDREALCME---EPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPH--LNVSISESEAVGRRVPLPRAIDPDAGTNSI-QHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTG----AELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTL---SELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDG-GSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGD-NARVALNLVREAGPDWIGGAGDTPGG--VVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNP-KGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRR 818          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 211.075 bits (536), Expect = 1.408e-56
Identity = 192/694 (27.67%), Postives = 317/694 (45.68%), Query Frame = 1
Query:  244 TSEMSIELYLVEECSNNSIVTDLNNRFHSNFNN--DGHFRLL--DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIH----ILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVL----NVNDNSPKISVQSF--AGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI-DKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-------FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVF-GKVDLNIEDMNDNSP-------RFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILK--HIGVTQDGKIFVRSSQLDREKNPS--FTFYIIAIDNGSPTLSSSAYIQIEVKDINDN 2223
            T+ ++++  L EE    ++V  L++            HFRL+  D   L ++EE  G +  +  IDRE  C Q    P C I   +L       T P  +  ++H    +LDINDHAP + +    M ++I E   + +   L  A DLD G  N  ++Y + +N+    +F L +  ++           L+V   LDRE++ +Y + +TA DGG PP SG   V I V D ND+SP F  Q   N+++ E+    +++    A D+D      + +SF S  + EV + F L  K+G+L L+  LD+E    Y  ++Q  D    +SI    KVL    ++NDN+P+I +     + G+ + VSE +     +G V V+D D     L V C +   P  +L P     R+ +++ T  + DRE  +     ++ SD G PP+ ++    + +LD NDN P F      A++ EN + G  +  + A D D E N    + +  +SEV          I   +G I++    + E  +         D  +G    V    V + I D NDN+P       R    +       +   G  +  V A+DSD SE N  + Y    G ++++ +   +G    G++F  ++ +      +   +  ++  D GSP LS++A I+I V    D 
Sbjct:   26 TTAITVKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQA---PSCVIRFDVL------CTLPRGLFQLVHAEVELLDINDHAPDFARSE--MHVEISESVALGTRVPLEGARDLDVG-GNALRAYHLDENE----RFGLALRART----DGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFA-QTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARD-MGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGL-VACHLRGHPHFKLLPY----RDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVV-ESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARD--DGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLP--RDAGLGYLVTVVRARDSD-SEANGELSYRIVQGNERNLFRINRLG----GEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDG 682          

HSP 2 Score: 149.058 bits (375), Expect = 7.715e-37
Identity = 159/608 (26.15%), Postives = 265/608 (43.59%), Query Frame = 1
Query:  808 ILDREKQS--------QYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTE--DEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADD--NSGLLPVFCS-IDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEP--PKHSSYTSRLHILDVNDNAP-VFLNEPMRAT-----IKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGK-VDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPG--TDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNH---INITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR---TLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            ++DRE+Q         ++ VL T   G    L   +   +E+ DINDH+P F     +++ + E+ A+ + + +  A D+D    N LR   L   E      +      K  EL+++  LD E +  YT  +   DG       +  V + VL+ NDNSP  +  S      +TV E++  G  +  +  TD D+  N  ++  F S +D  +  L  L D    K  LK     D E+ S    +I+  D G    P H      +H+ D+NDNAP + L+  M++      + E  A  + +  +   D D+  N     +L+           +   + +    + E+ + Y +    +D   GT  +V  +   + + D NDN PRF +  Y  S+ EN + G  +  V A D+D +E N  I YN         S+  ++ +            LD E   S TF + A D+G P L ++A + + + D NDN P   HP P  N    + +     +G+ V    A+D D  +N EL Y I + N  R++F++    G ++      T        H L ++V+DRG+P+L  T   ++ +
Sbjct:   89 VIDREQQCGQAPSCVIRFDVLCTLPRG----LFQLVHAEVELLDINDHAPDFARS-EMHVEISESVALGTRVPLEGARDLDVG-GNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCN----VTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQL-DPKTGKLSLK--GQLDHELNSEYEISIQARDMGPSSIPAHCKVL--VHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDG--GTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDAD-AEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHP-PLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNE-RNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 3 Score: 87.8113 bits (216), Expect = 8.166e-18
Identity = 86/309 (27.83%), Postives = 141/309 (45.63%), Query Frame = 1
Query: 1615 TIKENMAVGTLIYQLK--AQDEDTE-LNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVT-DSL----EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKI--FVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSG--RDIFQLEPTTGSLYVKRTLTVHDLRT-HRLNILVKDRGNPSL 2502
             + E    GTL+ +L    Q    E  + +FR   + D  +   +E   G + ++ + + E+      S  +  D L     G F  V  +V+L   D+ND++P F +   H  I E+V  GT +    A+D D+     A+R       ++  L     T   K    V  S+LDRE+   +T  + A D G P  S +  ++I V D NDN+P  +    S N + +      G  ++   A D+D+G N E+ Y  + P     R +FQL+P TG L +K  L  H+L + + ++I  +D G  S+
Sbjct:   34 ALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSL-VHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVEL--LDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVG--GNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP--VFAQTSCN-VTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLD-HELNSEYEISIQARDMGPSSI 333          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 1.632e-50
Identity = 167/582 (28.69%), Postives = 264/582 (45.36%), Query Frame = 1
Query:  871 PPLSGELRVNIEVTDINDHSPRFKNQIP-INISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQH-----IGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHI--LDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQP-DSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG--KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGV---------TQDGKI-FVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            PP+S   +V I V D+ND+ P F   +P + + + ENT    +IF   A D D      + +S LS +E      F +   SG L   + LD E + SY  TV+ +DG H T   + V V + NDNSP+ S  +++      V+E++          IG V+  DAD        F  +   +   S  SD A   F        L   +  DRE  +  +   + +D G      + T+RL++  LD NDNAP   N+ + A + E+   GT + ++ A D+D  +NA   F +   D E  F + ++ G++      + E  S Y +   V+D       ++    +V L + D+NDN+P F       +  E+   G  +  V+A D D S  N  + Y     TD                  T  G++  VR  +LDRE   S+   ++A+D G P L+S+A + + V D NDN P +   +       I    P G EV++  A D D+G+N EL+Y I   +   D F+L+P  G+L V R L      ++ L +  +D G P+   T + +V +
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFA--VPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSE----GAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYS----FDVAEDAAPDGKTTRAVIGTVLAGDADSGP-----FGEVTYALAP-SEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG----GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAP-EDSPVGAVVATVQAVDPD-SGRNSYVEYALA--TDGEEGGGGAGAGPGPFALNTVTGEVRLVR--ELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRRE---YEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD-FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTL 2044          

HSP 2 Score: 193.356 bits (490), Expect = 4.543e-50
Identity = 205/796 (25.75%), Postives = 343/796 (43.09%), Query Frame = 1
Query:  190 KIVYTSITYLIL---------FMVKRITSEMSIELYLVEECSNNSIVTDL--NNRFHSNFNND--GHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPV--MIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEE------SSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNP 2496
            K  YTS+T  +L            K + + +   L  +   S ++  +DL  N     NF+ D    +R     ++F ++   GK+ T   +DRE    +++  P       ++     R + P+    K  + + D+ND+ P +  V    +  I E+ P  +A     A D DRG  N T  Y ++       +F +  +  +     S           LDRE+++ YQ+ +TA+DGG         V I V D  D  P F      +  + EN A  +++    A  +D     N   ++L  + D+   +F ++   G +    ++D E +  Y   V    G       V V V +VN+++P     S+     ++++E+        +V  TD D           +   I E          KF       L      DRE       T+   DTG  P  SS T  + +LDVNDN P+F +        E   VG+L+  ++A D D   N    +  +   +VNF ++SETG+I S  +F+ E       ++ +  S   TD       +    V + ++D+NDN P+F K +Y  S+ E+ ++ T + RV A D D   +N A+RY    G +    K       G+I +  S LDRE+  S+T  + A D+G+  L++S  + ++V D NDN P +     SL  ++      VG  +I   A D D G + +++Y I   N+    F ++ +TGS+++ R L     R +RLN+  +D G P
Sbjct:  426 KTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYR-----EMFRLDSLTGKVTTLKSLDRE----ELEEYP-------LVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFAS--ILENEPGGTAVTTVTATDPDRGA-NGTVRYQLTAGD--AARFQVNAVTGAVSTRVS-----------LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARD-DYSFVVFENVAPGTLVGSVSASTLDL----NANVTYLIVSGDQ-RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYE----VSIAEDEPVNSRFFSVRATDKDSGKN-----GEVKYEIGE-----GNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE-KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVNGALRYAINEGNEGG--KFTVDASTGQITLLGS-LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTE---SLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT-HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRP 1160          

HSP 3 Score: 186.422 bits (472), Expect = 6.906e-48
Identity = 159/549 (28.96%), Postives = 253/549 (46.08%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREI-----GSYQI-FTIKCSDTGEP-PKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSL 2418
            +DRE+Q+ YQ+ + A  GGV   +GE  V++ V D+N+H+P F ++    +S+ E+  +NS  F   A D DS     +++        E    F      G+L ++  LD ET+  Y+ TV   D       +S+ V V VL+VNDN P  +  S+    +    E  E G  +GAV  TDAD   N G   V  S +KP V     S+  R    + +L+ FDRE      G+    F++  +D G P P     T ++ + DVNDN P F     +A++ E+ +  T + ++ A D D  +N   R+ +   +E   F +++ TG+I      + EE++ Y +    TDS           V + + D NDN PRF + +      E+   G  +  + A D D       +RY    G   +       T  G +F+ + +LD E    +   + A D G P  SS+  + + V+D NDN P ++   P     +I  ++P+G  VI   A+D D   N EL Y I         F ++P +G +
Sbjct:  719 IDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVF-DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF----PDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSY----VFHFCEEQEVGSLVGAVQATDADAGSNGG---VTYSFEKPQVNFELDSETGR----IASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASC-TVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGD-VRYAIVAGNTHATFAIDRST--GSVFL-ARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL---PGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEI 1240          

HSP 4 Score: 186.037 bits (471), Expect = 9.987e-48
Identity = 184/684 (26.90%), Postives = 306/684 (44.74%), Query Frame = 1
Query:  514 TKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTK-SYTI-SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH------FTSIYVEVKVLNVNDNSPKIS-VQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF-----------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSR-LHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHK-VFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGV-TQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGN 2493
            T P  ++ ++   D+ND+AP++ +   +M +   E + +     L  AVD D GP+ V   +Y I S N++G +    R + K +        L L   G LDRE    Y + + A DGG P   G L+VN+ V D ND+ P F+       S+ E++ + + +      D+       L   F                K+G +  ++ LD+E +  YT +++  DG +       T++   +++L+VNDN P I  V         +V E++  G     V VTDAD  +    +  SI         +    R  F           +LK     DRE       TI  SD G+P   S+  S  +++ DVND+AP F      A + E    G+ +  + A D D+ LNA  R+ +   +++  F ++  TG + +    + E +S   ++    D  +G   K  +  + + + D+ND  P F +  Y  +  EN   G  +  V A DSD+ E N  +RYNF P       +   + +  GK+    S LDRE+   +   + A D GSP L S+A + + V D+NDN P +    P     +I  + P G  V    A D D+G+N  ++Y +T  ++ R  FQ+   TG++  + +L   +   ++L +   D G+
Sbjct:    4 TYPTEVRVVVG--DVNDNAPSFPE-PGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRL-VPPRPVTKRAF-------LHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPA-YRASVAEDSPVGAAL-----RDLLHRGRGPLAVPF--------------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAV---IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSI---------VGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQD--QGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGE-NGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKS-LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY---PVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH 635          

HSP 5 Score: 176.022 bits (445), Expect = 1.020e-44
Identity = 183/704 (25.99%), Postives = 305/704 (43.32%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSG--NELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYET------KMSYTFTVQVTDGKHFTSIY----VEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDI---SEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPS-FTFYIIAIDNGSPT---LSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTG 2412
            DQ   F IE   G++ T + IDRE               L ++ + G    +   +  ++H  D+N+HAP +++ +    + I E  P+NS F    A D D G             K+GE+K++   I + +   K G   +  L V   LDRE + +Y + ++AMD GV PLS  + VN+ V D+ND+ P F N         E   + S++    A D D+     + +SF     ++    F L  ++G +   +  D E         S++F+V  TDG     +     V+V V +VNDN P+ +   +      +VSE++ +   +  V  +D D+  +G L    +I++         D +  +  L  L + DRE  +     +  +D+G  P  +S T  + +LD NDN P F    +     E+  VG L+  L A DEDT  + + R+ +   ++   F I+  TG +F     + E    Y ++    D            V +++ D NDN P F       SI EN+  GT +  V A+D D     E++ +I   F PG       H  +  +      ++++DRE     F   + A D   P     S+   + + V D NDN P ++ P   L           G  V   +A D D+  N+ ++Y +T  ++   +F+L+  TG
Sbjct:  699 DQRGSFSIEWSGGRIFTANAIDREE---------QAFYQLRVVANSGGVAGE-ASVSVLVH--DVNNHAPVFDRAS--YEVSIAEDEPVNSRFFSVRATDKDSG-------------KNGEVKYE---IGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF-NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-----EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQA----SVSESASNLTQLLRVTASDVDEGVNGAL--RYAINEGNEGGKFTVDASTGQITL--LGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILV-VHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGA------HFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVD---GLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAI-LFRLDRRTG 1347          

HSP 6 Score: 162.54 bits (410), Expect = 1.827e-40
Identity = 160/630 (25.40%), Postives = 272/630 (43.17%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRV-IMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTA-----INSIIFVFVAEDIDSSDANNLRFSFL-STTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIY-VEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEAR----NKFLLKTLKAFDREIGSYQIFTIKCSDTGE-PPKHSSYTSRLHIL--DVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN----------FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY 2355
            I + D+ND+ P +      M L++ E++          A D D+G  N   +Y++    +G    D    ++++S                LDRE+++ Y + + A DG     + + R+++ V D ND+SPRF      +  + E+ A       ++I   +A D DS     + ++   S   D     F L   +G L + + LD E++  Y    + TDG    +   + V VL+ NDN+P +   S A      V E++  G  +  +  TD D+      V   ++  I    P   E R    N   L   +A DRE  S+    ++ SD    PP   S   R+ ++  DVNDNAP F   P  A   E+  VG ++  ++A D D+  N+   + L  D E            F + + TG++      + E    Y ++    D            + + + D NDN+PRF +  Y  +I E+   GT + R+ A D D    N  +RY+   G      +   V   G + V +  LDRE+  S+   + A D G P  S +A +++ + D+ND +P +     +++    T   PV   +++  A+D D GS+ ++ Y
Sbjct: 1504 ISVEDVNDNPPVFAVPE--MELEVEENTGEGEVIFTLSATDADQG-QNALVTYSVLSGSEGAFVVDAASGVLRASRR--------------LDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHA-YSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAA----EVPEDAPPGTSLLRISATDDDEG-----VNAELEFSISSGDP---EGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTST-ATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPD-EGANGELRYDIASGDPTGDFRLDPVL--GTLAV-ARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPV--LILQVVARDDDLGSSGQVTY 2092          

HSP 7 Score: 159.073 bits (401), Expect = 1.904e-39
Identity = 182/701 (25.96%), Postives = 293/701 (41.80%), Query Frame = 1
Query:  535 SIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTI----SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVL---GI-----------LDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIY--VEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLL-------KTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGK--VDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKS--ILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            ++I +LD+ND+ P       +  + +P  +   SA     +VD    P  V    T+    S   +GE+          S++   GNE    VL   G+           LDRE+   Y + I A D G P   S    + + V D+NDH+PRF        +L E     S +    A D DS     LR+S +S  +      F + E +G +     +D E   S    +   D G    + Y  + V +L+VND  P  +   +    + T  ENS  G  + +V   D+D   +G +      D P         + R  F L        TLK+ DRE        ++  D G PP  S+    + + D+NDN PVF      A+I EN   GT +  + A D D   N   R+ L       F++ + TG + +++  + EE + Y++      +L+G   +      V + + D  D  P F +D Y F ++ENV  GT +  V A   D   +N  + Y    G  +    ++  G    G+IF  ++ +DRE+   +   ++A   G   ++  A + + V D+N++ P +   D +   ++I    PV        A D D G N E++Y I E N G + F + P  G LYV+  L       + L +   D G   L  ++T  V ++
Sbjct:  211 AVIQLLDVNDNDPA------IRFVYLPPAA--RSA-----SVDESAAPGTVAALVTVTDADSPTANGEL----------SVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSA-YAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGND---LGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKY----VATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPA--------QYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQ---VTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD---LNANVTYLIVSGDQRGSFSIEWSG----GRIFT-ANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVF---DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGG-EKFGIFP-DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVL 853          

HSP 8 Score: 152.14 bits (383), Expect = 2.749e-37
Identity = 198/724 (27.35%), Postives = 297/724 (41.02%), Query Frame = 1
Query:  388 EEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSP--RFKNQIPI--NISLHENTAINSIIFVFVAEDIDSSDANN-LRFSFLSTTEDEVTQTFFLKEKSG-----ELILQKSLDYETKMSYTFTVQVTD-GKHF---TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLS----DEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN----FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRG 2490
            +  F  L T   +DRE       ANP    AL +    G    +   ++  + + D ND+ P + K        + E SP+ +A R  + +   RGP  V               FD +  M S+                LD E + QY + + A DGG PPLSG     I++ D+ND+ P  RF    P   + S+ E+ A  ++  +    D DS  AN  L  S +   E    +  F+    G      L +   LD E    Y  T+  +D GK      +  + V V +VND++P+ ++ +        +SE + +G ++  V   DAD  SGL      +   IV  + L     DE+    L+ T    DRE+ S  +  I   D G  PK ++YTS  + +LDVND  P+F      AT  EN   G  +  + A D D   N   R+   PD        FR++S TGK+ +    + EE   Y +     D           KV + + D+NDN P F    Y  SI EN   GT +  V A D D    N  +RY    G D +  +   VT  G +  R S LDRE+   +   + A+D G     S A + I V D  D  P +   D S     +  +V  G  V    A  LD   N+ + Y I   +  R  F +E + G ++    +   +   ++L ++    G
Sbjct:   82 KRAFLHLATTGPLDRE-------ANP--SYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEK--PAYRASVAEDSPVGAALR--DLLHRGRGPLAV--------------PFDPKTGMVSTRQP-------------LDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNE----RGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSA----YAAALSEGAPAGSYVKDVTAMDAD--SGL---NAKLRYSIVSGNDLGWFSVDESTG--LVTTDGKVDREVASSVVLNISAQDQGAQPK-TAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGST-AKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGA-NGTVRYQLTAG-DAARFQVNAVT--GAVSTRVS-LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSF---VVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQ-RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG 737          

HSP 9 Score: 151.369 bits (381), Expect = 3.864e-37
Identity = 178/716 (24.86%), Postives = 294/716 (41.06%), Query Frame = 1
Query:  406 LRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKI-SVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLN--IEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHV----PVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDL------RTHRLNILVKDRGNP 2496
            L+  S++DRE I       P   + +    + GK   +      ++++ D+NDHAP +        L   E +P  S  +   A+D D G +   +   +S N  G    D      + L +  G          +DRE  S   + I+A D G  P +    + + + D+ND  P F     +  ++ EN+     +    A D D  +   +R++F      +  + F L   +G++   KSLD E    Y   VQ  D       ++  V V V ++NDN P    VQ FA     ++ EN   G  +  V  TD D   N  +     + D    +++ ++        + T  + DRE  +     +   D G     S     + + D  D  P F  +     + EN+A GTL+  + A   D  LNAN  + +   D   +F IE   G+IF+    + EE + Y++              V G+  ++  + D+N+++P FD+  Y  SI E+    +    V A D D S  N  ++Y    G      +  G+  DG+++VR  +LDRE    ++  + A+D G   LSSS  + + V D+NDN P +       N  +  +H      VG  V   +A D D GSN  + Y   +P      F+L+  TG +   R      L       +   +++  D G P
Sbjct:  292 LKVASQLDRERI-------PMYNLTILASDN-GKPVARSATASLVVYVNDVNDHAPRFALSAYAAALS--EGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVD----ESTGLVTTDGK---------VDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAV-ENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFA-----SILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGA------VSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSG------GVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKD-SGKNGEVKYEIGEGNGG---EKFGIFPDGQLYVR-YELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF-------NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN---FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP 949          

HSP 10 Score: 137.502 bits (345), Expect = 8.992e-33
Identity = 139/542 (25.65%), Postives = 236/542 (43.54%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVL---GILDREKQSQYQVLITAMDGGVP-PLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVS--ENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL--QPDSEVNFRIESETGKIFSKIIFNAEESSR-YEISAYVTDSL--EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKN 2124
            + +LD+ND+ P +N  ++       E   + S     +A D D G  N   +Y+  K    ++ F+L        +S++G   SL V     ++ +   + +   + A DGG P PL     V + V D+ND+ P+F   +    S+ E+ +  + +    A D+D      LR++     E      F +   +G++ L  SLD E   SYT  V  TD        S  V V+VL+ NDN P+ +        LL+V   E++  G+ +  +  +D D        +  +         +     + FL + L   D E        +   D G PP+ S+    +H+ D NDN P FL   + A+I EN+ +GT +  + A+D D ++N    + +  Q     +F I+ E+G+I +    + E +   +E++   TD      T       V + + D NDN+PRF              +G+ +  ++A D D +E N A+RY    G D +IL  +   +   I   S++LDRE  
Sbjct:  850 VTVLDVNDNKPLFN--SSSYVFHFCEEQEVGSLVGAVQATDADAG-SNGGVTYSFEKP---QVNFEL--------DSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSV-YQASVSESASNLTQLLRVTASDVDEGVNGALRYAI---NEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTES------LLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRL---DFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAE-NAAVRYAVT-GGDAAILFRL--DRRTGIIETSTELDRESG 1360          

HSP 11 Score: 131.724 bits (330), Expect = 4.425e-31
Identity = 147/585 (25.13%), Postives = 250/585 (42.74%), Query Frame = 1
Query:  895 VNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVA--EDIDSSDANNLRFSFLSTTED-------EVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELS---PLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAP----VFLNEPMR-ATIKENMAVGTLIYQLKAQDEDT-----EL-------NANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK---SILKHIG-VTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITE--PNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            V + V D+ND++P F     + ++  E+ A+   + +  A   D+  +  N+  +  +S  E+        VT+  FL      L     LD E   SY   VQ  DG   + +  + V V V + NDN P     ++      +V+E+S  G  +  ++      + G  P+    D     +S   PL  EAR ++ L                +++ +D G PP     T+ + +LDVNDN P    V+L    R A++ E+ A GT+   +   D D+     EL       N    F L        R+     K+ S++  + E    Y ++   +D+ +         + + + D+ND++PRF    Y  ++ E   +G+ +  V A D+D S +N  +RY+   G D    S+ +  G VT DGK+       DRE   S    I A D G+   ++   + + + D+ND  P +           +   +P G  V+   A D D G N  ++Y      P   R++F+L+  TG +   ++L   +L  + L +  +DRG+P L  T   KV +V
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFL-----HLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRA----SVAEDSPVGAALRDLL------HRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTL----------------SLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVL----KVASQL--DRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDAD-SGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKV-------DREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQ--TKYVATAVENSLP-GLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTA--KVTVV 543          

HSP 12 Score: 122.094 bits (305), Expect = 4.224e-28
Identity = 149/614 (24.27%), Postives = 241/614 (39.25%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVN---NLMTLQIPEHSPINSAFRLPEAVDLDRGP-DNVTKSYTISKNKD-GEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD------GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTL-------KAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQP-DSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTP--IDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAID 2157
            F ++   G LR   R+DRE            + A ++L       T     +  + + D ND++P +++     ++     P+     +      A D D GP   VT +   S++ D  +  F L  +  +           L V   LDRE ++ Y +   A DGG   L+   R+ + V D ND++P  +N   +   + E+    + +    A D D      L FS  S       +  F     G+L + ++LD E +  Y   V+V+D       +  +++ V + + +VNDN+P     +F         E+S  G  +  V   D D       V  ++     E    +      F L T+       +  DRE       T+   D G PP  S+ T  + + D NDNAP F      A I E+   GT + +L A D D   N   R+ +   D   +FR++   G +      + E ++ YE++    D   G        V + + D+ND SP F    Y     EN   G P  I +V A+D D+    + + Y        +      V+ DG + +  S LDRE  P     I A D
Sbjct: 1563 FVVDAASGVLRASRRLDRE------------ERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGA-----------LNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQND-SLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDP----EGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAP-----AFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSY-VEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDG-GGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQ-GPPVLILQVVARDDDLGSSGQ-VTYAAA---GGNDGGAFSVSPDGHVHLLRS-LDREAQPQHVLIITATD 2133          

HSP 13 Score: 106.301 bits (264), Expect = 2.954e-23
Identity = 95/345 (27.54%), Postives = 153/345 (44.35%), Query Frame = 1
Query: 1525 PPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENV-----NSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSIL-KHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPN-SGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRG-NPSLERTLTFKVNIV 2535
            PP  S     + + DVNDN PVF    M   ++EN   G +I+ L A D D   NA   + +   SE  F +++ +G + +    + EE + Y ++   +D   GT H    ++ + + D NDNSPRF +  Y F + E+       +   I  V A D+D     + + Y   P  D        G+         +  LDRE    +     A D G   L+++A + + V D NDN P  +  D SL    +    P G  +++  A D D+G N+EL++ I+  +  GR  F +    G L V R L       + L + V DR  +P    +   +V+++
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD---GT-HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGE-VTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPS-VQND-SL-AAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR--FAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLI 1825          

HSP 14 Score: 55.0694 bits (131), Expect = 1.026e-7
Identity = 56/240 (23.33%), Postives = 92/240 (38.33%), Query Frame = 1
Query: 1861 KVDLNIEDMNDNSPRF-DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFK--------------PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +V + + D+NDN+P F +  +   +  E+   G  +    A D D+   N    + +K              P T ++ L H+  T           LDRE NPS+   + A D GSP       + + V+D NDN P +  P       ++    PVG  +     +DL       L                +P TG +  ++ L     R + L++   D GNP L    T  + ++
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGP-NGVNHHAYKIVSGNEEGRLVPPRPVTKRAFL-HLATT---------GPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKP---AYRASVAEDSPVGAAL-----RDLLHRGRGPLA------------VPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLL 216          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 2.972e-44
Identity = 184/756 (24.34%), Postives = 320/756 (42.33%), Query Frame = 1
Query:  352 FRLLDQNKLFYIEEKFGKLRTKSRIDRESI------CKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLR--VIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH--FTS-IYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVE--------LSPLSDEARNKFLLKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRY------NFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            +RL   +  F +    G++ T + +DRE           +D  P           PG  ++  +    ++ + D+NDH P +  +N       P  +P  +A     A D D GP+   + +++S +       D R  VI  +       ++L+L V                   DGG PP S    V +   D  +  PRF    P + S  E+    + I V  A    S  A  + +   S     +   F +  +SGE+ + ++LD+E +  Y   V+  D     F++ + +EV VL++NDN+P+ S   F       V EN+   + I  VV+T  D +SG   +   +D  I++        ++P S E      ++++   DRE + SY++ T+K +D G P +H +    + + D NDN+P F  +   A ++E+ AVG  + ++   D D   NA   F L  D  + F I   TG+I      N E+ S Y +    +D        V   V + ++D+NDN+PRF +  Y+    E       + RV A D+D     +   +      NF+ G D   +  +   +        S  +  K   ++F + A+D G P LSS A + I +   N N P ++    S     +   V  G  ++   A D D+  N ++ Y +   N+ R  F ++   G L+++ +L         + +  +DRG P L    T  +++ ++
Sbjct:   63 YRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPT----------PGLSSSATL----VVAVTDVNDHTPRF--LNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLR-FSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLTV----------------RVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPG-PRSFSFREDQPPGTTITVVAAR--SSRRAGPVSYHLASG--GNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRF----WAKVPENTPP-RTI--VVLTAVDKDSG---INGQVDYSIIDGNIGNVFRVNPNSGE------IRSVSTLDRENVASYEL-TVKATDRGSPTQHCTVKVLISVTDENDNSPRF-TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPA----WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNK---YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYS---TPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRR-FDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEE 748          

HSP 2 Score: 174.481 bits (441), Expect = 3.495e-44
Identity = 182/684 (26.61%), Postives = 293/684 (42.84%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGG-VPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNS--PKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSID---KPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHE--VIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHD---------LRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            + + D ND+ P +      +   +PE +PI S   L  A D D G  N   SY + +  DG            S+N  +G    +I    LDRE +  Y + +TA+DGG  P LS    + + VTD+NDH+PRF N  P       +    + +F   A D D+    +LRFS   +     +  F +  + G +   ++L    +   T TV+V+DG       V    +   D    P+ +     G    +  E+   G  I  VV   +   +G +    +       +  + P S E      +   +A D E   +    ++  D+G PP  +     + +LD+NDNAP F +    A + EN    T++  L A D+D+ +N    + +  D  +   FR+   +G+I S    + E  + YE++   TD    T H    KV +++ D NDNSPRF + I+   + E+   G P+ RV   D+D    N AI ++     D S+   I  +  G+I V S +L+RE    +   + A D   P  + S  + I V D+NDN P +           I +  P   E  V +  A D D G+N ++ +F+    S  + F++   +G ++  R L   D         L  +   +   DRG P L    T  +NIV
Sbjct:   14 VLVEDENDNLPRFGAAE--LRAAVPEDAPIGSDVALVNATDADAG-LNAIISYRL-RGGDGHF----------SVNPSTGQ---IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNA-PYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGS----ASAGFSVDPRRGVIHAARALQ-GPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFA----PGPRSFSFREDQPPGTTI-TVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGE------VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSII-DGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTV-KVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRVSTLDADEGP-NAAITFSL---LDPSLPFSIHPST-GEITV-SRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF-----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFM---RSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIV 642          

HSP 3 Score: 159.458 bits (402), Expect = 1.470e-39
Identity = 158/618 (25.57%), Postives = 263/618 (42.56%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSI---YVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEV-NFRIESETGKIF--SKIIFNAEESSRYEISAYVTDSLEG-TFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK---SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNS---ELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIE------------TYHGLSLFGKFEGD 2589
            L  +  S + V + A D G PPLS      I VT+ N ++PRF +  P+ +SL EN    S +    A D D+     + +S  S    + +  F +   SG+++L   LDYET+  Y  +V   DG          V + V +VNDN P ++   +       + EN+ SG  +  +   DAD  S  + ++ S+D    +L  L+   +   +L T    D E       T++  +  +   +S+    + I  VN+  P F+       + E+  VG  +  + A D D  ++    + L  +S    F +   TG+I   S++    E S+   + A    S+ G    +V   V++ I D ND  P F   +YH  + E  + GT +  V A D D     +   +  + G      SI  H G      + V +S LDRE  P +   ++A+D G P  + +  + + ++D+NDN P  +      +   +T + P G  V+  EA D D   N      Q   ++P + R  F L  ++G L   R +         L + + D G+P L  T+T  ++++ Q +             Y G    G F GD
Sbjct:  713 LAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHP-PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIAS---GDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDY----YPVIPENAPSGTTVLVMDAVDADSPSNAVTMY-SLDDGEADLFVLN---QKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVL--VNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTG------LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL-----TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDP-AWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGD 1302          

HSP 4 Score: 151.754 bits (382), Expect = 3.993e-37
Identity = 153/577 (26.52%), Postives = 250/577 (43.33%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSP-----RFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFT---SIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPI-VELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISA------YVTDSLEGTFHKVF--GKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRG 2490
            LD E Q  Y++++ A D G PP S  L++ ++V DIND++P     RF  ++P      ENT   +I+ V  A D DS     + +S +   +  +   F +   SGE+    +LD E   SY  TV+ TD    T   ++ V + V + NDNSP+ + Q F+      V E++  G  +  V   DAD+       F  +D  +   + P + E      +   +  +RE  S     ++ SD   P    S    + + DVNDNAP F          E      L+ ++ A D D   N    F+++  +E NFR+  ++G+I S       + +     A      +V  +++     +     V +NI   N N+PRF ++ Y   +   V +GT I  + A D D  ++N  I Y+   G      +   V   G + +R+S L  +    F+  + A D G P LSS A   I V + N   P + HP   L   ++  + P G  + +  A D D G N  + Y I     G  +F +   +G + +   L     + + L++   D G
Sbjct:  294 LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVP------ENTPPRTIV-VLTAVDKDSGINGQVDYSII---DGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT-QIFSA----HVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGE------ITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTE-NFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPD-RDVNGQIAYSVVGGNAS---RRFDVDAGGFLHLRAS-LAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLEL---SLPENHPAGSSLARVTATDTDAGVNGAIVYSIAS-GDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGG 836          

HSP 5 Score: 145.591 bits (366), Expect = 3.253e-35
Identity = 158/586 (26.96%), Postives = 256/586 (43.69%), Query Frame = 1
Query:  535 SIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRF--KNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQV---TDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD---DNSGLLPVFC-------SIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELN-ANFRFYLQP-DSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLE--GTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKP-GTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPE 2232
            +II + + N +AP +   +  + L +PE+ P  S+     A D D G  N    Y+I+   DG   FD+        +  SG+   ++++G LD E +  Y + + A DGG    +    V+I VTD+ND+ P     +  P+   + EN    + + V  A D DS       +S     +D     F L +K+G L  Q  LDYETK +Y  TV+     D  H+++  V V++  VN+  P+   + +       VSE++  G  +G+V  TD D   D +    +F        S+++   E+   S   R +    TL+   +  GS + F +                 + I D ND  PVF +      + E  +VGT +  + A D D+      F F +Q  ++   F I + TG I      + E    Y ++    D  E   T   V   V + +ED+NDN P          + EN  +G  +  +EA D D+   NK   Y F+  G+D +   +  ++  G +   +  +DRE+ P F   +   D GSP L+S+  + + V D NDN  E
Sbjct:  741 AIISVTEENQYAPRF--AHPPLELSLPENHPAGSSLARVTATDTDAG-VNGAIVYSIASG-DGSGLFDI--------SRASGD---VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPV---IPENAPSGTTVLVMDAVDADSPSNAVTMYSL----DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYN----FVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVD-----------EVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTV---VVVALEDVNDNGPFLLTS--SAKVTENQPAGMTVLNLEAGDPDLPP-NKGP-YTFQLLGSDPAWRGYFSLSSSG-LLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE 1280          

HSP 6 Score: 127.487 bits (319), Expect = 8.813e-30
Identity = 133/551 (24.14%), Postives = 228/551 (41.38%), Query Frame = 1
Query:  865 GVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF----TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELS-PLSDEARNKFLLKTLKAFDREIGSYQ------IFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            G P L+G   V + V D ND+ PRF     +  ++ E+  I S + +  A D D+    N   S+     D     F +   +G++I   SLD E + SY   V   DG       +S  + V V +VND++P+     +    +     ++ +G  + AV   DAD              P  +L   LS  A   F +   +       + Q        T++ SD G PP+ +  T  +   D  +  P F   P   + +E+   GT I  + A+        ++      +    F ++ ++G++      + E    YE+     DS    F   + K+++++ D+NDN+P F    +   + EN    T I  + A D D S IN  + Y+   G   ++ +   V  +       S LDRE   S+   + A D GSPT   +  + I V D NDN+P +      +   ++     VG  V++    D D+G N+ + + + +P+     F + P+TG + V R L   D   + + +   D
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRF-GAAELRAAVPEDAPIGSDVALVNATDADA--GLNAIISYRLRGGD---GHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPY----VAYAPSSAPAGTAVFAVTARDADAG------------PNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPF-SAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRT-IVVLTAVDKD-SGINGQVDYSIIDGNIGNVFR---VNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ----IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSL---PFSIHPSTGEITVSRRLNREDRSGYAVKVRASD 516          

HSP 7 Score: 114.005 bits (284), Expect = 1.292e-25
Identity = 113/447 (25.28%), Postives = 194/447 (43.40%), Query Frame = 1
Query: 1213 VEVKVLNVNDNSPKISVQSFAGGEL-LTVSENSESGQHIGAVVVTDADDN-SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPK-HSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHK-VFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            V V V + NDN P+     F   EL   V E++  G  +  V  TDAD   + ++            ++P + +      + T  + DRE     +  +   D G  P   SS T  + + DVND+ P FLN P  A    +   GT ++ + A+D D   N + RF L   +   F ++   G I +     A +  R +++  V  S  G   +     V +   D  +  PRF      FS  E+   GT I  V A+ S  +     + Y+   G +   +  +   Q G++ V  + LD E    +   + A D+G P  S+   ++++V DINDN PE+     S     +  + P    ++   A D D G N ++ Y I + N G ++F++ P +G +    TL   ++ ++ L +   DRG+P+   T+   +++  +
Sbjct:   12 VTVLVEDENDNLPR-----FGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAA---RALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRA---GPVSYHLASGGNLGDVFAVD-PQSGEVSVHRA-LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF---SSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSIIDGNIG-NVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDE 433          

HSP 8 Score: 102.064 bits (253), Expect = 5.587e-22
Identity = 124/495 (25.05%), Postives = 205/495 (41.41%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNV---NDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNAN-FRFYL---QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDI-YHFSIYENVNSGTPIDRVEAKDSDISE 2001
            I + D+ND+ P  N  +      IPE++P  +   + +AVD D  P N    Y++    DGE   DL V     LN K+G    L   G LD E +  Y++ + A +          +V++++T +N++ PRF  Q   N  + E+  + + +    A D D+     + +     +    ++ F + E +GE+I+   LD E + S T  V   +        V+  ++NV   + N P +   +   G    VSE +  G H+  V   D D   G    F  + +        S  A    L+      DRE       T+   D GEPP   +    + + DVNDN P  L     A + EN   G  +  L+A D D   N   + F L    P     F + S +G + +    + E+   + +   + D+           + L++ D NDN P   +D+  H + + +   G  I  V  +D DIS+
Sbjct:  848 ISVTDVNDNPPMLNASDYYPV--IPENAPSGTTVLVMDAVDADS-PSNAVTMYSL---DDGEA--DLFV-----LNQKTG---VLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFV-QREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESR---SKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGR---VSEAASVGTHVVGVSAHDFDSPPGWR-TFSFLIQSGNAGRAFSINAHTG-LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTS--SAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-SGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTV-TLHLSVLDQNDN-PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISD 1312          

HSP 9 Score: 81.6481 bits (200), Expect = 1.039e-15
Identity = 76/343 (22.16%), Postives = 139/343 (40.52%), Query Frame = 1
Query: 1516 TGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK--SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTH-RLNILVKDRGNPSLERTLTFKVNIV 2535
             GEP    + T  + + D NDN P F    +RA + E+  +G+ +  + A D D  LNA   + L+   + +F +   TG+I +    + E    Y +     D            + + + D+ND++PRF    Y      +  +GT +  V A+D+D    N  +R++         S+    GV        R+ Q  R+     T  +   D G+P  S+   + +  +D      E+    P     +     P G  +    A+   +     + Y +    +  D+F ++P +G + V R L  H+ + H  L +  +D G P     L  +V+++
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLR-GGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGP-NGDLRFSLSGSASAGFSVDPRRGVIH----AARALQGPRDD---LTLTVRVSDGGAPPRSAVTTVTVRFRDAG----EFPRFAPGPRSFSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALD-HEYQHHYELVVEARDSGFPPFSAYLKLEVDVL 327          

HSP 10 Score: 56.9954 bits (136), Expect = 2.661e-8
Identity = 71/299 (23.75%), Postives = 121/299 (40.47%), Query Frame = 1
Query:  367 QNKLFYIEEKFGKLRTKSRIDRE---SICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDN 1245
            ++K F + E  G++   S++DRE   S   +V A     I  F +          V++   + I D ND  P ++    L   ++ E + + +      A D D  P   T S+ I     G            S+N+ +G    ++V   LDRE    Y + + A+D G PP +G   V + + D+ND+ P        +  + EN      +    A D D    N   ++F     D   + +F    SG L   + +D E K  +   V + D       +++ + + VL+ NDN
Sbjct: 1008 RSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDE--------VLVN--VAITDAND-PPVFSSA--LYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAF---------SINAHTG---LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTS---SAKVTENQPAGMTVLNLEAGDPDLP-PNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 222.631 bits (566), Expect = 5.309e-59
Identity = 193/729 (26.47%), Postives = 320/729 (43.90%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL--ERTLTFKVNIV 2535
            ++N  F ++   G++ T+  +DRE+I            +L I    G            I I D ND+ PT+   +      I E SP  +      A D D GP+       IS N+    + D R  +             L V   LDRE    Y +++ A D G P  S    +++ V D+ND++PRF+  +  +  + E+ +++S +     ED D      +  S      D      F  + +G ++ +  LDYET  +Y  TV   DG       +  V++ ++NVNDN P       +  ++ ++ E+     H+  +  TD+D      P+   I +     S   D++    L+   K  DRE  +     ++ ++TG   +     + + +LDVNDNAPVF       ++ EN+ +G  + ++ A D D   NA   + L       F +   TG + +K   + E+ + Y +     D  + +       + L I D+NDNSP+F +  Y  ++ EN  +G+ I RV A D D +  N  + Y+   G   +  +    T  G+I V    +DRE   S+   I A D+G P   S+A++ I V D NDN+P +   + S     I   V +G  V    A D D+GSN+++ Y I   ++    F +    G L VK+ +    + T+ L I   DRG+P +  ++ LT  VN V
Sbjct:  728 NENMAFAMDRFTGEITTRVPLDRETIAS---------YSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF---NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGI-------------LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSL-FSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-----FTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSF----VSPAQVTSIPEDVAINTHVVKLNATDSDGT----PLTFDIVEGNAGSSFKIDQSSG--LISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPS-QSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPD-AGANGRVTYSIISGNHGNAFRIDSTT--GRITV-VGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSY---GIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS--AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDV 1405          

HSP 2 Score: 197.593 bits (501), Expect = 3.721e-51
Identity = 196/750 (26.13%), Postives = 330/750 (44.00%), Query Frame = 1
Query:  352 FRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI---DKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIE---TYHGLSLF 2571
            + L      F +  K G++RT + +D E+           +I+ F     GK TT       +I + D+ND+AP +    ++    + E   + S  R   AVDLD G  N   SY++          D + ++++               G  DRE ++ YQV + A DGG P  SG+  V IE+ D+ND+ P F +      S+ E+ AI + +    A D D+ +  +LR+SF   T       F L   +G + + +SLD+E + SY   + VTD        + ++ + V ++NDN P  S  ++       V EN+ +G  + A   TD D ++    VF  I   D  +  +        +  ++   K+ D E  +    T++  D G P K+ +    + I DVND++PVF        I E+  +G+ +  + A D D+       + L   + +  F I++ +G I      + E +  Y +     D    T      +V + ++D+NDNSP F +  Y F + E+ + G  I +V A D+D S  N  +RY     TD   +     T  G I ++ +QLD EK   +   + A D G+P+ SS   +++ V D+NDN P++     SL    +  ++  G  V    A D D G+N ++ Y I   N     F ++  TG +  +  L    + ++ L I   D          T  ++I  + +   T+ G S F
Sbjct:  106 YSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYT-----MRISAF----DGKHTT----FVPLITVDDVNDNAPFF--ALSVYKTGVYEDVAVGSIVRQLTAVDLDVGI-NARLSYSLVSGDTSYFTVDSQGVIRTK--------------GAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSA-QYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF---TSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQS----RVKENTPAGTQVSA---TDRDSSTNGALVFGIIKGNDDGVFTID------GSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGS-TSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSS-NGDVRYALSDNTDVFSIN----TSTGLITLK-TQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAK---SLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENM-AFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF 796          

HSP 3 Score: 196.438 bits (498), Expect = 9.040e-51
Identity = 196/721 (27.18%), Postives = 329/721 (45.63%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESI------CKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIY--VEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADD--NSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDS-LEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHI-NITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            +Q   F ++ + G L  +S +DRE+I       K  DA             P +  T  + +     +LD+ND+AP + K  +L + +I E + ++S     +  D D G +    + T+S + +G   F +           +G  LS   L   D E  + YQ+ +TA DGG P  S   +V I + ++ND+ P F +   +  S+ E+ AIN+ +    A D   SD   L F  +   E     +F + + SG + + K LD ET  +YT  V+ T+ G    S+Y    ++VL+VNDN+P  +  S+A     ++ EN   GQ +  V  TD D+  N+ +       D    E++P +       L+ T +  DRE  +     +   D G+P + +     L I D+NDN+P F       T+ EN A G+ I ++ A D D   N    + +   +  N FRI+S TG+I    + + E  + Y ++    DS +       F  V + + D NDNSP F  +   + I E V+ G+ +  V A D D    N  + Y+   G   +   +     +G + V+  +++RE  P++T  I A D GSP ++S   + + V D+NDN P +     S ++I ++  +      V+   A D D G+N+ L+Y I   N  +  F++  T+G +     L   +   + L +   D
Sbjct:  832 NQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAG-----------SPQQSITASIHVS----VLDVNDNAPRFEK--SLFSGEIREDASVHSTVLQVKVEDKDEGSNG---AITLSLSGEGSDNFTI---------DSTGFVLSKTPL---DYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVT-SIPEDVAINTHVVKLNATD---SDGTPLTFDIV---EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAK----SLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATG------LVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF--VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS-NAQVFYSIVRGDTSAFAIN---AMNGVLTVKK-EINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVF----NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR-FKINSTSGVIMTTTPLDFEEKSQYGLEVTATD 1491          

HSP 4 Score: 186.037 bits (471), Expect = 1.578e-47
Identity = 161/567 (28.40%), Postives = 260/567 (45.86%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPIN---ISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREI-GSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDS----LEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
             DRE +S+Y++ + A D       G   V I+V D ND++P F    P+N    ++ ENT    +  V  A D DS     + +S  S         F +  K+GE+     LD+ETK SYT  +   DGKH T + + + V +VNDN+P  ++  +  G    V E+   G  +  +   D D     + +   +   +V          ++ +++T  AFDRE   SYQ+  ++  D G P +    T  + ILDVNDN PVF +    A++ E++A+G  +  + A D+D   NA+ R+ +   ++   F +++ TG +      + E+ S Y +   VTD     L  T H +     +N+ D+NDN P F    Y   + EN  +GT   +V A D D S  N A+ +    G D  +    G T  G I +  S  D E    +   + A D G P    +A + I ++D+ND++P +    PS     I     +G  V+   A DLD G    L+Y +   N  +  F ++  +GS+ V   L      ++ L +  +D
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEF----PLNSYVFNIRENTPAAQVAIV-TATDRDSGTNAAITYSLFSGE-----NKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFALSVYKTG----VYEDVAVGSIVRQLTAVDLD-----VGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQV-ALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLL-----INVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRD-SSTNGALVFGIIKGNDDGVFTIDGST--GIISIAKSP-DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF---SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV-KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 5 Score: 180.644 bits (457), Expect = 7.957e-46
Identity = 193/733 (26.33%), Postives = 324/733 (44.20%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIYVEVKVL--NVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF-----LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSR----LHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            F +    G + TK  +DRE              +L +      + ++  +    + I D+ND++P +++  +  TL + E++   S      A D D G +       IS N     + D          S +G    + V+G++DRE  + Y + I+A D GVPP      V I V D ND+SP F +    +  + E  +I S + V  A D D      + +S +       T  F +   +G L ++K ++ ET  +YT T++ +D G    +   E+ V+  +VNDN P  + QS+ G    +V ENS     +  V   D+D  +  +  +  I          +DE R K      ++ T    D E  S     +  +D       S YT++    + ++++ND  P F  +   A+++EN    T + ++ A D D+  + ++      DS+  F I+  +G I +  + + E  S Y I   VTD+       +   V + I D NDNSP+FD   Y  SI EN    +   ++ A D+D    N  I YN      ++    IG +    +   +  LDRE   ++   I A D+G+P  +SS  I++ V DIND+ P  +    SL   ++  + P    V++  A D D G N+EL + +   N  + +F L+ TTG +  K  L       + L I V D+GNPSL       ++++ +
Sbjct: 1146 FEVNPATGLVTTKRPLDRED---------QASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQ--SKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRID----------STTGR---ITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASN-ETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD----TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG----SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISG--------NDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD-------SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSD-KFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLT-WVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDAD-EGTNARITYNLS----RNDAFMIGASS--GVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP--LINSSSLRG-SVRENQPKETHVMRILASDADTGLNAELTFSLLS-NEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDE 1817          

HSP 6 Score: 174.481 bits (441), Expect = 5.473e-44
Identity = 172/657 (26.18%), Postives = 296/657 (45.05%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSI---IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIV---ELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG-KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLD 2328
            F I+   G++     +DRE++            A + L    K +  P  + +    I + D ND++P +   +N  +  I E   I S   +  A D D G  N    Y+I       ++ D      +++N        L V   ++RE    Y + I A D G P ++ +  + + V D+ND+ P F +Q  I  S+ EN+A ++ +    A+D D      LR+S +S  ++   + F +   SG ++    LD+E K  Y   V  TD K+     V ++V+N+ND +P  + Q++      +V ENS +   +  V  +D D        F S+   IV   +    S + R+  ++ T    DRE+ S     ++ +D G PP  +     + ILD NDN+P F +    ++I EN A  +  ++L A D D   NA   + L  +    F I + +G I      + E  S Y+++    D   GT  +     + + + D+ND+ P  +      S+ EN    T + R+ A D+D + +N  + ++      KS+      T D    V    LDRE+   +T  I   D G+P+LSS A + I+V D +DN P +    P+  ++ I+  +P G  +++  A+D+D
Sbjct: 1251 FRIDSTTGRITVVGVVDREAL------------ASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF--ASNETSYGIDEGVSIGSRVAVVTATDRDEG-SNAQVFYSI-------VRGDTSAFAINAMNGV------LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG-SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE---KRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTA----SVRENSPTSTSVVKVSASDRDS-------FGSLSYSIVGGKDSDKFSIDQRSG-IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA--FMIGASSGVITLAQPLDRENKSTYDLAIQARD--HGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDAD-TGLNAELTFSLLSNEHKSVFTLDNTTGDISTKV---PLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF---QPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 127.872 bits (320), Expect = 1.063e-29
Identity = 103/364 (28.30%), Postives = 166/364 (45.60%), Query Frame = 1
Query: 1444 LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRS-SQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            +  T + FDRE  S    T+   D             + + D NDNAP F        I+EN     +   + A D D+  NA   + L    E  F + S+TG+I +    + E    Y +     D    TF  +     + ++D+NDN+P F   +Y   +YE+V  G+ + ++ A D D+  IN  + Y+   G D S       T D +  +R+    DRE   S+   + A D GSP+ S  A ++IE+ D+NDN P +     +    ++   V +G  ++   A D D G+N++L+Y  T  N+    F L+  TG + V R+L      ++ L + V DRG+P L  T    +N+
Sbjct:   21 ITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLF-SGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-----ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVG-INARLSYSLVSG-DTSYF-----TVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTA---SVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNH-AFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINV 366          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 216.083 bits (549), Expect = 5.887e-57
Identity = 209/746 (28.02%), Postives = 345/746 (46.25%), Query Frame = 1
Query:  343 DGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS---IYVEVKVLNVNDNSPKISVQSFA--GGELLTVSENSESGQHIGAVVVTDADDNSGL---LPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN-FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFG-KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGV-TQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIE 2547
            DG        K F      G + T +RIDRE+  +         + L  L +P   + +P+ ++  + + DIND+ P +  +    TL+I E   +N+   +  A D D G +N T  YTI+   D    F L      +    +G+ L +I    LDRE    YQ+ ITA D G P L G   +NI + D NDH+P F     +  S+ ENT     I    A D DS    +++++ +     +    F L   +G +  +++LD+E K SYTF V  +DG   +      V + VL+ NDNSP++ +       G+    SENS    +I  ++VTD D N+     L +    D+   ++     E    + ++  K  DRE+  +   T+  +D G P + +     + + DVNDN+P F +    A I E    G+ + QL A D D   N    + +   +++  F+++ ++G + +    + E+ S   I+    D   G+  K     V + I D NDN PRF K  Y  +I E  + G  + +V A D D  + N  I Y     +D  +     + TQ G ++ + SQLDRE    ++F ++A D+G P L SS  +++ + DINDN P +    P     +I  + P G ++++  A D D+G+N+ + Y I   N+  + F ++ +TG +    +L         L I  KD GN    +T    V ++ + +
Sbjct:   30 DGASAFEGSPKQFGFNSNTGVISTTARIDRETTTQ-------ISLQLRTL-NP---SNQPISVQ--VQVDDINDNEPRFPTL--YYTLRIRESMDVNTTNPINTATDPDAG-NNGTVDYTIASG-DNTATFSL-----GTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLG-SIAENTKPGVSILRVSAADRDSGSNGDIKYA-IDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKV-----EFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQD--HGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGD-NGRITYEIS-SSDAQVNGLFELNTQTGVLWTK-SQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFY---PVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGN-FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKAD 736          

HSP 2 Score: 174.481 bits (441), Expect = 5.344e-44
Identity = 168/633 (26.54%), Postives = 292/633 (46.13%), Query Frame = 1
Query:  685 VTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG----KHFT-SIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI----DKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVD-----LNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGT--DKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            V + Y  +K+K+G + + +     ++L         + + G +DRE+++QY + + A  G V PLS +  VNIEV D ND++P+F     I + +     +  +++   A D+D+     +R+   S  E       ++   SG + L + L    +  YT  V  +D     +H T +I++ + +    ++ PK ++ S+    L   +    S Q    V V      +G L  F SI    ++ +  + P       K LL+ LK      GSY +  ++ +D G P   +S    ++I D ND+  +F+N   R  + EN + GTL+  L A   D     +  + L   SE +F ++  +G+I +++  + EE  +   S       E  ++    K D     + + D+NDN+P F + +Y  ++ E    G+P+ R++A D+D  + N    Y+   GT  DK  +     +  G++ + S  LDRE   S+   + A D  +  L S+A I+I V D ND  P +   D +   +NIT    +G  VI   A D D G N  ++Y I+  N    +F +E  TG L V ++L     + + L I  +D G   L  T+   VN++
Sbjct:  760 VGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVI-VDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEG----LLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI----NHPPKFTLSSYVTHVL---ASQPLSYQFFYVVAVDQDSGKNGQL--FYSIPQGNEEGLFGIFPGGKLYIRKSLLQALK------GSYDLI-VRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLI-SSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD-NAKFFYSLVSGTGMDKFFIN----SSTGELHL-SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYT---VNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAA-MFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVL 1360          

HSP 3 Score: 153.68 bits (387), Expect = 1.384e-37
Identity = 176/666 (26.43%), Postives = 286/666 (42.94%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHS-PINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFK-NQIPINIS----LHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG---KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-QPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVK 2481
            I ILD NDHAP + + + L +  I E++ P  S  R+  A D D G            N D +   D   I  +S+     +   +     LD E ++ Y   + A DGGVP  +    V I V D ND+SP+ K   +P +        EN+ IN+ I   +  D DS+  +       +  ++   +  FL      + LQK LD E    Y  T+ VTD       T  +V + V +VNDNSP  +  ++       +SE +++G ++  +  TD D+           D   V  S         F       L+ T K  DRE  S    TI   D G  PK  S T  + I+D NDN P F+    + TI E  ++G  + Q+ A D D+  N    + +   D++VN  F + ++TG +++K   + E  S Y  +    D  +        KV+L I D+NDN+P F    Y  SI EN   G  + +V A D+D    N  I Y+   G +     +  +     +    + LD E    F+  I A D G+   + +A + + V +  DN P +++    + +  +  +VP G  V +  A   D+  N  + Y I   +   ++F ++ T G + +   +   +   + L ++ +
Sbjct:  194 ITILDENDHAPVFTQNSYLGS--IAENTKPGVSILRV-SAADRDSG-----------SNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYF--IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTA----NISELAQNGSYVLQLNATDPDEG----------DNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSV-KVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDAD-EGTNAVISYDIIGGNNNG---NFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLY---EMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDP-TNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR 817          

HSP 4 Score: 135.961 bits (341), Expect = 4.081e-32
Identity = 161/641 (25.12%), Postives = 283/641 (44.15%), Query Frame = 1
Query:  352 FRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHS-PINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRF-KNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHF---TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFL--LKTLKAFDREI-----GSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTL-IYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEES-SRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKS---ILKHIGVTQDGKIFVRSSQLDREK-NPSFTFYIIAIDNGSPTL-SSSAYIQIEVKDIN 2217
            + L+     F ++ + G++ T+ R+DRE + K   +N     A  +      +  K ++I   + + D+ND+AP +++   +  + + E S P +  FR+ +A+D D G DN    Y++      +  F         +NS +G EL L     LDRE  S Y +++ A D     L    ++ I V D ND  P F ++   +NI+  E+  I S++    A D D      +++S    +   +   F ++  +G LI+ KSLD+ET   Y  T+   D       +++ V V VL+VNDN+P    Q       LTV EN  +G  +G    +D D  +     F      +   +P    + N     + T+ A D E       S+Q+  +  +D G P   +  +  + + D NDN+P F++ P  A      A  +L +  + A+D D   N    + +   +   F +   TG++  ++I    ++ + Y+++   +D  + +  +    V +  E      P F    Y  S+ EN  +GT +  V A     S +N  I Y     + K    ++K  GV +       +  +DRE    SF   + A+D   P+  +SSA + I V+D+N
Sbjct: 1087 YSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVI---VTVTDLNDNAPVFSRA--VYAITVSELSLPGSPVFRI-KAMDADEG-DNAKFFYSLVSGTGMDKFF---------INSSTG-ELHL--SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNIT--EDALIGSLVINLNASDKDIGQNGLIKYSI---SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVT----LTVRENVNTGFPVGRCTASDRDTGTNAHIAFS-----MYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLV-VMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAA------AGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQL--QMIHQIPDNPTIYQLTIQASDGGQPS-RQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQ-SSLNGNIEYYLTSDSSKGGFEVVKSTGVVK------TTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 5 Score: 108.227 bits (269), Expect = 1.300e-23
Identity = 140/560 (25.00%), Postives = 237/560 (42.32%), Query Frame = 1
Query:  895 VNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNAN--FRFYLQPDSEVNFRIESETGKI--FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGK-VDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPS-FTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDL-RTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            V + VTD+ND++P F   +   I++ E +   S +F   A D D  D     +S +S T       FF+   +GEL L K+LD ET  SY   V+ TD  +   +++  +E+ V + ND  P      +     + ++E++  G  +  +  +D D   +GL+    S       L+ + D       L   K+ D E       TI   D G  P  S+    +++LDVNDNAP+F  +P+  T++EN+  G  + +  A D DT  NA+  F  Y Q  S+  F + S T +I   + I      + R      V  + +G+      K + + + D NDNSP F       +      S   +  + A+D D +  N  + Y+   G +     H    Q   I     Q+    NP+ +   I A D G P+  +   + +  +      P +   D      ++T +   G  V+   A       N  ++Y++T  +S +  F++  +TG +   R +    +  +  L +   D+  PS  RT +  V I  Q
Sbjct: 1145 VIVTVTDLNDNAPVFSRAV-YAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTG---MDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYT----VNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGN----LAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKT-FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAA-----GSSLNVMTITAEDPDRNS-NGKVTYSIISGNNGYFNLHPSTGQLQMIH----QI--PDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSAD---YQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTS-DSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPS-ARTSSATVTITVQ 1674          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 205.682 bits (522), Expect = 1.334e-53
Identity = 174/578 (30.10%), Postives = 279/578 (48.27%), Query Frame = 1
Query:  793 LIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS--IYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            +IV   LDRE ++ Y + +TA +          +V+I VTD+ D  P F N   + + L EN +I + +    A D D  D      S+ S    +    F +   +GE+     LD E    Y   VQ  D  +  S  + V V+V +VNDN P  S+  +     +   E S  G  I  V   DAD  DN+ +L    SI + + +   ++  A    +       DRE+  Y  FTI+ +D+G P K S+ +  + ++D+NDN+PVF N    A ++EN   GT +  + A D+D   NA   + L       F I+ +TG I ++   N EE+  Y ++    DS     EGT      +V + + D ND+ P+F +  Y FS+ E+V  G  + RV   D DI++ N  +RY    G + S++    V +   I   +S LDRE+N S+T  I A D+G P L S+  + I ++D+NDN P +     S+ ++ +   V +  +V++  A D D+G+N +  Y IT  ++  D+F ++  TG + +K  L       + L +  +D G P L
Sbjct: 1144 IIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYF-NSSSLTVKLSENASIGTNVTKITALDKDIGDT----ISY-SIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYT----IEYWEESPEGTSILQVKAIDADIGDNAAVL---YSIVENVTDYVTVN--AITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTT-----RVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDIND-NARVRYYISSG-NTSLM--FSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF---SKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDT-DDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPL 1693          

HSP 2 Score: 186.037 bits (471), Expect = 1.468e-47
Identity = 195/742 (26.28%), Postives = 335/742 (45.15%), Query Frame = 1
Query:  364 DQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPV--MIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGI--LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD--DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQP-DSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVR---SSQLDREKNPSFTFYIIAIDNGSPTLSSSAY-IQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            D   LF I+   G++RT + +DRE++ +            + L+   K +   V  ++K ++ + D+ND+ P ++      T++  E SP  ++    +A+D D G DN    Y+I +N          V    ++N+ +G    +I LG   LDRE +  +   I A D GVP  S    V I++ DIND+SP F N       + EN    + + V  A D D     N + S++ +    +   F +   +G +  ++ L+ E   SYT T++  D        +  V + V + ND+ P+ +   +A     +V E+ + G  +G V  TD D  DN+ +     S +      S +        ++ T    DRE  +     I   D G P   S+ +  + I DVNDN P+F       T++E++ + T + Q+ A D D   N  F + +   D++  F I++ TG I  K   + E++S Y ++    D     L G        V++++ D++DN+P F K  Y   +YENV  G  +  V A D D    +K + Y  + G   S+   IG  Q G I +    S  L+RE +  +   + AI   + T   S     I V D+NDN P +       + +  T  +     ++  +A+D D+G + E+ + I   N    +FQ++  TG L   R L   D   + L ++ +D+G P+L  ++T  + ++
Sbjct: 1233 DPYGLFTIDNVTGEIRTVAELDRENVTQ------------YELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPG--YTIEYWEESPEGTSILQVKAIDADIG-DNAAVLYSIVEN----------VTDYVTVNAITG----VISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNT-DYYAYVRENQPAGTPVLVVTASDKDV--GTNAKLSYVLS--GVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYA----FSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNT-----SLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACF-----VEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMF-LIG-EQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPI-TDATILTVKAQDGDEGESGEIIFTIVSGNE-NGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVL 1922          

HSP 3 Score: 157.147 bits (396), Expect = 1.495e-38
Identity = 165/639 (25.82%), Postives = 268/639 (41.94%), Query Frame = 1
Query:  721 GEMKFDLRVIMKS--SLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELR---VNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-----IYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVT-------DADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRA----TIKENMAVGTL---IYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSK---------IIFNAEESSRYEISAYVTDSLEGTFHKVFG--KVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTD------KSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTL 2514
            G + ++LR    +  S+N+ +G   ++    ILD +   QYQ  +   DGG      E+    V + + D+ND+ P F   +P    + EN    +I+F   A D DS +  N R SF  +  D+     F    SG +   + LD ET  +YT TV   D  H  S     + + V VL+ NDN+P+I+       + LT++ N   G   G V+++       DA  N  L       D      S  +  +    L  +    DRE+       I  +D G PP  +S T  + ILDVNDN P F   P ++     I  +   GT+   +  + A D D + N    + L  D    FR++  TG++  +         +  NA+   R+ +    TD       +     +V + + D NDNSP+F    Y   + E    G+ + +V A D D+    K I YN   G +      + +++H    +   +  + S+   E+                      Y+ I V D+NDN P +   + S    ++  + P G  V++  A D DQG+N ++ Y +T  N   D F +   TG + V   +    + T  L +  +D+G PS  +T 
Sbjct:  422 GALTYELRGGQAAYFSVNADNG---TISAAQILDYDTLRQYQFSLVVKDGG--GFYQEIAIATVTVTLQDVNDNDPEFTG-MPYTSDIAENLPAGTIVFQVTATDKDSGE--NGRLSFNISAGDD--GGHFSINGSGLVTTARELDRETIATYTLTVSAYD--HGVSSRHKHVQLTVNVLDENDNTPQIT-------DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD------SRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVI-YNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVER---------------------TYVVIYVDDVNDNDPVF---NQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNK-DDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTF 1009          

HSP 4 Score: 155.606 bits (392), Expect = 3.882e-38
Identity = 174/676 (25.74%), Postives = 288/676 (42.60%), Query Frame = 1
Query:  499 PGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDG-----KHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL--QPDSEVNFRIESETGKIFSKII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVN--SGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSL-----NHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNI 2472
            P K +T  V IK    ++DIND++P +N  +    ++  E+ P  +   +  A D D G  N   SY +S            +  + +++  +GN   +     L+RE+   Y + + A+D  +    G  RV I VTD NDH P+F  Q     S+ E+  +   +      D D +D   +R+   S      +  F + E +G +    +LD E   SYT  +   D      +  TS+ + ++  +VNDN P  S   +     +T+ E+      +  V+ TD D+ +     +        ++  +     N  L+      D E  S    T+   D G PP   +    +H+ DV+DNAPVF      A + EN+  G  +  + A D D E +    +Y     +++  F I  ++G I          N E  +RYE+       +  T  K      + + D+NDN+PRFD + Y  S+ E+    +   I  V+A+D D  E  + I +    G +  + +    T    +  R+  LDRE    ++  ++A D G P LSSS  + I V D+NDN P    P   L        ++  ++  G  V    A+DLD  + + + Y+IT     +  F L  T+G L  + TL   D   H L +
Sbjct: 1377 PSKSSTASVAIK----LVDINDNSPVFNNTDYYAYVR--ENQPAGTPVLVVTASDKDVGT-NAKLSYVLSG----------VLYTRFAIDPDTGN---ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF-TQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISS---GNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIE--DVNDNKPLFSKSVYN----VTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYID---ANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEII-FTIVSGNENGVFQMDNKT---GVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLD--TKNLIYYYITNTEEQK-YFILNETSGELRTRITLDREDSSVHYLYV 2012          

HSP 5 Score: 146.747 bits (369), Expect = 2.219e-35
Identity = 197/698 (28.22%), Postives = 297/698 (42.55%), Query Frame = 1
Query:  553 DINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTV---QVTDGKHFTSIYVEVKVLNVNDNSPKI--SVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVF-------CSIDKPIVELSPLSDEARNKFLLKTLK-------AFDRE-------------IGSYQIFTIKCSDTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHK--VFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVI-KFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLR-THRLNILVKDRGNPSLERTLTFKVNIV 2535
            D ND+AP + +   +   +I E++ + +      A+D D G  N    Y  S     +  F        SLNS +G EL+L   G LD E    Y +++ A D GVP L     V IEVTDI+D  PRF     +   + ENT I S +    A D D    N + +  +S   D V   F +   +G + +  S+D E    +  TV   +V D    T++ V V V++VNDN P    SV  F   E + +     S Q    + VTD D N    PVF          D     + P S      ++ KTL         FD E              G  +   +  ++T    K S+  S  L +++VNDN P+F       T+ E +  GT I  + A D D        + L+      F + ++ G I +  I + +   +Y+ S  V D   G F++      V + ++D+NDN P F    Y   I EN+ +GT + +V A D D  E N  + +N   G D     H  +   G +   + +LDRE   ++T  + A D+G  +      + + V D NDNTP+    D      NI+     G  ++    A D D GSN +L Y ++    G   F L   TG L +  T    +L+ ++ L I V D G+P    + T  V I+
Sbjct:   38 DYNDNAPVFTEQPYMA--KIAENARVGTTILKISAIDADSGT-NSQVQYKFSNATATQTPF-------FSLNSVNG-ELTL--GGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLK-EIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV---FTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQ----LQVTDGDKN----PVFRRVLYHLVGADSDKFAIDPTSGTL---YINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDG--GGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGE-NGRLSFNISAGDDGG---HFSINGSG-LVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQIT--DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMS---GGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTIL 695          

HSP 6 Score: 135.961 bits (341), Expect = 4.496e-32
Identity = 183/725 (25.24%), Postives = 308/725 (42.48%), Query Frame = 1
Query:  538 IIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANN------LRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTF---------------------------TVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPI--VELSPLSDEARNKFLLKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSY-TSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQP-DSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGK-----VDLNIEDMNDNSPRF-DKDIYHFSIYENVNSGTP-IDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVG-----HEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHR---------LNILVKDRGNPSLER-TLTFKVNI 2532
            II + DI+D  P +  + +    +I E++PI S     EA D D G +N      IS N DG    D              N   + V G +D EK   +++ + A +   P  +  + V + V D+ND+ P F   + I   + E+ A+   +   V++ +  +D +       + +  +    D+    F +   SG L + K+LDYE ++++TF                           T   T  K   +  V + ++NVNDN P  +  S+      T+ E    G HI  +  TDAD     L  F ++   +   + +  S  A N   +   +  D + +  YQ F++   D G   +  +  T  + + DVNDN P F   P  + I EN+  GT+++Q+ A D+D+  N    F +   D   +F I        S ++  A E  R  I+ Y T ++    H V  +     + +N+ D NDN+P+  D      +I E    GT  +  + A D D    N  + Y+   G  +  L     +  G++ +  + LDRE   S+   I   DNGSP  ++S  + + + D+NDNTP +  P+P+ +       V  G       +I   A D D  +N ++ Y ++    G   F+L+P TG L V++ L     +  R         L+I   D+  P  +R + T +V+I
Sbjct:  140 IIEVTDISDMPPRF--LQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTID-------------SNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYI-FDVREDVALPGRV---VSDQLQVTDGDKNPVFRRVLYHLVGADSDK----FAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYN----YTMDEEITPGTHIADITATDAD-----LGTFGALTYELRGGQAAYFSVNADNG-TISAAQILDYDTLRQYQ-FSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSING------SGLVTTARELDRETIATY-TLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGS-NGQLTYSMSGGDSRFTLN----SATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAF-DPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHG--FFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSI 815          

HSP 7 Score: 103.219 bits (256), Expect = 3.980e-22
Identity = 144/586 (24.57%), Postives = 246/586 (41.98%), Query Frame = 1
Query:  907 VTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQT--FFLKEKSGELILQKSLDYETKMSYTFTVQVTD---GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVE--LSPLSDEA----RNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFR---FYLQPDSEVNFRIESETGKIFSKIIFNAEESSRY-------------------------EISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLS-SSAYIQIEVKDINDNTPEWIH-PDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            V D ND++P F  Q P    + EN  + + I    A D DS   + +++ F + T    TQT  F L   +GEL L   LD+E   SY   V   D    K  +   V ++V +++D  P+  +QSF    L  + EN+  G  +  V   D D           I+ PI+   +S  SD       N  ++    + D E       T+K S+  +P  +++ T  + ++DVNDN P FL       ++E++A+   +   + Q  D + N  FR   ++L       F I+  +G ++     + E+   +                         ++ A  TD+ E         V L + ++NDN P F K  Y++++ E +  GT I  + A D+D+     A+ Y  + G       +  V  D      +  LD +    + F ++  D G      + A + + ++D+NDN PE+   P  S    +I  ++P G  V +  A D D G N  L + I+  + G   F +   +G +   R L    + T+ L +   D G  S  + +   VN++ +
Sbjct:   36 VDDYNDNAPVFTEQ-PYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNAT---ATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRF-LQSFY---LKEIEENTPIGSTVVTVEARDGD---------VGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEK--FSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFG-ALTYELRGGQ----AAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTS----DIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH-FSIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDE 591          

HSP 8 Score: 103.219 bits (256), Expect = 4.481e-22
Identity = 171/714 (23.95%), Postives = 283/714 (39.64%), Query Frame = 1
Query:  400 GKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLP-EAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTA------INSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFF-LKEKSGELILQKSLDYET-KMS--------YTFTVQVTD------GKHFTSIYVEVKVLNVNDNSPKISVQSF---------AGGELLTVSENSESGQHIGAVV--VTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYL-QPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTL 2436
            G + T   +DRE+I             L +  +    +++   ++  +++LD ND+ P        +T  I E +   +       AVD D G  N   +Y++S    G+ +F        +LNS +G  L +   G LDRE +  Y ++I   D G PP +    V++ + D+ND++P F      +++ +  T       IN  +    A D D +DAN      LS  E      FF L   +GEL ++K LD E+ +MS        +   +  TD       +   ++ V + V + NDNSP+   Q++          G  ++ VS   +  ++ G V+  +TD D+N       C ++K +   +      +N  L K                 KCS         +Y   +++ DVNDN PVF      A + EN   GT + ++ A D D   N    + L   + +  F I + TG+I    + + E    + ++    D  E +  K F +V + ++D NDN P+F    Y   I EN   G+ I  V   D  IS  +  +R    P    ++L                   REK P     I  I++ SP    S Y                       ++N++     G  + +  A D D+G N+ + Y     N     F +  +TG + V   L
Sbjct:  548 GLVTTARELDRETIATY---------TLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITD-GLTITTNISEGAGGGTVLLSSIAAVDPDAG-SNGQLTYSMSG---GDSRF--------TLNSATG-RLQISPTG-LDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPD-ADANGKVAYSLSGDE----HGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRK-----CEVEKLVRHYNW---HKKNCVLCKES---------------KCS------VERTYVV-IYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV--PDQKIS--SSTLRPRSSPRAPAALLTA-----------------REKRP-----ITLINDESPLFEKSMY-----------------------YVNVSESASRGIVIGRVTATDRDEGINAIIFY---SSNGAEAKFYVSRSTGDIIVDSPL 1150          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 202.986 bits (515), Expect = 1.084e-52
Identity = 183/720 (25.42%), Postives = 307/720 (42.64%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHF--TSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDT-ELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            F I++  G + TK  +DRE + +             +    G   +    +   I++LD+ND+ P + +  N+    IPE   I        A D D G +   K Y I  N DG+           S+   SG   ++ V+  LDREK   Y + + A D G PP S  + V I + D+ND +P+F  ++  + ++ E+  +N ++    A D D      + F  +S  +      F +   +GE+ +++ LDYE    +   V   D G+ F      V++ +++VNDN+P+     F       + EN   GQ    V   D D  +     F  +   +    P S    N   +   +  DRE      F IK  D G P K  +    + +LD+NDN P F  E    +I EN   GT + Q+KA D D+   N  +        +  FRI  + G I      N      Y  S   +D +  +   V+    +N+ D N ++P F +  Y   + E+ + GT +  V A D D    N  I Y+       +++    V +   +   +  LDREK  ++ F + A D+G P L + +++ I + D+NDN P ++ P        +   +  G  VI+  A D D G N+++ Y       G+  F ++ T G +   + L    +  + L ++  D+G P  + ++  KV
Sbjct:   71 FSIDQITGVITTKRGLDREFLDRHF---------FRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFER--NIYAADIPEDKSIGDFVLAVRASDADSGSNGEVK-YCI-LNSDGDNS-------AFSIGEVSG---AVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKV-YSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND---MNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQ----TMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDL----PFSIN-ENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVY----VNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGS-NAKISYSI-----ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPS---YEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKV 740          

HSP 2 Score: 177.178 bits (448), Expect = 8.958e-45
Identity = 186/726 (25.62%), Postives = 322/726 (44.35%), Query Frame = 1
Query:  337 NNDGHFRLLDQNKL--FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSI---IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFD-LRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNAN--FRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGT-FHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            N +  F ++  N +  F I    G++R K ++D E             I +F L    +   +P +       I ++D+ND+AP +  V++     IPE+  +   F   +A D D G              +GE+ F  ++  +  S+N  +G    + +   LDREK  ++   I A D GVP   G  ++ I + DIND+ P+F +Q   + S+ EN+   + +    A D DS    N+ +S +S++  +     F     G + L  +L+Y TK  Y F+V  +DG   ++  V V V + N ++P+   +S++      V E++  G  +  V+ TD D  S        I   I  L P         ++KT  + DRE + +Y+ F +  +D G P   +     +HI DVNDN PVFL     A ++E++  G  + ++ A D D   NA   + F    D +  F I+S  G I +    + E    YE++   TD  +GT   +   KV + +ED+ D+ P F+K +Y  ++ E+    +P+  V+AK  D+S     + Y+   G    +     +  +        +LD E    +   + A    SP  + +  + + +KDINDNTP          H+NI           +++    D   + +L + + E N+ ++   L  T+G L V + L +   +   + I V D
Sbjct:  266 NGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYE------------MIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF--VSSHFQTMIPENYAVGQEFYRVQAYDKDHG-------------TNGEITFSFMQNDLPFSINENTGG---ISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKF-SQEEYHTSIAENSRWGTSVLQVKAIDPDSG-PTNVVYSIVSSSGHDRC---FRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSA----EVKEDASLGTSVLTVLATDRDTGSNA-----KISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYR-FEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATD--QGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSP-ETGMMYSIVRGNSPQVFD---INPNTGAIQTLMKLDYETQSEYRLTVRA--TLSPFFTETT-VMVYLKDINDNTPVL-----EAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNA-KEWVTLNATSGELSVNKKL-IQASKPANIKIAVTD 930          

HSP 3 Score: 121.324 bits (303), Expect = 1.280e-27
Identity = 104/419 (24.82%), Postives = 182/419 (43.44%), Query Frame = 1
Query: 1291 TVSENSESGQHIGAVVVTDADDNS-GLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSE-VNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDI-FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +VSE++E G  +  V  +D D  S G++    S  + ++  +  S +     ++ T +  DRE      F +K  D GEP         +++LDVNDN P+F      A I E+ ++G  +  ++A D D+  N   ++  L  D +   F I   +G +      + E+   Y +     D            V + + D+ND +P+F K +Y  +I E+V     +  V A D D    N  + +    G D +      +  +G++ V+  +LD E    F   + A D G P L +   + I + D+NDN P+++    S     I  +  VG E  + +A D D G+N E+ +   +     D+ F +   TG + +K  L    +      I  +D+G P  E T    + ++
Sbjct:   28 SVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITG-VITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATV-TVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGS-NGEVFFEIVSGNDMNFFSINRI--NGEVRVK-QKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVS---SHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQ----NDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLL 433          

HSP 4 Score: 116.701 bits (291), Expect = 3.755e-26
Identity = 93/326 (28.53%), Postives = 150/326 (46.01%), Query Frame = 1
Query: 1576 DNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPD----SEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDL--NIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +N P F      A++ E+  VGT++  + A D D+  N   R+ + P     S   F I+  TG I +K   + E   R+       D  E +     G +DL  N+ D+NDN P F+++IY   I E+ + G  +  V A D+D S  N  ++Y        +    IG        ++  +LDREK P++T  + A D G+P  S++  ++I + D+ND TP++      +    I   VPV   V    A D DQGSN E+ + I   N   + F +    G + VK+ L    +    L +  +D+G P L    T  + ++
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLE---GYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDAD-SGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMK--KLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQF---SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND-MNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALI 330          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 202.601 bits (514), Expect = 1.467e-52
Identity = 185/662 (27.95%), Postives = 306/662 (46.22%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSI---YVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNG---SPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            + ++D+ND++P +   N   T  + E +P +S      A D+D G +N   SY      D   KF LR   K  + SK            LDRE   +Y + + A+D G P  S    V + V D+ND++P F+ Q      + EN  + + +    A D D     ++ + F    + +V Q F + +++G++   + LD E K SY F++  TDG     +    V V V +VND SPK S   ++    +TV+E+   G  +  ++ TD DD  G       I   IV         +   +L  +   DRE+    I  +  SD G      + T   +++LDVNDN PVF+NE    T+ E + +G+++  + A D D   N   R+  +  +++  F+I   TG I +    + E ++RY +    TD  +      +  V + +ED NDN P FDK+     IYENV   T +  ++A D D S +N  I Y       +S   H  +  +  +   +  +DRE+   ++  + A D        L ++A ++I ++D+NDN P+++    S N   +    P   +V    A D D G    ++Y I  P++G+  F L+  TG L +  +L   D+  + L+I   D G+P L
Sbjct:  900 LKVVDVNDYSPVFG--NWSYTAHVLETTPPDSNIIEVVATDVDSG-ENGRISYAFDSKVDTS-KFGLRNGGKIFIKSK------------LDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQ-QASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF----DTQVAQ-FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYS----VTVNEDLPVGSSLLTLIATD-DDQQGP---NSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDD-SGLNSRIWYTID---SQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV----SRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK--FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPL 1521          

HSP 2 Score: 167.933 bits (424), Expect = 8.100e-42
Identity = 196/719 (27.26%), Postives = 310/719 (43.12%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVM--IKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSI---YVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKI-FSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRG-NPSLERT 2511
            F I+   G + T + +DRE I +         + L +L H   R + P+      I+++ D ND+ P +N+ +   +L   E+SP  S      A D D G +++     ++ N      F L        NS++           LD E QS Y   + A DGG    S    V++ +TD+ND+ P F +    ++   ENT I   I    A D DS      RF       DEV    F  + SG + L K LD ET+ +Y  TV+  DG    S+    V + VL+VND  P  S   +      T+ E+S++   IG V     D  +    V+ SI K   +   L +     +L   +   D E       T++  D G PP        + ++D+NDN+P F +  +   + E+  +G   Y +   D D+ +     F L  +    F ++S TG +  +K+I     +  Y +     D            ++L + D+ND SP F    Y   + E     + I  V A D D  E N  I Y F    D S     G+   GKIF++ S+LDRE    +   +IAID+G+P  SSSA +++ V D+NDN P +     +     +  + PV   +    A D D+GSN  + Y F T+       F ++  TG +   + L      ++  +I+  D G +P +++T
Sbjct:  441 FAIDPSSGMITTATDLDREQIPQ---------VVLTVLVH--DRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLF--ENSPSGSPVVQLLAQDPDIGENSLILYSILTPN----TPFFLDPRKGLVTNSRT-----------LDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVF-DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV----FSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYN----FTIQEHSQALSVIGHVHAISRDKGTNAEVVY-SISKGNTDNIVLINSTGTLYLQSEV---DHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSST-AMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGE-NGRISYAFDSKVDTS---KFGLRNGGKIFIK-SKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAF---FVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ----FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKT 1103          

HSP 3 Score: 159.458 bits (402), Expect = 3.121e-39
Identity = 200/735 (27.21%), Postives = 316/735 (42.99%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKI-ALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEA----RNKFLLKTLKAFDREI-GSYQIFTIKCSDTGEPPKHSSYTS-RLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISE-INKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQ-LDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKR--TLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQ 2541
            F I  + G ++T   IDRE I +        K+ A    +    R      +K II   D+ND+AP +   N    +   E  P N       A+D D G     + Y I     G+   DL+  +             L ++G LD E   QY + I+A D G PPL+     N+ V D+ND+ P F   + I  ++ EN    + +    A D DS     L +S  S  E      F + + SG ++    LD E K +Y  TV  T   +    +S  V + V++ NDN PK      +    L V ENS + + I  + V D D  +    V  SI      +S  +D A    R+   L T    DRE   SYQ+ +++  D   PP ++++ +  + I D NDN PVF      +TI E    GT I  L A D+D+  N N  + L  D+   + I+S TG ++S   F       Y       D  +     +   V + IED N+++P+F K  Y   I+ N ++   +  V A D+D  +  N  + Y      + + L    V +     VR+S             YIIA D+GSP L     +QI + +I D+ P +++  P+   ++I  +  VG  +    A+     S++++ Y I   N GR  F ++P TG + V     L     +  RL+++   +G  SL   +   +N++ +
Sbjct: 1378 FKINSETGLIQTTHPIDREEISEY-----SLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRNLTYVM---EDEPFNFQVTSITALDPDTGQGGNVE-YRIVSPDTGKFSLDLKTGV-------------LKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIG-TVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVE---MDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKF----ISPVVTLKVPENSPA-RLIYTLTVQDLDYGNNT-KVLYSI------MSGNTDGAFTIGRSTGELSTTTKLDRETKASYQL-SVQAKDI-TPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIV-PVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLF---VVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPA--RVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGR-AFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDR 2060          

HSP 4 Score: 144.05 bits (362), Expect = 1.386e-34
Identity = 196/752 (26.06%), Postives = 333/752 (44.28%), Query Frame = 1
Query:  328 SNFNNDGH--FRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMD-GGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GK-------HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLT-VSENSESGQHIGAVVVTDADDNSGL-LPVFCSIDKPIVELSPLSDEARNKF-------LLKTLKAFDREIGSYQIFTIKCSD---TGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKII--FNAEESSRYEISAYVTD--SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK---SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVP---VGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKD 2484
            S+  ++GH  +R   Q   F ++++ GK+ T   +DRE+    V           I+   G  + +    +  + + D+ND +P ++K  N  ++ + E  P+ S+     A D D+   N   +Y I     G   F        SLN  +G    L ++  LDRE   ++ + + A D GG   L     + I V D+ND+ P F N+     ++ E   I S++   +A D D  D   +R+  ++   D    TF + E +G +   ++LD+E    Y   V  TD GK          +IYVE    + NDN P     +F    ++T + EN     ++    +   DD+SGL   ++ +ID         S   R  F       L++T    DRE  S     ++ +D   T +   +++ T ++ I D+NDNAP F++  +   + E+      +  + A D DT    N  + +       F ++ +TG +  K+I   + E+  +Y +    TD  S   T +++F      + D+NDN P F +D++  ++ EN  +GT + +V A D D S  N  + Y+   G +    SI KH G      + V +S LDREK  ++   + A     P   SS  ++I V D NDN P++I P        +T  VP       +     +DLD G+N+++ Y I   N+    F +  +TG L     L      +++L++  KD
Sbjct: 1043 SDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYV---------FSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSK--NKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA---GPKAF--------SLNQVTG---VLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFK-TVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTD---GTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVE----DANDNRP-----TFDKNPIITWIYENVPINTNV--TTIKAHDDDSGLNSRIWYTID---------SQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNL-TYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVL--KLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNV---VVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRD-SGSNAELTYSIPSGVEMDKFSIDKHSG------LIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISP-------VVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNT-DGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKD 1724          

HSP 5 Score: 143.28 bits (360), Expect = 2.346e-34
Identity = 196/741 (26.45%), Postives = 322/741 (43.45%), Query Frame = 1
Query:  331 NFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTI-SKNKDGEMKFDLRVIMKSSLNSKSGNELSLI-VLGILDREKQSQYQVLITAMDGGVPP---LSGELRVNIEVTDINDHSPRFKNQIPINIS-LHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTSIY--VEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGL-----LPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRF-YLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK--SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSL 2502
            N N DG F+         I E  G + T   +D E   + V      +++   +   GK+  K       I++ D ND+ PT++K  N +   I E+ PIN+     +A D D G  N    YTI S++     K          +NS++G    LI     +DRE+ S+Y + + A D        L     + I + D+ND++P+F ++   N++ + E+   N  +    A D D+    N+ +  +S      T  F L  K+G L L  SLDYE    YT  +  TD G    + Y    V V++VNDN P+ +   F G    TVSEN  +G  +  V   D D  S       +P    +DK  ++        ++  L+ T    DRE       T+  +    P + SS + R++++D NDN P F++  +   + EN +   LIY L  QD D   N    +  +  +++  F I   TG++ +    + E  + Y++S    D +   ++  F  + + IED NDN P F + +Y  +I E    GT I  + A D D S  N  I Y     T    SI    G+      F   + + +E N    F+ IA D G     +   ++I+++D N++ P++    P   HI           ++     D D+ +N ++ Y + +  +   +F +E  TGS+      +      H L I+ +D G+P L
Sbjct: 1265 NGNTDGTFK---------INETTGVISTLRALDFEVTNRYV-----LRVSATDM---GKKQQKTSYQLVTIYVEDANDNRPTFDK--NPIITWIYENVPINTNVTTIKAHDDDSGL-NSRIWYTIDSQSPRAHFK----------INSETG----LIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR---NLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPD----TGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIG----TVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSID--------KHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKD-ITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKD-SGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARF--ETSIKQEYN----FFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKT-PYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPL 1942          

HSP 6 Score: 139.813 bits (351), Expect = 3.176e-33
Identity = 194/786 (24.68%), Postives = 331/786 (42.11%), Query Frame = 1
Query:  379 FYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSI---IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTI-SKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNE-PMRATIKENMAVGTLIYQLKAQ-DEDTEL-------NANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTD----SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTP--IDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINI------------------------TYHVPV----GHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVK--DRGNPSLERTLTFKVNIVQQIETYHGLSLFGK 2577
            F I++  G + T S +DRE            K   F+  H     + P  + S    I+++D ND+ P +  ++ ++TL++PE+SP    + L    DLD G +N    Y+I S N DG                +S  ELS      LDRE ++ YQ+ + A D   P  +    + I + D ND+ P F+  +  + ++ E T   + I    A D DS    N+ +    T  ++    + +  ++G +      +   K  Y F     D         + V +K+ + N+++P+ +   +     + +  N+ +   +  V  TDAD D S    V   +D      S    E+ N   ++T   F           I   D G PP       ++ I ++ D+ P FLN+ P R +I EN  VG+ I  ++A+   D ++       N    FY+ P + V          + S    + E +  + +    T     SL G     +  +D+N+ D NDNSP F        + E+  +  P  + +V A D D S  N  + Y+   G +  +      T  G+I   +  LDRE   SF   I   D+G P  S++  +++ V D+NDN P +   DP L+ +NI                        TY++      G  +++  A D D GSN++++Y     NS +  ++++  TG +  +RT+ V  +R   + I V+  D+G P  +R L +   I+ +   +   S FGK
Sbjct: 1589 FSIDKHSGLIVTNSILDREK-----------KDTYFLTVH-ATGVSYPFRVSSTSVRINVMDRNDNPPKF--ISPVVTLKVPENSPARLIYTL-TVQDLDYG-NNTKVLYSIMSGNTDGAFTI-----------GRSTGELSTTTK--LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSL-YSSTISELTPPGTSILNLTASDKDSGSNGNIVY----TLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYE----VHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVES-NTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVI--------SVASADALDYESTKNFRLHLVATPQGWVSLNG-----YMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVD-SGTNGKVTYSIWTGNEAGVFTIDSTT--GEI-TTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF---DP-LSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVR-IRDSFIQIPVQAMDQGVPP-QRALVYVRIIITREPKFELPSYFGK 2312          

HSP 7 Score: 138.272 bits (347), Expect = 8.941e-33
Identity = 184/776 (23.71%), Postives = 313/776 (40.34%), Query Frame = 1
Query:  352 FRLLDQ---NKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHIL--DINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINI--SLHENTAINSIIFVF--VAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGK---HFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLS-------DEARNKF-------------------LLKTLKAFDREI-GSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDK---SILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVK--DRGNPSLERTLTFKVNIVQQIE 2547
            +RL D      LF +E   G +RT +              P  + AL+I+       + P+    I+ I+  +I D  P +        + IPE+S + S      A    R   +   +Y+I     G   +         ++  +G  +S+     LD E    +++ + A   G   L+G + ++I V D ND+SP F    P N+   L E+T      FV    A D+DS     + +S  +  E  V   F +   +GE+   K LD ET  S+   ++ TD       T+  V+V V ++NDN P      F     + + E++ +G  + +VV TD D  S L     S   P + +  +S         A+ K+                   ++   +  D  I  S+    ++  D G PP+ +    R+ I       P F        + EN  +GT +  ++  D    L    R     ++   FRI   +G I      + E   R+ +     D    +   V   V +N+ D+ND  P F +  Y     E +  GT +  V A D D S  N  + +  + G DK   +I +  GV +  +       LD E   +    + A D GSP + +   + I V D+NDN P +  P P  N + +  ++P+   + +  A D D G+N+ L + +    +G+ +F ++  +G L    T    +   ++ ++ +K  D GNP L   +T  VN+  + E
Sbjct: 1893 YRLDDSKNSTSLFVVESNTGSVRTSAGFSNP---------PQGRHALYIIAE--DHGSPPLRGYGIVQIVIGNIQDDPPRFLN-QTPARVSIPENSKVGSYITTVRA----RASSDAQVTYSIISGNKGRAFY---------VDPFTG-VISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFH---PSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPL-----FDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLG-RISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPS-KPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKD-SGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQR------ALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGP--NDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIG-GTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDE 2615          

HSP 8 Score: 135.191 bits (339), Expect = 8.680e-32
Identity = 181/797 (22.71%), Postives = 330/797 (41.41%), Query Frame = 1
Query:  277 EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKS-SLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKS--LDYETKMSYTFTVQVTDGKHFT---SIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGL-----LPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPM-RATIKENMAVGTLI---------------YQLK-------------AQDEDTELNAN--FRFYLQPDSEVNFRIESETGKIFSKIIFNAE-ESSRYEISAYVTD-SLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            +  SN +IV  L+N  +      G + +  +  + Y   +F    T  + +    C   D   D K+A+            PV IK    I D N+HAP + K      + I  ++  ++   +  A D D             K+ +G++ + L     S SL     N  S+          Q ++ + I A D G PPL G   V I + +I D  PRF NQ P  +S+ EN+ + S I    A    SSDA  + +S +S  +    + F++   +G + +  +  LDYE+  ++   +  T     +    + +++ V++ NDNSP     +     L  ++E++ + +    V VT  D +SG        ++   +  +  +   + E      + T K  DRE  +     I+ +D+G PPK ++   ++ + D+NDN P+F  +P+    I+E+   G ++               Y LK             A D+D+  NA   + F +    +++++I+++TG I ++   +     S  +I     D  +      V+ ++ +  E      P+F+   Y   + EN   GT +  V   D+        I YN +      I +  GV    K       LD E    F   + AID+ +P+      + I V D+ND  P +     S      +  +PVG  V+   A D D G+N  + +F  +    +  F ++  TG +  +R L    ++TH +++   D G+P +   ++  + ++
Sbjct: 1778 DSGSNGNIVYTLSNDTY------GVYSIDSRTGIVYSAARF---ETSIKQEYNFFCIAKDQGQDPKMAIV-----------PVRIK----IEDKNNHAPQFTKTP--YEVHIFPNTSASALVTMVTATDAD-----------TDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARA--SSDAQ-VTYSIISGNKG---RAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNM----LAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGE------ITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF--DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE------PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNK------PLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQ---SGYMAQWSEGIPVGTIVVNVSAADKDSGANGRV-WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVL 2503          

HSP 9 Score: 131.724 bits (330), Expect = 9.481e-31
Identity = 147/506 (29.05%), Postives = 210/506 (41.50%), Query Frame = 1
Query: 1099 LKEKSGELILQKSLDYETKMSYTFTVQ--VTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGG--ELLTVSENSESGQHIGAVVVTDADDNS---------GLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQ--PDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIE--DMNDNSPRFDKDIYHFS--------IYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFI---TEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI 2532
            L+  +G +  +  LD E   +Y  T+    T  K +T   V V V ++NDNSP     SF  G    L V EN +  +     V +D   NS          +  VF  I K   +    +D   N   +      DRE     +  I  SD G P  H      + + D NDN P F N     TI EN+ VGT I Q+ A D+D   NA  ++ ++   D +  F I   TG I + +  + E    Y I     D  +G+ H++     + IE  D+NDN+P     + H S        + EN   GT + RV   D+D S  N  +    + G D        V  D  I      LDRE +  F    + ID G P  ++    +I V D+ND  P++   D       +  +  V   V    A D D GSNSEL Y I   TE  S    F ++P++G +     L    +    L +LV DRG+P L    +  VN+
Sbjct:    7 LEYNAGVITTKTVLDREKVSAYNLTIVEFSTPPKSYT---VLVYVQDLNDNSP-----SFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSI----GVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAED--KGSSHQLSSSAIVRIEVLDVNDNNP-----VIHVSYTLGGSYQVTENATIGTQVARVSVSDAD-SGKNGEVNVTLE-GGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF---DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNL 488          

HSP 10 Score: 127.102 bits (318), Expect = 2.126e-29
Identity = 149/593 (25.13%), Postives = 254/593 (42.83%), Query Frame = 1
Query:  808 ILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGEL----ILQKS---LDYETKMSYTFTVQVTDGKHFTS---IYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFC----SIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPK-HSSYTSRLHILDVNDNAPVF-LNEPMRAT--IKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDS---EVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEG--TFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTD-KSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTL 2514
            +LDREK S Y   +T ++   PP S    V + V D+ND+SP F       + + EN        + V  D  S+   +  ++ +S     V +    ++  G+L    ++  S   +D E   SY   +  +DG +  +   + + + V + NDN P+ S  S++G    T+ EN + G  I  V  +D D  +     +     S  + I  + P +    N   L      D E     +  +K  D G   +  SS   R+ +LDVNDN PV  ++  +  +  + EN  +GT + ++   D D+  N      L+       + F + ++   I      + E    + + A   D  +   T  K F    +N+ D+ND +P+FD+  Y   ++EN    T +  V A D D    N  + Y     T+ +S L    +     +   ++ LDRE+ P     ++  D GSP LS +  + + + D NDN P +   + S  + ++  + P G  V++  A+D D G NS + Y I  PN+    F L+P  G +   RTL      ++   +   D G  S   T+
Sbjct:   19 VLDREKVSAYN--LTIVEFSTPPKS--YTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQS--YTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSG----TIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRL------DYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSF---RINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGS-NSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF---NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP---FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATV 585          

HSP 11 Score: 120.939 bits (302), Expect = 1.611e-27
Identity = 162/671 (24.14%), Postives = 274/671 (40.83%), Query Frame = 1
Query:  541 IHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPE------AVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDI----------------------------DSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYT-FTVQVTD-GKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQP-DSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRF----DKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNP--SFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVP----VGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTG 2412
            I+++D ND++P ++  N  M  Q+ E +    AF+ P       A D+D G +        + N+ G    D          S +G    +    +LDRE  + + ++I   D G+PP S   +V + VTD+ND+ P F     +NI   E+T   +++   VA D                             DS     +++SF  T  D++   + +   +G +  ++++D   + S+    VQ  D G       V V+++   +  PK  + S+ G     V EN+  G  +  V VT   DN+  LP    I   I E S      +   ++   K  D E     +  +   D   P K       +++ DVND  PVF      A   E + VGT++  + A D+D+  N    F +Q  D + +F I+ +TG I ++   + E    + +S   TD      H     V + + D+NDN P F      D+    + EN+   + +  + A D D S  N  + +    GT + +     + +       +   D E      ++  I A D G+P LSS+  I + V D ++        DPS N ++  + VP    +G  V +  A D D G    + +    P S  +  ++  TTG
Sbjct: 2055 INVIDRNDNSPAFHPSN--MLAQLAEDT---GAFK-PRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTID----------STTG---EITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNI--REDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQI--DYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE--PKFELPSYFG----KVPENAMMGTSVLTVRVT---DNAAGLP-LGRISYNI-ENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDV-SVTIRVLDLNDNPPVFRVPGPNDV---QVLENLPLNSRLYEINATDRD-SGANARLSFTVIGGTGQGLFL---IDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEY-------DPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTS--NALKMNATTG 2674          

HSP 12 Score: 81.2629 bits (199), Expect = 2.066e-15
Identity = 84/324 (25.93%), Postives = 140/324 (43.21%), Query Frame = 1
Query:  811 LDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKF--LLKTLKAFDRE-IGSYQI-FTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKI 1761
            LD E + ++ ++++A+D   P     + V I V+D+ND  P F  Q        E   + +I+    A D DS     + F+  S  +     +F +  K+G +  Q++LD+ET  ++  +V+ TD       T + V ++VL++NDN P   V    G   + V EN      +  +  TD D  +     F  I      L  +     +KF   L T   FD E    YQ   TIK +D G PP  S+ T  +++ D ++  P F     +  +  N  +G  + Q+ A D D+       F     +    ++ + TG I
Sbjct: 2365 LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVF-GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD---KGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRV---PGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLI-----DKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 13 Score: 79.7221 bits (195), Expect = 7.085e-15
Identity = 82/337 (24.33%), Postives = 137/337 (40.65%), Query Frame = 1
Query:  361 LDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEK-SGELILQKSLDYETKM--SYTFTVQVTDGKH---FTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDAD 1353
            L   ++ Y  E     R   R    S+ K +D     +  L +        +KPV +   I++ D+ND  P + +   +   Q  E  P+ +      A D D G +        S +  G    D +  +  +  +             LD E    + V + A D G PP+  ++ V I V D+ND+ P F+   P ++ + EN  +NS ++   A D DS     L F+ +  T     Q  FL +K SG L    + DYE      Y+ T++ TD  +    ++I + V V + ++  P  +   +       V  N++ G  +G V  TD D
Sbjct: 2335 LPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMA--QWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRA-------------LDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTG----QGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYK----FDVPGNAKIGDFVGQVTATDRD 2648          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 248.44 bits (633), Expect = 1.172e-67
Identity = 214/714 (29.97%), Postives = 344/714 (48.18%), Query Frame = 1
Query:  412 TKSRIDRESICKQV---DANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFK-NQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHI-GVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            T +RIDRE +C      DA    +I + +L +   R     +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   I    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + VTD+ND+ P F+ NQI ++I   EN+ I + +    A D D      + + F +       + F L   SG + +Q+ LD E    +  +V  +DG    +   V + V +VNDN P I ++   S   G +  +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E      F I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  L A DED+  NA   + L P++   F ++ +TG + +  +F+ E+  R+  +    D+      +    V + + D NDN+P+F  + + F + EN+   + +  +   DSD  E N AI  +     +  IL    GV +    F      DRE+  S+TF + AID+G P  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N+ + +F+++P TG++ ++      D+  HRL + + D G P    TL  
Sbjct:   88 TSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-----LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELI----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIP--ENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL-QAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGE-NAAISLSILNDNENFILDPFSGVIKSNVSF------DREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN-KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 91.2781 bits (225), Expect = 3.771e-18
Identity = 88/332 (26.51%), Postives = 154/332 (46.39%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITE--PNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKV 2526
            P+R  ++EN+ +G +   L          A+    +R   +       R+   TG+IF+        K+     F   E S +EI   V   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   I   D GSP  SS+A +Q+ V D+NDN P +     +   ++I  + P+G  V++ +A D D G N+E+ Y F T+  P + R +F L  T+G + V+R L   +   H+L++L  D  +     T+   V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECS-FEIEVVV---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRE---NQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKR-LFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINV 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 249.21 bits (635), Expect = 2.203e-67
Identity = 211/712 (29.63%), Postives = 342/712 (48.03%), Query Frame = 1
Query:  412 TKSRIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFK-NQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHI-GVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            T +RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   I    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + VTD+ND+ P F+ NQI ++I   EN+ I + +    A D D      + + F +       + F L   SG + +Q+ LD E    +  +V  +DG    +   V + V +VNDN P I ++   S   G +  +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E      F I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  L A DED+  NA   + L P++   F ++ +TG + +  +F+ E+  R+  +    D+      +    V + + D NDN+P+F  + + F + EN+   + +  +   DSD  E N AI  +     +  IL    GV +    F      DRE+  S+TF + AID+G P  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N+ + +F+++P TG++ ++      D+  HRL + + D G P    TL  
Sbjct:   88 TSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR---LIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELI----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIP--ENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL-QAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGE-NAAISLSILNDNENFILDPFSGVIKSNVSF------DREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN-KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 92.4337 bits (228), Expect = 2.162e-18
Identity = 89/335 (26.57%), Postives = 155/335 (46.27%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITE--PNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            P+R  ++EN+ +G +   L          A+    +R   +       R+   TG+IF+        K+     F   E S +EI   V   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   I   D GSP  SS+A +Q+ V D+NDN P +     +   ++I  + P+G  V++ +A D D G N+E+ Y F T+  P + R +F L  T+G + V+R L   +   H+L++L  D  +     T+   V  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECS-FEIEVVV---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRE---NQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKR-LFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDV 350          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 247.284 bits (630), Expect = 2.254e-67
Identity = 224/802 (27.93%), Postives = 364/802 (45.39%), Query Frame = 1
Query:  265 LYLV-EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTS--IYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKPIVELSPLSDEA---RNKFLLKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI------VQQIETYHGLSLFGKFEGD 2589
            LY V EE   N+++  L         + GH   L+    +  ++ K G +  T+  IDRE++  C+ +     C +   +      +   P +I+  I + DIND+ P +    +++T+ +PE++ + + F +P A D D   + V   Y ++   D    F L+V      + + G    LIVLG LDRE +  Y + I A+DGG P    +  + + VTD ND+SP+F++       + EN+ +   +    A+D D      + +S L    D V +   +   +G + ++  LD E   S +F V   D G    S   +V ++V + NDN+P + ++          +  +SE+   G  +  V V+D D+    + V C +  D P  +L P SD     + K+ L+T    D E +  Y++  I   D+G P   S+ + ++ + DVNDN+PVF          E    G  I  + A D D+  NA   + +  DS +   F I+  TG++ ++   + E   RYE      D      HK    V + + D NDN P+F    Y FS+ EN+   +P+  V   D D  E N  +  + +P   K ++      Q+G   + SS   DREK  S+TF + A+D G P  SS   + I V D NDN P    P  S          P  H V   EA+DLD G N++L + I   N    +F++ P++G + + + +T      HRL + V DRG P    T    + +      V  +E   G SL+   + D
Sbjct:   25 LYRVQEEQPPNTLIGSL--AADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPL--SVLTISVPENTIMGALFSIPLATDRDSERNGVA-DYALTAGPDAATLFGLQVA-----DDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHP-SYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYS-LHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAV-VTCVVAGDVPF-QLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRV-EIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADK-GSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGE-NAHVHLSVEPDGGKFVV------QNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSH-VDVVEAEDLDSGPNADLVFSIAGGNP-YQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRD 801          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 249.21 bits (635), Expect = 2.315e-67
Identity = 211/712 (29.63%), Postives = 342/712 (48.03%), Query Frame = 1
Query:  412 TKSRIDRESICKQVD-ANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNEL-SLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFK-NQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTS-IYVEVKVLNVNDNSPKISVQ---SFAGGELLTVSENSESGQHIGAVVVTDAD-DNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHI-GVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTF 2520
            T +RIDRE +C      + +C   + ++  P        +IK  I + D ND+AP +   + ++ + IPE++ INS F +P A D D GP++V K   I    +G+  F L ++      +  G +   LIV   LDRE++  Y + I   DGG P  S    + + VTD+ND+ P F+ NQI ++I   EN+ I + +    A D D      + + F +       + F L   SG + +Q+ LD E    +  +V  +DG    +   V + V +VNDN P I ++   S   G +  +SE       I  + V+D D D +G +  F   D P   L  + D   N++LL+T    D E      F I  SD+G+P  + +   R+ + D NDN P+F    +   + EN      +  L A DED+  NA   + L P++   F ++ +TG + +  +F+ E+  R+  +    D+      +    V + + D NDN+P+F  + + F + EN+   + +  +   DSD  E N AI  +     +  IL    GV +    F      DRE+  S+TF + AID+G P  SS+A + I V D+NDNTP  I+P  + +   +      G  V +  A D D G N+EL+Y I   N+ + +F+++P TG++ ++      D+  HRL + + D G P    TL  
Sbjct:   88 TSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR---LIKIKIIVKDTNDNAPMF--PSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELI----NGQSAFGLDIV-----ETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIP--ENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPF-HLKAVYD---NQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL-QAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGE-NAAISLSILNDNENFILDPFSGVIKSNVSF------DREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN-KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVL 768          

HSP 2 Score: 92.4337 bits (228), Expect = 1.880e-18
Identity = 89/335 (26.57%), Postives = 155/335 (46.27%), Query Frame = 1
Query: 1603 PMRATIKENMAVGTLIYQLKAQDEDTELNAN----FRFYLQPDSEVNFRIESETGKIFS--------KII----FNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN--VNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIF---VRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQY-FITE--PNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIV 2535
            P+R  ++EN+ +G +   L          A+    +R   +       R+   TG+IF+        K+     F   E S +EI   V   L   + ++  K+ + ++D NDN+P F   + + SI EN  +NS   I      D+  + ++K    N +      I++    T +G+ +   +    LDRE+  ++   I   D GSP  SS+A +Q+ V D+NDN P +     +   ++I  + P+G  V++ +A D D G N+E+ Y F T+  P + R +F L  T+G + V+R L   +   H+L++L  D  +     T+   V  V
Sbjct:   29 PIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECS-FEIEVVV---LPNDYFRLI-KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVE----TPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRE---NQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKR-LFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDV 350          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 249.21 bits (635), Expect = 2.567e-67
Identity = 224/802 (27.93%), Postives = 364/802 (45.39%), Query Frame = 1
Query:  265 LYLV-EECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFY-IEEKFGKL-RTKSRIDRESI--CKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTD-GKHFTS--IYVEVKVLNVNDNSPKISVQSFA----GGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSI--DKPIVELSPLSDEA---RNKFLLKTLKAFDRE-IGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVN--FRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSS-QLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNI------VQQIETYHGLSLFGKFEGD 2589
            LY V EE   N+++  L         + GH   L+    +  ++ K G +  T+  IDRE++  C+ +     C +   +      +   P +I+  I + DIND+ P +    +++T+ +PE++ + + F +P A D D   + V   Y ++   D    F L+V      + + G    LIVLG LDRE +  Y + I A+DGG P    +  + + VTD ND+SP+F++       + EN+ +   +    A+D D      + +S L    D V +   +   +G + ++  LD E   S +F V   D G    S   +V ++V + NDN+P + ++          +  +SE+   G  +  V V+D D+    + V C +  D P  +L P SD     + K+ L+T    D E +  Y++  I   D+G P   S+ + ++ + DVNDN+PVF          E    G  I  + A D D+  NA   + +  DS +   F I+  TG++ ++   + E   RYE      D      HK    V + + D NDN P+F    Y FS+ EN+   +P+  V   D D  E N  +  + +P   K ++      Q+G   + SS   DREK  S+TF + A+D G P  SS   + I V D NDN P    P  S          P  H V   EA+DLD G N++L + I   N    +F++ P++G + + + +T      HRL + V DRG P    T    + +      V  +E   G SL+   + D
Sbjct:  102 LYRVQEEQPPNTLIGSL--AADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPL--SVLTISVPENTIMGALFSIPLATDRDSERNGVA-DYALTAGPDAATLFGLQVA-----DDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPS-YEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYS-LHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAV-VTCVVAGDVPF-QLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRV-EIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADK-GSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGE-NAHVHLSVEPDGGKFVV------QNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSH-VDVVEAEDLDSGPNADLVFSIAGGNP-YQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRD 878          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000012836.1 (SMESG000012836.1)

HSP 1 Score: 2031.91 bits (5263), Expect = 0.000e+0
Identity = 1030/1049 (98.19%), Postives = 1032/1049 (98.38%), Query Frame = 1
Query:  229 MVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDXXXXXXXXXXXXXXXXXXXSAIWFLKCGFRPSLWCHSTPFNPREHLRPPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQLQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSPNCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQNNDEEEYQICISNRSTPKLPIIKVXXXXXXXXXXXXXXXLKDTDYTQLSNATTFRCDNESNLPMSYV 3375
            MVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSK GNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNI+VTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLK FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN             DSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKN SFTFYIIAIDNGSPTLSSSAYIQIEVKDINDN+PEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKCGFRPSLWCHSTPFNPREHL PPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQLQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSPNCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQNNDEEEYQICISNRSTPKLPIIKVSRSSSQNRNSSPNNNLKDTDYTQLSNATTFRCDNESNLPMSYV
Sbjct:    1 MVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKYGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIQVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKPFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN-------------DSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNSSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNSPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKCGFRPSLWCHSTPFNPREHLSPPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQLQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSPNCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQNNDEEEYQICISNRSTPKLPIIKVSRSSSQNRNSSPNNNLKDTDYTQLSNATTFRCDNESNLPMSYV 1036          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000012836.1 (SMESG000012836.1)

HSP 1 Score: 2014.19 bits (5217), Expect = 0.000e+0
Identity = 1022/1041 (98.17%), Postives = 1024/1041 (98.37%), Query Frame = 1
Query:  253 MSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDXXXXXXXXXXXXXXXXXXXSAIWFLKCGFRPSLWCHSTPFNPREHLRPPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQLQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSPNCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQNNDEEEYQICISNRSTPKLPIIKVXXXXXXXXXXXXXXXLKDTDYTQLSNATTFRCDNESNLPMSYV 3375
            MSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSK GNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNI+VTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLK FDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN             DSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKN SFTFYIIAIDNGSPTLSSSAYIQIEVKDINDN+PEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKCGFRPSLWCHSTPFNPREHL PPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQLQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSPNCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQNNDEEEYQICISNRSTPKLPIIKVSRSSSQNRNSSPNNNLKDTDYTQLSNATTFRCDNESNLPMSYV
Sbjct:    1 MSIELYLVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKYGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIQVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKPFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYEN-------------DSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNSSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNSPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKCGFRPSLWCHSTPFNPREHLSPPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQLQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSPNCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQNNDEEEYQICISNRSTPKLPIIKVSRSSSQNRNSSPNNNLKDTDYTQLSNATTFRCDNESNLPMSYV 1028          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 355.525 bits (911), Expect = 8.932e-104
Identity = 301/1003 (30.01%), Postives = 483/1003 (48.16%), Query Frame = 1
Query:  169 FVMTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDG----HFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDAN--PDCKI------ALFILYHPGKRT-TKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNK--DGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLT----------VSENSESGQHIGAVVVTDADDNSGLLP------VFCSIDKPIVELSPLSDEAR--NKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRA-------TIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYN---FK-------------------PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFIT-----------------EPNSGRDI-------FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQ-----------QIETYHGLSLFGKFEGDXXXXXXXXXXXXXXXXXXXSAIWFLKCGFRPSLW---------CHSTPFNPREHLRPPDGHSPSPSHEIIPVFMDRRHDSFISN-ITKTSCSEKM 2844
            + M V+++       +L  F  K I  ++ I   +VEE   NS++ +++N+        G    +++ +   + F+++ K  + R   R+DRE IC+    N   +C++      +  I    G+ + + P +I   + I+DIND++P W+  +  + L +PEHS I +   LP A+D D+ P N T+ Y IS     DG   F L+   +         +LSLIV    DREKQ+   V + A DG   PLSG+L +NI +TDIND  P FK +  I+  ++EN  + S I    A+D D SD + LRF F ++ ++ V   F++   +GE++    +DYE K  YT  V VTDGKH     + ++V NVNDN+P+ISV   +G    T          ++EN + G  + ++ V+D D  S  L       + C ID P  E   L  +++  + F L T K FDRE  S     + C D+      +S T  + I DVNDN P+F   P +        +IKE +A+GT I Q+KA D D   NA  ++ L   S   F I+  +G++ +  +F+ E+  ++E++   ++ +             K+ +NIED+ND  P F+KD+Y F++ E  +    + +V  KD DIS      +YN   FK                     +D S    IG T  G I V    LDREK  SF+F I A D     LSS+A +QI++ D+NDN P W+ P+     +N++Y   +G+ +   +A D D G N ++ Y I                  E     DI       F L+ +TG++Y+ + + + D+ + ++ +   D+G P  ++     +NIV            Q     GLS  G FE DL+I++VLV + +++ + ++  I  L+C     L          C S   +     R PDGHS SP ++I P +   +    IS  + +++ S +M
Sbjct:   11 YSMLVLIRFC----IWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPH--IYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG---FKLKHSGRDHYE-----KLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFK-KTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRID-PHRESLELRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISS-----KYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET--GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVG-FENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQM 988          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 355.525 bits (911), Expect = 9.837e-104
Identity = 301/1003 (30.01%), Postives = 483/1003 (48.16%), Query Frame = 1
Query:  169 FVMTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDG----HFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDAN--PDCKI------ALFILYHPGKRT-TKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNK--DGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLT----------VSENSESGQHIGAVVVTDADDNSGLLP------VFCSIDKPIVELSPLSDEAR--NKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRA-------TIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYN---FK-------------------PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFIT-----------------EPNSGRDI-------FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQ-----------QIETYHGLSLFGKFEGDXXXXXXXXXXXXXXXXXXXSAIWFLKCGFRPSLW---------CHSTPFNPREHLRPPDGHSPSPSHEIIPVFMDRRHDSFISN-ITKTSCSEKM 2844
            + M V+++       +L  F  K I  ++ I   +VEE   NS++ +++N+        G    +++ +   + F+++ K  + R   R+DRE IC+    N   +C++      +  I    G+ + + P +I   + I+DIND++P W+  +  + L +PEHS I +   LP A+D D+ P N T+ Y IS     DG   F L+   +         +LSLIV    DREKQ+   V + A DG   PLSG+L +NI +TDIND  P FK +  I+  ++EN  + S I    A+D D SD + LRF F ++ ++ V   F++   +GE++    +DYE K  YT  V VTDGKH     + ++V NVNDN+P+ISV   +G    T          ++EN + G  + ++ V+D D  S  L       + C ID P  E   L  +++  + F L T K FDRE  S     + C D+      +S T  + I DVNDN P+F   P +        +IKE +A+GT I Q+KA D D   NA  ++ L   S   F I+  +G++ +  +F+ E+  ++E++   ++ +             K+ +NIED+ND  P F+KD+Y F++ E  +    + +V  KD DIS      +YN   FK                     +D S    IG T  G I V    LDREK  SF+F I A D     LSS+A +QI++ D+NDN P W+ P+     +N++Y   +G+ +   +A D D G N ++ Y I                  E     DI       F L+ +TG++Y+ + + + D+ + ++ +   D+G P  ++     +NIV            Q     GLS  G FE DL+I++VLV + +++ + ++  I  L+C     L          C S   +     R PDGHS SP ++I P +   +    IS  + +++ S +M
Sbjct:   15 YSMLVLIRFC----IWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPH--IYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG---FKLKHSGRDHYE-----KLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFK-KTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRID-PHRESLELRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISS-----KYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET--GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVG-FENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQM 992          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 355.14 bits (910), Expect = 1.191e-103
Identity = 301/1003 (30.01%), Postives = 483/1003 (48.16%), Query Frame = 1
Query:  169 FVMTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRFHSNFNNDG----HFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDAN--PDCKI------ALFILYHPGKRT-TKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNK--DGEMKFDLRVIMKSSLNSKSGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLT----------VSENSESGQHIGAVVVTDADDNSGLLP------VFCSIDKPIVELSPLSDEAR--NKFLLKTLKAFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRA-------TIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRVEAKDSDISEINKAIRYN---FK-------------------PGTDKSILKHIGVTQDGKIFVRSSQLDREKNPSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFIT-----------------EPNSGRDI-------FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQ-----------QIETYHGLSLFGKFEGDXXXXXXXXXXXXXXXXXXXSAIWFLKCGFRPSLW---------CHSTPFNPREHLRPPDGHSPSPSHEIIPVFMDRRHDSFISN-ITKTSCSEKM 2844
            + M V+++       +L  F  K I  ++ I   +VEE   NS++ +++N+        G    +++ +   + F+++ K  + R   R+DRE IC+    N   +C++      +  I    G+ + + P +I   + I+DIND++P W+  +  + L +PEHS I +   LP A+D D+ P N T+ Y IS     DG   F L+   +         +LSLIV    DREKQ+   V + A DG   PLSG+L +NI +TDIND  P FK +  I+  ++EN  + S I    A+D D SD + LRF F ++ ++ V   F++   +GE++    +DYE K  YT  V VTDGKH     + ++V NVNDN+P+ISV   +G    T          ++EN + G  + ++ V+D D  S  L       + C ID P  E   L  +++  + F L T K FDRE  S     + C D+      +S T  + I DVNDN P+F   P +        +IKE +A+GT I Q+KA D D   NA  ++ L   S   F I+  +G++ +  +F+ E+  ++E++   ++ +             K+ +NIED+ND  P F+KD+Y F++ E  +    + +V  KD DIS      +YN   FK                     +D S    IG T  G I V    LDREK  SF+F I A D     LSS+A +QI++ D+NDN P W+ P+     +N++Y   +G+ +   +A D D G N ++ Y I                  E     DI       F L+ +TG++Y+ + + + D+ + ++ +   D+G P  ++     +NIV            Q     GLS  G FE DL+I++VLV + +++ + ++  I  L+C     L          C S   +     R PDGHS SP ++I P +   +    IS  + +++ S +M
Sbjct:   11 YSMLVLIRFC----IWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPH--IYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG---FKLKHSGRDHYE-----KLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFK-KTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRID-PHRESLELRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISS-----KYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET--GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVG-FENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQM 988          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11.270e-7128.89protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11.803e-7128.89protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11X5.445e-7029.40protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.521e-6929.40protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.790e-6929.40protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.292e-5328.36FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.180e-4229.80FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-33.758e-3626.60Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
hmr-14.734e-3426.05Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-14.734e-3426.05Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.223e-6428.79gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.223e-6428.79gene:FBgn0284247 transcript:FBtr0343249[more]
kug7.337e-5427.99gene:FBgn0261574 transcript:FBtr0346077[more]
kug7.337e-5427.99gene:FBgn0261574 transcript:FBtr0332721[more]
kug7.533e-5427.99gene:FBgn0261574 transcript:FBtr0332722[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.776e-7328.88protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.12.424e-7328.88pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh92.435e-7328.88protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh92.435e-7328.88protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
LO018022.11.400e-7229.31FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.100e-7226.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh172.025e-7226.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh172.614e-7226.88protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.039e-7226.88protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.525e-7226.88protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.108e-7028.63protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.108e-7028.63protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh93.035e-6628.65protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x1.719e-6529.06protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh91.791e-6528.65protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN6.101e-7128.89Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q6X862|PC11X_GORGO3.929e-6929.54Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6KEQ9|PC11X_PIG4.210e-6929.01Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q6WYY1|PC11X_PANPA6.431e-6929.40Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR6.971e-6929.40Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IPY57.348e-11232.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DUI63.914e-11031.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4S2M0G91.259e-10428.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KRD83.391e-10427.89Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN... [more]
A0A564YH373.465e-10429.87Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036470.13.065e-7428.52pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh92.550e-7028.71protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh93.533e-7028.71protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh112.122e-6829.51protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.527e-6729.37protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh113.877e-6028.24protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.11.112e-5626.31pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.11.408e-5627.67protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.11.632e-5028.69pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004042.12.972e-4424.34pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461895.309e-5926.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354125.887e-5728.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.334e-5330.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.084e-5225.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.467e-5227.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.172e-6729.97protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.203e-6729.63protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1a2.254e-6727.93protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh92.315e-6729.63protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1a2.567e-6727.93protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012836.10.000e+098.19SMESG000012836.1[more]
SMESG000012836.10.000e+098.17SMESG000012836.1[more]
SMESG000022791.18.932e-10430.01SMESG000022791.1[more]
SMESG000022791.19.837e-10430.01SMESG000022791.1[more]
SMESG000022791.11.191e-10330.01SMESG000022791.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018957 ID=SMED30018957|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=3468bp
CCGATCTATTTAATTGGCTGATTATTTTCAATCAATCAAATTCGATACTC
AGTAGAGATTTTATCCTTGTGGAAACTTCAATGTCAACTGGATTATGCGG
GGATAATTTTTCAATTAACGGAATTTTTGTGAATTTATTTTATATCTGTT
AAATTTTAATTCTGTAGATTTGTGATGACAGTGATGCTCAAGATTGTATA
TACCAGCATTACCTACTTGATCCTTTTCATGGTTAAAAGAATAACATCCG
AAATGTCCATCGAATTATATCTTGTAGAGGAATGTAGCAACAATTCAATT
GTTACAGACCTGAACAATCGTTTCCATTCAAACTTTAACAATGATGGGCA
TTTTAGGTTGCTTGATCAAAATAAATTATTTTATATCGAGGAAAAGTTTG
GAAAGTTACGAACGAAATCGAGAATCGACAGAGAATCTATTTGTAAACAA
GTCGACGCTAATCCCGACTGTAAAATCGCTTTATTTATTCTTTATCATCC
AGGGAAAAGAACGACAAAACCAGTGATGATAAAGTCTATAATTCACATTC
TTGACATTAATGACCACGCGCCTACTTGGAATAAGGTGAACAATCTAATG
ACTTTGCAAATTCCAGAACATTCTCCTATCAATTCTGCTTTTCGGTTACC
GGAAGCTGTAGATTTAGATCGTGGCCCAGATAACGTTACTAAATCATATA
CGATTTCCAAAAACAAAGATGGAGAGATGAAGTTTGATTTACGCGTCATA
ATGAAGAGTTCGCTGAATTCCAAATCTGGAAATGAATTGAGTTTAATAGT
ATTGGGAATTCTTGATCGAGAAAAGCAGTCTCAGTATCAAGTTCTAATAA
CGGCCATGGATGGAGGCGTTCCACCATTGTCAGGAGAACTGAGAGTGAAC
ATTGAAGTGACAGATATTAATGATCATTCTCCACGATTTAAAAACCAAAT
TCCAATTAACATCTCTTTGCATGAAAACACAGCAATTAATAGTATCATAT
TTGTCTTCGTGGCGGAAGACATTGACTCAAGTGATGCCAATAACCTACGA
TTTTCGTTTCTCAGCACGACTGAAGATGAAGTGACTCAGACGTTTTTTCT
GAAAGAAAAATCTGGTGAATTAATTTTGCAGAAGTCATTGGATTATGAAA
CGAAAATGTCTTATACATTTACAGTTCAGGTAACTGATGGAAAGCATTTT
ACTTCAATTTATGTGGAAGTGAAAGTGTTGAATGTCAATGATAACTCTCC
AAAGATTTCTGTGCAATCTTTTGCTGGAGGTGAGCTACTAACTGTATCAG
AAAACTCAGAAAGTGGTCAACATATTGGAGCGGTAGTGGTTACGGATGCT
GACGACAATTCTGGTTTACTGCCGGTGTTTTGCTCAATTGATAAACCTAT
TGTTGAGTTAAGTCCGCTTTCTGATGAAGCTAGGAATAAGTTTCTTTTAA
AAACTTTAAAAGCTTTTGATAGAGAAATTGGAAGTTATCAAATCTTTACA
ATTAAATGCTCTGATACTGGAGAACCGCCTAAACACAGTTCATATACTAG
TAGATTGCACATATTAGATGTAAATGATAATGCGCCTGTTTTTTTGAATG
AACCAATGAGAGCTACTATAAAAGAAAATATGGCAGTCGGAACCCTTATT
TACCAATTGAAAGCCCAAGACGAAGATACGGAATTGAACGCAAATTTTCG
GTTTTATTTGCAACCTGATTCTGAGGTAAACTTTAGAATTGAATCGGAAA
CGGGAAAAATCTTTTCTAAAATTATTTTTAATGCCGAAGAGAGTTCCAGA
TATGAAATTTCAGCTTACGTTACAGATTCACTAGAAGGGACATTTCATAA
GGTTTTCGGAAAGGTCGATCTTAATATTGAAGATATGAATGACAATTCTC
CAAGATTTGACAAGGATATTTATCATTTCAGCATATATGAGAATGTGAAT
TCAGGAACCCCAATTGATAGAGTTGAAGCAAAGGATAGCGATATTTCTGA
AATTAATAAAGCCATTAGGTACAACTTTAAACCAGGCACCGATAAAAGCA
TTTTAAAGCACATCGGAGTCACTCAAGATGGTAAAATATTTGTCCGAAGT
TCCCAGCTTGATAGAGAAAAGAATCCTTCATTCACATTTTATATAATTGC
AATAGATAATGGAAGTCCAACTTTATCTTCTTCGGCATACATTCAAATCG
AAGTTAAAGACATCAATGATAATACCCCAGAATGGATTCATCCAGATCCT
TCATTAAATCACATTAATATAACATATCATGTACCTGTAGGTCATGAAGT
CATCAAATTCGAAGCGAAAGATCTAGATCAAGGATCTAATAGTGAATTGC
AGTATTTCATTACAGAACCAAATTCTGGTCGAGATATCTTTCAATTAGAG
CCTACAACTGGATCTTTATATGTCAAGCGAACTTTAACCGTTCATGATCT
AAGAACTCATAGGTTAAACATTCTGGTGAAAGACCGTGGAAATCCTTCTC
TCGAAAGAACTCTCACGTTTAAAGTTAACATTGTTCAACAGATTGAAACA
TATCACGGTCTCTCACTGTTTGGAAAATTCGAAGGAGACTTGTTGATTAT
TCTAGTATTAGTTATTGTGACTTTAATCATATGCTTGGGATTAATTTCTG
CTATATGGTTTTTAAAATGCGGATTCCGTCCTTCACTTTGGTGTCATAGT
ACCCCATTCAATCCTCGAGAACATCTTCGTCCTCCTGATGGCCATTCACC
ATCGCCAAGTCATGAAATAATCCCTGTATTTATGGACCGGCGTCACGATT
CATTTATCAGTAATATTACTAAAACAAGTTGTTCAGAAAAAATGAAAATC
ACTGACTCAGAAAGAGAGTCCCAACTGCAATCCTCTAAGTCCCAATTTCA
TTATTTGAATAACAGCAAGACCATCAACAACTACCAATGTCTACAACAGA
TGAAAGATTGTGATCGATCATTGTTGAATCAAAACATTTATAATTACAAC
ACCTCAACTCTCAGATGCAGTCCAAACTGTTTGGCCAATTCGTTGAGTCC
CTCGACCTCTTCGGACAATCAAACGAATACGATTTGTAAGTCTCATACGT
TATCCAAGGATTTCTGTGTACCTTCCTCGTCGAATTCCCAGCTGTCTGTG
AGATGGCTCGACAAACAATGTCAAAACAACGATGAAGAGGAATATCAAAT
TTGCATTTCGAACAGATCTACACCGAAGTTGCCGATTATCAAAGTCAGTC
GGTCTTCAAGCCAGAACCGAAATTCCTCACCAAACAACAACCTGAAAGAC
ACCGATTATACTCAGTTGTCGAACGCCACCACGTTTCGGTGCGACAACGA
ATCCAATTTGCCAATGTCGTACGTATGAAAAAAAAAGTTGAAAAGAAAAT
TTTGAAAAGAAAATAAAATGGCAAAATTTGATTTATTCAACAGATTCAAT
AGTTTTAATCATTCTCAG
back to top

protein sequence of SMED30018957-orf-1

>SMED30018957-orf-1 ID=SMED30018957-orf-1|Name=SMED30018957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1068bp
MTVMLKIVYTSITYLILFMVKRITSEMSIELYLVEECSNNSIVTDLNNRF
HSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCK
IALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHS
PINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSK
SGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIEVTDIND
HSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTE
DEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVK
VLNVNDNSPKISVQSFAGGELLTVSENSESGQHIGAVVVTDADDNSGLLP
VFCSIDKPIVELSPLSDEARNKFLLKTLKAFDREIGSYQIFTIKCSDTGE
PPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDE
DTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVT
DSLEGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYENVNSGTPIDRV
EAKDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKN
PSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNTPEWIHPDPSLNHINIT
YHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYV
KRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFG
KFEGDLLIILVLVIVTLIICLGLISAIWFLKCGFRPSLWCHSTPFNPREH
LRPPDGHSPSPSHEIIPVFMDRRHDSFISNITKTSCSEKMKITDSERESQ
LQSSKSQFHYLNNSKTINNYQCLQQMKDCDRSLLNQNIYNYNTSTLRCSP
NCLANSLSPSTSSDNQTNTICKSHTLSKDFCVPSSSNSQLSVRWLDKQCQ
NNDEEEYQICISNRSTPKLPIIKVSRSSSQNRNSSPNNNLKDTDYTQLSN
ATTFRCDNESNLPMSYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion