tubulin polyglutamylase TTLL4-like

Overview
Nametubulin polyglutamylase TTLL4-like
Smed IDSMED30018939
Length (bp)3829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tubulin polyglutamylase TTLL4-like (SMED30018939) t-SNE clustered cells

Violin plots show distribution of expression levels for tubulin polyglutamylase TTLL4-like (SMED30018939) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tubulin polyglutamylase TTLL4-like (SMED30018939) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tubulin polyglutamylase TTLL4-like (SMED30018939) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018939

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018939SMESG000056158.1 dd_Smed_v4_17034_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018939SMESG000056158.1 Contig49998newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018939SMESG000056158.1 Contig49998uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30018939SMESG000056158.1 Contig49998newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018939SMESG000056158.1 Contig49998uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018939SMESG000056158.1 Contig6190newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018939SMESG000056158.1 Contig6190uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Human
Match: TTLL4 (tubulin tyrosine ligase like 4 [Source:HGNC Symbol;Acc:HGNC:28976])

HSP 1 Score: 539.265 bits (1388), Expect = 1.337e-172
Identity = 275/550 (50.00%), Postives = 373/550 (67.82%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            LI+S F NVPP I F    E++E LP++ RK LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQ+F LP D +L ++ WES  S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++GVN+D +W +IKD+VVKT+IS+E  +++ + +Y +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS SPLDI IKG MI+D+ N+ G+VLP   D+    +    S  + T        D+     E  T +  K  ++++           P  +    +LD LTP DVR LV+  DE+ RRG FER++P    + S RYL +FE+  Y N+L T +  KY  N  +G  LL + C K  H+     G   DS  VW +P S
Sbjct:  410 LIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESS-SRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDI----ISSPSSCSSSTTSLPTSPGDKCRMAPEHVTAQKMKKAYYLTQKI--------PDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS---HISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRSWCYKGFHM-----GVVSDSAPVWSLPTS 927          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Human
Match: TTLL4 (tubulin tyrosine ligase like 4 [Source:HGNC Symbol;Acc:HGNC:28976])

HSP 1 Score: 541.191 bits (1393), Expect = 7.031e-171
Identity = 275/550 (50.00%), Postives = 373/550 (67.82%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            LI+S F NVPP I F    E++E LP++ RK LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQ+F LP D +L ++ WES  S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++GVN+D +W +IKD+VVKT+IS+E  +++ + +Y +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS SPLDI IKG MI+D+ N+ G+VLP   D+    +    S  + T        D+     E  T +  K  ++++           P  +    +LD LTP DVR LV+  DE+ RRG FER++P    + S RYL +FE+  Y N+L T +  KY  N  +G  LL + C K  H+     G   DS  VW +P S
Sbjct:  575 LIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESS-SRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDI----ISSPSSCSSSTTSLPTSPGDKCRMAPEHVTAQKMKKAYYLTQKI--------PDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS---HISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRSWCYKGFHM-----GVVSDSAPVWSLPTS 1092          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Human
Match: TTLL4 (tubulin tyrosine ligase like 4 [Source:HGNC Symbol;Acc:HGNC:28976])

HSP 1 Score: 541.191 bits (1393), Expect = 7.031e-171
Identity = 275/550 (50.00%), Postives = 373/550 (67.82%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            LI+S F NVPP I F    E++E LP++ RK LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQ+F LP D +L ++ WES  S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++GVN+D +W +IKD+VVKT+IS+E  +++ + +Y +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS SPLDI IKG MI+D+ N+ G+VLP   D+    +    S  + T        D+     E  T +  K  ++++           P  +    +LD LTP DVR LV+  DE+ RRG FER++P    + S RYL +FE+  Y N+L T +  KY  N  +G  LL + C K  H+     G   DS  VW +P S
Sbjct:  575 LIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESS-SRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDI----ISSPSSCSSSTTSLPTSPGDKCRMAPEHVTAQKMKKAYYLTQKI--------PDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS---HISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRSWCYKGFHM-----GVVSDSAPVWSLPTS 1092          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Human
Match: TTLL4 (tubulin tyrosine ligase like 4 [Source:HGNC Symbol;Acc:HGNC:28976])

HSP 1 Score: 361.303 bits (926), Expect = 3.161e-105
Identity = 188/390 (48.21%), Postives = 263/390 (67.44%), Query Frame = 3
Query: 2322 PASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            PASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++GVN+D +W +IKD+VVKT+IS+E  +++ + +Y +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS SPLDI IKG MI+D+ N+ G+VLP   D+    +    S  + T        D+     E  T +  K  ++++           P  +    +LD LTP DVR LV+  DE+ RRG FER++P    + S RYL +FE+  Y N+L T +  KY  N  +G  LL + C K  H+     G   DS  VW +P S
Sbjct:  659 PASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDI----ISSPSSCSSSTTSLPTSPGDKCRMAPEHVTAQKMKKAYYLTQKI--------PDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS---HISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRSWCYKGFHM-----GVVSDSAPVWSLPTS 1028          

HSP 2 Score: 92.8189 bits (229), Expect = 2.655e-18
Identity = 47/95 (49.47%), Postives = 61/95 (64.21%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQK 2126
            LI+S F NVPP I F    E++E LP++ RK LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK
Sbjct:  575 LIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPSFRSIREHQK 658          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Human
Match: TTLL5 (tubulin tyrosine ligase like 5 [Source:HGNC Symbol;Acc:HGNC:19963])

HSP 1 Score: 304.679 bits (779), Expect = 6.933e-85
Identity = 168/444 (37.84%), Postives = 263/444 (59.23%), Query Frame = 3
Query: 2034 DLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKS-PENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFL 3359
            ++  + T+  +++ G H+K  + +++ + QKVNHFP S++L RKDRL++NI RMQ   G   F  +PQTF LP +   F  C      +  WI+KP AS+RG GV ++   NQI     I+V +YI+NP LI+D KFD+RLYV +T  +PL +YLY++GL RFA+ +Y    K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++  Y+K+ G +T  +   ++DL++KT+ISAE AI+ +   +     S  EL+GFDV++D  LKPW+LEVN+SPSL  D+PLD+ IK  MI DMF + G+V  +P+        RA + P   T  SS     ++     P +   ++MK+ V  A      R      L   +L  L+  +++ L +  +E +RRG F R++P       + Y SY E    +N ++ + L
Sbjct:   88 EVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEF--CNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQ-------RASTRPIYPTFESSRRNPFQKPQRCRPLSASDAEMKNLVGSA------REKGPGKLGGSVLG-LSMEEIKVLRRVKEENDRRGGFIRIFPTS--ETWEIYGSYLEHKTSMNYMLATRL 513          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 343.199 bits (879), Expect = 3.429e-104
Identity = 196/525 (37.33%), Postives = 295/525 (56.19%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKG-HKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSF-LTKYSRNNQGTRLLENLCQKK 3419
            S+F++VPP I F  +G K+     +++  L W  + L P++++QT+  S F           +DE+    ++ Y+G+H+K   +++++ +QKVNHFPG+F +GRKDRLW +I R QQE    EFD +P T+ LPTD +   +  E+  S+H  I+KPPASARG G+ V  K    P    +V Q YI  P  IN +KFDLRLY ++    PL+VY+YD GLVRFAS  YS+S+ T+ N+Y+HLTNYSINK     L   D  A K   KW+L  LW +  + GV+ + +   I+++++K  IS E+ I   ++ + +  +   ELFG D+ILDE+ KPW+LEVN+SPSLHS +PLD+ +K  + KD+ N+ G  +P PS  + +    +  P N    + +  I    W        ++  K  + V  N              +I   LTP D R LV+  DE ER G F+ V+P      +  Y  YF    Y+N+L+  + + +    + G   LE LC++K
Sbjct:  112 SQFTDVPPTIRFYTKGTKVTKPARKIQARLTWCHNSLLPIVMRQTLAASHFTV---------VDESLF--YVGYWGRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHI-RKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVP-PSFDKLSDADYSTRPRN-GRKNREQLIKEASW--------VAAYKDQLGVIDN--------------RIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAH---TSHYQKYFAETIYMNILLQQWQIAQEDDRSIGINRLEQLCRQK 591          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 341.658 bits (875), Expect = 4.210e-104
Identity = 196/525 (37.33%), Postives = 295/525 (56.19%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKG-HKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSF-LTKYSRNNQGTRLLENLCQKK 3419
            S+F++VPP I F  +G K+     +++  L W  + L P++++QT+  S F           +DE+    ++ Y+G+H+K   +++++ +QKVNHFPG+F +GRKDRLW +I R QQE    EFD +P T+ LPTD +   +  E+  S+H  I+KPPASARG G+ V  K    P    +V Q YI  P  IN +KFDLRLY ++    PL+VY+YD GLVRFAS  YS+S+ T+ N+Y+HLTNYSINK     L   D  A K   KW+L  LW +  + GV+ + +   I+++++K  IS E+ I   ++ + +  +   ELFG D+ILDE+ KPW+LEVN+SPSLHS +PLD+ +K  + KD+ N+ G  +P PS  + +    +  P N    + +  I    W        ++  K  + V  N              +I   LTP D R LV+  DE ER G F+ V+P      +  Y  YF    Y+N+L+  + + +    + G   LE LC++K
Sbjct:   74 SQFTDVPPTIRFYTKGTKVTKPARKIQARLTWCHNSLLPIVMRQTLAASHFTV---------VDESLF--YVGYWGRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHI-RKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVP-PSFDKLSDADYSTRPRN-GRKNREQLIKEASW--------VAAYKDQLGVIDN--------------RIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAH---TSHYQKYFAETIYMNILLQQWQIAQEDDRSIGINRLEQLCRQK 553          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 341.658 bits (875), Expect = 4.210e-104
Identity = 196/525 (37.33%), Postives = 295/525 (56.19%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKG-HKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSF-LTKYSRNNQGTRLLENLCQKK 3419
            S+F++VPP I F  +G K+     +++  L W  + L P++++QT+  S F           +DE+    ++ Y+G+H+K   +++++ +QKVNHFPG+F +GRKDRLW +I R QQE    EFD +P T+ LPTD +   +  E+  S+H  I+KPPASARG G+ V  K    P    +V Q YI  P  IN +KFDLRLY ++    PL+VY+YD GLVRFAS  YS+S+ T+ N+Y+HLTNYSINK     L   D  A K   KW+L  LW +  + GV+ + +   I+++++K  IS E+ I   ++ + +  +   ELFG D+ILDE+ KPW+LEVN+SPSLHS +PLD+ +K  + KD+ N+ G  +P PS  + +    +  P N    + +  I    W        ++  K  + V  N              +I   LTP D R LV+  DE ER G F+ V+P      +  Y  YF    Y+N+L+  + + +    + G   LE LC++K
Sbjct:   74 SQFTDVPPTIRFYTKGTKVTKPARKIQARLTWCHNSLLPIVMRQTLAASHFTV---------VDESLF--YVGYWGRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHI-RKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVP-PSFDKLSDADYSTRPRN-GRKNREQLIKEASW--------VAAYKDQLGVIDN--------------RIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAH---TSHYQKYFAETIYMNILLQQWQIAQEDDRSIGINRLEQLCRQK 553          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 226.868 bits (577), Expect = 2.238e-62
Identity = 124/349 (35.53%), Postives = 199/349 (57.02%), Query Frame = 3
Query: 2064 ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTD--------LELFKQCWESGGS---KHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTL-HNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEP---SDVEPATLGRAKSPENFTLPSSDLFID 3062
            +++ G  +K    + +  +Q++N FP S +L +KDRL+ NI R +   G   FDFIP+ +  P +        + + K+   +GG      ++I+KP  S +G G+        IP   P++V +Y+ +PYL+N+ KFDLR+YV +T   PL  Y+Y +GL R AS  Y  S  +   N YVHLTNYSINK +  ++ N    +   GHKW+L +L  Y++  G +   +  RI+DL+VK+++S + +++ +     +   +  ELFGFDV++D+ LKPW+LEVN+SPSL  D+PLD ++K  +I D+ N+    L +      V PA      S E+ +  + DL +D
Sbjct:  103 VIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFG-ESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRKIIDSVTPALRKSMNSQESESSETDDLELD 450          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 226.868 bits (577), Expect = 5.881e-62
Identity = 124/349 (35.53%), Postives = 199/349 (57.02%), Query Frame = 3
Query: 2064 ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTD--------LELFKQCWESGGS---KHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTL-HNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEP---SDVEPATLGRAKSPENFTLPSSDLFID 3062
            +++ G  +K    + +  +Q++N FP S +L +KDRL+ NI R +   G   FDFIP+ +  P +        + + K+   +GG      ++I+KP  S +G G+        IP   P++V +Y+ +PYL+N+ KFDLR+YV +T   PL  Y+Y +GL R AS  Y  S  +   N YVHLTNYSINK +  ++ N    +   GHKW+L +L  Y++  G +   +  RI+DL+VK+++S + +++ +     +   +  ELFGFDV++D+ LKPW+LEVN+SPSL  D+PLD ++K  +I D+ N+    L +      V PA      S E+ +  + DL +D
Sbjct:  156 VIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFG-ESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRKIIDSVTPALRKSMNSQESESSETDDLELD 503          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Fly
Match: TTLL4B (gene:FBgn0031574 transcript:FBtr0077501)

HSP 1 Score: 447.973 bits (1151), Expect = 1.951e-138
Identity = 230/530 (43.40%), Postives = 324/530 (61.13%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSK-HKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSP--ENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNNQ-GTRLLENLCQKKLHL 3428
            S F +VPP +NF    +K  P+P  L + L+W+ S + P IVK+ +  SGF+  +            T DW+  + KHMK P F++IR +QK NH PGSF++GRKD +WR+IY   ++ G  EF F+ +++ +P DLE  +Q W    SK  KWI+KPPASARG G+++V KW+Q PK RP+VVQKYI  P LIND+KFD+RLYV +T INPL++Y+Y DGL RFAS KYS+ +  L  R +HLTNYSINK +  Y  N D  AC+GHKW+L+SLW+ ++ RGVNT  +W  +++LV+K ++S E  ++          Y+  ELFGFDV+LDENL PW+LE+N+SPSLHS+ PLD+ +KG +I+ + N   Y +P      P    R ++   E   L +  L  D+R +    + +E+ K   + +      EFR +  D     ILD L P DVRCL+   DE  R    ER++P    +    YL Y E   Y N L+ ++ TKY++N + G  LL   C+ K HL
Sbjct:  428 SLFPHVPPYLNFTSHADKGPPMPAALHRVLKWKLSPVMPKIVKRVVLNSGFRIIK-----------NTTDWMAVWEKHMKSPGFRTIRSHQKYNHIPGSFRIGRKDTMWRSIYNNMKKFGKKEFGFMQKSYIMPDDLESLRQVWPKNASKLTKWIVKPPASARGTGIRIVNKWSQFPKDRPLVVQKYIERPLLINDNKFDMRLYVVLTSINPLRIYMYKDGLARFASVKYSSELSNLDERCMHLTNYSINKFSQNYAKNEDFNACQGHKWTLQSLWSCLENRGVNTKRLWATLRNLVIKGIVSGESGLNRMYRQNVNFRYNCFELFGFDVLLDENLVPWLLEINISPSLHSELPLDLHVKGPLIQAVLNTALYQVP------PKLNERQQADILEELNL-TGPLCHDKRIFTTCLTAEEVRKHNQYTN---RSIEFREEYVDT----ILDNLLPDDVRCLIVAEDELARCQPLERIFPTAGTHV---YLRYVENARYYNRLLDAWETKYAKNREMGIALLSRYCRDKYHL 929          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Fly
Match: TTLL4B (gene:FBgn0031574 transcript:FBtr0334832)

HSP 1 Score: 447.973 bits (1151), Expect = 1.951e-138
Identity = 230/530 (43.40%), Postives = 324/530 (61.13%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSK-HKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSP--ENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNNQ-GTRLLENLCQKKLHL 3428
            S F +VPP +NF    +K  P+P  L + L+W+ S + P IVK+ +  SGF+  +            T DW+  + KHMK P F++IR +QK NH PGSF++GRKD +WR+IY   ++ G  EF F+ +++ +P DLE  +Q W    SK  KWI+KPPASARG G+++V KW+Q PK RP+VVQKYI  P LIND+KFD+RLYV +T INPL++Y+Y DGL RFAS KYS+ +  L  R +HLTNYSINK +  Y  N D  AC+GHKW+L+SLW+ ++ RGVNT  +W  +++LV+K ++S E  ++          Y+  ELFGFDV+LDENL PW+LE+N+SPSLHS+ PLD+ +KG +I+ + N   Y +P      P    R ++   E   L +  L  D+R +    + +E+ K   + +      EFR +  D     ILD L P DVRCL+   DE  R    ER++P    +    YL Y E   Y N L+ ++ TKY++N + G  LL   C+ K HL
Sbjct:  428 SLFPHVPPYLNFTSHADKGPPMPAALHRVLKWKLSPVMPKIVKRVVLNSGFRIIK-----------NTTDWMAVWEKHMKSPGFRTIRSHQKYNHIPGSFRIGRKDTMWRSIYNNMKKFGKKEFGFMQKSYIMPDDLESLRQVWPKNASKLTKWIVKPPASARGTGIRIVNKWSQFPKDRPLVVQKYIERPLLINDNKFDMRLYVVLTSINPLRIYMYKDGLARFASVKYSSELSNLDERCMHLTNYSINKFSQNYAKNEDFNACQGHKWTLQSLWSCLENRGVNTKRLWATLRNLVIKGIVSGESGLNRMYRQNVNFRYNCFELFGFDVLLDENLVPWLLEINISPSLHSELPLDLHVKGPLIQAVLNTALYQVP------PKLNERQQADILEELNL-TGPLCHDKRIFTTCLTAEEVRKHNQYTN---RSIEFREEYVDT----ILDNLLPDDVRCLIVAEDELARCQPLERIFPTAGTHV---YLRYVENARYYNRLLDAWETKYAKNREMGIALLSRYCRDKYHL 929          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Fly
Match: TTLL4B (gene:FBgn0031574 transcript:FBtr0077502)

HSP 1 Score: 447.588 bits (1150), Expect = 2.846e-138
Identity = 230/530 (43.40%), Postives = 324/530 (61.13%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSK-HKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSP--ENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNNQ-GTRLLENLCQKKLHL 3428
            S F +VPP +NF    +K  P+P  L + L+W+ S + P IVK+ +  SGF+  +            T DW+  + KHMK P F++IR +QK NH PGSF++GRKD +WR+IY   ++ G  EF F+ +++ +P DLE  +Q W    SK  KWI+KPPASARG G+++V KW+Q PK RP+VVQKYI  P LIND+KFD+RLYV +T INPL++Y+Y DGL RFAS KYS+ +  L  R +HLTNYSINK +  Y  N D  AC+GHKW+L+SLW+ ++ RGVNT  +W  +++LV+K ++S E  ++          Y+  ELFGFDV+LDENL PW+LE+N+SPSLHS+ PLD+ +KG +I+ + N   Y +P      P    R ++   E   L +  L  D+R +    + +E+ K   + +      EFR +  D     ILD L P DVRCL+   DE  R    ER++P    +    YL Y E   Y N L+ ++ TKY++N + G  LL   C+ K HL
Sbjct:  428 SLFPHVPPYLNFTSHADKGPPMPAALHRVLKWKLSPVMPKIVKRVVLNSGFRIIK-----------NTTDWMAVWEKHMKSPGFRTIRSHQKYNHIPGSFRIGRKDTMWRSIYNNMKKFGKKEFGFMQKSYIMPDDLESLRQVWPKNASKLTKWIVKPPASARGTGIRIVNKWSQFPKDRPLVVQKYIERPLLINDNKFDMRLYVVLTSINPLRIYMYKDGLARFASVKYSSELSNLDERCMHLTNYSINKFSQNYAKNEDFNACQGHKWTLQSLWSCLENRGVNTKRLWATLRNLVIKGIVSGESGLNRMYRQNVNFRYNCFELFGFDVLLDENLVPWLLEINISPSLHSELPLDLHVKGPLIQAVLNTALYQVP------PKLNERQQADILEELNL-TGPLCHDKRIFTTCLTAEEVRKHNQYTN---RSIEFREEYVDT----ILDNLLPDDVRCLIVAEDELARCQPLERIFPTAGTHV---YLRYVENARYYNRLLDAWETKYAKNREMGIALLSRYCRDKYHL 929          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0304950)

HSP 1 Score: 435.261 bits (1118), Expect = 1.959e-135
Identity = 223/531 (42.00%), Postives = 328/531 (61.77%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKH-KWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHL 3428
            L+ S F  VPP ++F    ++   +P  L + L+WR + + P +V+  +  SG +  +           +TNDW+  +GKH+K P FK+IR YQK+NH PGSF++GRKD  W+N+ R   +  + EF F+P+T+ +P DL   ++ W     ++ KWIIKPPASARG G++V+ +W QIPKRRP++VQKYI  P LIN SKFDLRLYV +T +NPL+V++Y +GL RFAS KYS    TL++R +HLTNYSINK +  Y  N D  AC GHKW++KSLW Y+  RGV TD +W  ++ LV++T+++ E  I++ +    +S YS  ELFGFDVILD +L PW+LEVN+SPSLHS+ PLD  +K  +++ + N   Y +P    ++     +  + E    P + +  D+R ++   S +E  K+KH  +      E R +  D     IL+ LTP DVRCL+   DE  R    ER++P    + + +YL Y +   Y N L+ ++ ++Y+ N  +G  LL + CQ K HL
Sbjct:  292 LVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLK-----------KTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQ---KELAAEFSFPPGTQMCYDKRLYINYLSREE--KIKHN-TFTRKSMEDRNEYVD----AILNNLTPDDVRCLIIAEDELARCAPLERIFPT---DQTHKYLKYNDTPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHL 798          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0304952)

HSP 1 Score: 435.261 bits (1118), Expect = 1.959e-135
Identity = 223/531 (42.00%), Postives = 328/531 (61.77%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKH-KWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHL 3428
            L+ S F  VPP ++F    ++   +P  L + L+WR + + P +V+  +  SG +  +           +TNDW+  +GKH+K P FK+IR YQK+NH PGSF++GRKD  W+N+ R   +  + EF F+P+T+ +P DL   ++ W     ++ KWIIKPPASARG G++V+ +W QIPKRRP++VQKYI  P LIN SKFDLRLYV +T +NPL+V++Y +GL RFAS KYS    TL++R +HLTNYSINK +  Y  N D  AC GHKW++KSLW Y+  RGV TD +W  ++ LV++T+++ E  I++ +    +S YS  ELFGFDVILD +L PW+LEVN+SPSLHS+ PLD  +K  +++ + N   Y +P    ++     +  + E    P + +  D+R ++   S +E  K+KH  +      E R +  D     IL+ LTP DVRCL+   DE  R    ER++P    + + +YL Y +   Y N L+ ++ ++Y+ N  +G  LL + CQ K HL
Sbjct:  292 LVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLK-----------KTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQ---KELAAEFSFPPGTQMCYDKRLYINYLSREE--KIKHN-TFTRKSMEDRNEYVD----AILNNLTPDDVRCLIIAEDELARCAPLERIFPT---DQTHKYLKYNDTPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHL 798          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 531.176 bits (1367), Expect = 4.930e-175
Identity = 257/545 (47.16%), Postives = 378/545 (69.36%), Query Frame = 3
Query: 1866 VPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY--SRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNSSG 3494
            +P  + F    E++E LP +  K L+W+ + +TP +VK TI RS FK ++           +++DW+  +G HMK P FK+IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L ++ W+ GGSK KWI+KPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL++Y+++DGLVRFAS KYS+S+KTL+N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  +G+NT  +W +IKD+V+KT+I+++  +++ V ++ +S YS  ELFGFD++LDENLKPW+LEVN+SPSLHS++PLD+ IKG MI+D+ N+ G+VLP   D  P+    + S  +           R  W  + S DE  K   ++S        RF   D     +LD LTP DVR L +  DE  R+G FERV+P    +AS RYL +FE+  YLN+L+  +  KY  SR ++G  LL +LC+K++HL     G+  +S H W   +  G
Sbjct:    1 MPSTLYFSTANERVELLPAEQMKLLKWKITTVTPNVVKNTIFRSHFKATK-----------KSHDWLGCWGHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSDDKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLPLRDDFAPSGSSASSSTSSLCGGV------REKWRPDISPDEKVKRAFYLSQ-------RFGDQD-FCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPS---HASSRYLRFFEQPRYLNILLNQWEQKYWLSR-SKGINLLRDLCEKRVHL-----GNLAESVHHWSSKSYHG 511          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 538.11 bits (1385), Expect = 1.036e-173
Identity = 263/562 (46.80%), Postives = 387/562 (68.86%), Query Frame = 3
Query: 1794 DLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY--SRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            DL+E +A         L+ S F ++P  + F    E++E LP +  K L+W+ + +TP +VK TI RS FK ++           +++DW+  +G HMK P FK+IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L ++ W+ GGSK KWI+KPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL++Y+++DGLVRFAS KYS+S+KTL+N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  +G+NT  +W +IKD+V+KT+I+++  +++ V ++ +S YS  ELFGFD++LDENLKPW+LEVN+SPSLHS++PLD+ IKG MI+D+ N+ G+VLP   D  P+    + S  +           R  W  + S DE  K   ++S        RF   D     +LD LTP DVR L +  DE  R+G FERV+P    +AS RYL +FE+  YLN+L+  +  KY  SR ++G  LL +LC+K++HL     G+  +S H W
Sbjct:  280 DLVERSA---------LVPSLFPHMPSTLYFSTANERVELLPAEQMKLLKWKITTVTPNVVKNTIFRSHFKATK-----------KSHDWLGCWGHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSDDKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLPLRDDFAPSGSSASSSTSSLCGGV------REKWRPDISPDEKVKRAFYLSQ-------RFGDQD-FCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPS---HASSRYLRFFEQPRYLNILLNQWEQKYWLSR-SKGINLLRDLCEKRVHL-----GNLAESVHHW 798          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 539.65 bits (1389), Expect = 6.929e-172
Identity = 263/562 (46.80%), Postives = 387/562 (68.86%), Query Frame = 3
Query: 1794 DLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY--SRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            DL+E +A         L+ S F ++P  + F    E++E LP +  K L+W+ + +TP +VK TI RS FK ++           +++DW+  +G HMK P FK+IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L ++ W+ GGSK KWI+KPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL++Y+++DGLVRFAS KYS+S+KTL+N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  +G+NT  +W +IKD+V+KT+I+++  +++ V ++ +S YS  ELFGFD++LDENLKPW+LEVN+SPSLHS++PLD+ IKG MI+D+ N+ G+VLP   D  P+    + S  +           R  W  + S DE  K   ++S        RF   D     +LD LTP DVR L +  DE  R+G FERV+P    +AS RYL +FE+  YLN+L+  +  KY  SR ++G  LL +LC+K++HL     G+  +S H W
Sbjct:  478 DLVERSA---------LVPSLFPHMPSTLYFSTANERVELLPAEQMKLLKWKITTVTPNVVKNTIFRSHFKATK-----------KSHDWLGCWGHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSDDKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLPLRDDFAPSGSSASSSTSSLCGGV------REKWRPDISPDEKVKRAFYLSQ-------RFGDQD-FCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPS---HASSRYLRFFEQPRYLNILLNQWEQKYWLSR-SKGINLLRDLCEKRVHL-----GNLAESVHHW 996          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 539.65 bits (1389), Expect = 6.929e-172
Identity = 263/562 (46.80%), Postives = 387/562 (68.86%), Query Frame = 3
Query: 1794 DLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY--SRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            DL+E +A         L+ S F ++P  + F    E++E LP +  K L+W+ + +TP +VK TI RS FK ++           +++DW+  +G HMK P FK+IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L ++ W+ GGSK KWI+KPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL++Y+++DGLVRFAS KYS+S+KTL+N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  +G+NT  +W +IKD+V+KT+I+++  +++ V ++ +S YS  ELFGFD++LDENLKPW+LEVN+SPSLHS++PLD+ IKG MI+D+ N+ G+VLP   D  P+    + S  +           R  W  + S DE  K   ++S        RF   D     +LD LTP DVR L +  DE  R+G FERV+P    +AS RYL +FE+  YLN+L+  +  KY  SR ++G  LL +LC+K++HL     G+  +S H W
Sbjct:  478 DLVERSA---------LVPSLFPHMPSTLYFSTANERVELLPAEQMKLLKWKITTVTPNVVKNTIFRSHFKATK-----------KSHDWLGCWGHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCKYSSSMKTLNNKFMHLTNYSVNKKNSEYQSNSDDKACQGHKWALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLPLRDDFAPSGSSASSSTSSLCGGV------REKWRPDISPDEKVKRAFYLSQ-------RFGDQD-FCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPS---HASSRYLRFFEQPRYLNILLNQWEQKYWLSR-SKGINLLRDLCEKRVHL-----GNLAESVHHW 996          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Zebrafish
Match: ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:ZFIN;Acc:ZDB-GENE-070912-313])

HSP 1 Score: 457.218 bits (1175), Expect = 2.788e-141
Identity = 237/562 (42.17%), Postives = 349/562 (62.10%), Query Frame = 3
Query: 1794 DLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY--SRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            DL+E +A         L+ S F ++P  + F    E++E LP +  K L+W+ + +TP +VK TI RS FK ++           +++DW+  +G HMK P FK+IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L ++ W+ GGSK KWI+KPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL++Y+++DGLVRFAS K                                         +LK+LW Y+  +G+NT  +W +IKD+V+KT+I+++  +++ V ++ +S YS  ELFGFD++LDENLKPW+LEVN+SPSLHS++PLD+ IKG MI+D+ N+ G+VLP   D  P+    + S  +           R  W  + S DE  K   ++S        RF   D     +LD LTP DVR L +  DE  R+G FERV+P    +AS RYL +FE+  YLN+L+  +  KY  SR ++G  LL +LC+K++HL     G+  +S H W
Sbjct:  478 DLVERSA---------LVPSLFPHMPSTLYFSTANERVELLPAEQMKLLKWKITTVTPNVVKNTIFRSHFKATK-----------KSHDWLGCWGHHMKSPGFKAIREFQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFILPQDIKLLRKAWDDGGSKQKWIVKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRIYIFNDGLVRFASCK-----------------------------------------ALKALWQYLGSQGINTTLIWEKIKDMVIKTIIASDPYVNSLVKMHVRSPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNTPLDVSIKGQMIRDLLNLAGFVLPLRDDFAPSGSSASSSTSSLCGGV------REKWRPDISPDEKVKRAFYLSQ-------RFGDQD-FCATVLDVLTPDDVRVLAESEDELSRKGDFERVFPS---HASSRYLRFFEQPRYLNILLNQWEQKYWLSR-SKGINLLRDLCEKRVHL-----GNLAESVHHW 955          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Xenopus
Match: sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:Xenbase;Acc:XB-GENE-1013438])

HSP 1 Score: 523.857 bits (1348), Expect = 2.568e-165
Identity = 250/529 (47.26%), Postives = 361/529 (68.24%), Query Frame = 3
Query: 1848 FSK--FSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTK-YSRNNQGTRLLENLCQKKLH 3425
            FSK  F NV P + F  + EK+E LP+  RK L+W+ S +TP +VK TI RS F+ ++           +  DW+  +G HMK   FKS+R YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L K+ WE GG++ KWI+KPPASARG+G++V++KW+Q+PK+RP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++Y++ DGLVRFAS KYS+S+K+L N+++HLTNYS+NK N +Y  N D  AC+GHKW+LK+LWNY+ ++G N+D +W +IKD+V+KT+I+++  +++ V +Y +S Y   ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   +V  A+   +   E+          D+   L   + +++ + ++ +            P  +L   +LD LTP DVR LV+  DE  R G FER++P      + RYL +FE+  YLN+L   +  K Y+   +G  LL + C K  H
Sbjct:  534 FSKSLFPNVHPTLYFGTQEEKVELLPWAQRKLLKWKMSNVTPNVVKHTIARSHFRVTK-----------KNQDWLGCWGHHMKSTAFKSLRAYQKLNHFPGSFQIGRKDRLWRNLSKMQAHYGKKEFNFFPQSFVLPQDIKLLKKAWEEGGNRQKWIVKPPASARGMGIQVIHKWSQLPKKRPLLVQRYLHKPYLISGSKFDLRIYVYVTSFDPLRIYMFTDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKNNADYQANPDQTACQGHKWALKALWNYLNQKGFNSDRIWEKIKDIVIKTIIASDPYVNSFVKMYVQSPYCCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPSKDEVCTASPSGSSISESSA------GKDKGHSLEIVAEEKMKRARYLIQKI---------PDKDLYATVLDHLTPEDVRVLVETEDELSRCGQFERIFPS---PITSRYLRFFEQPRYLNILTNQWEQKYYTDRERGRDLLRSFCLKNYH 1033          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Xenopus
Match: sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:Xenbase;Acc:XB-GENE-1013438])

HSP 1 Score: 521.546 bits (1342), Expect = 2.073e-164
Identity = 250/529 (47.26%), Postives = 361/529 (68.24%), Query Frame = 3
Query: 1848 FSK--FSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTK-YSRNNQGTRLLENLCQKKLH 3425
            FSK  F NV P + F  + EK+E LP+  RK L+W+ S +TP +VK TI RS F+ ++           +  DW+  +G HMK   FKS+R YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L K+ WE GG++ KWI+KPPASARG+G++V++KW+Q+PK+RP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++Y++ DGLVRFAS KYS+S+K+L N+++HLTNYS+NK N +Y  N D  AC+GHKW+LK+LWNY+ ++G N+D +W +IKD+V+KT+I+++  +++ V +Y +S Y   ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   +V  A+   +   E+          D+   L   + +++ + ++ +            P  +L   +LD LTP DVR LV+  DE  R G FER++P      + RYL +FE+  YLN+L   +  K Y+   +G  LL + C K  H
Sbjct:  514 FSKSLFPNVHPTLYFGTQEEKVELLPWAQRKLLKWKMSNVTPNVVKHTIARSHFRVTK-----------KNQDWLGCWGHHMKSTAFKSLRAYQKLNHFPGSFQIGRKDRLWRNLSKMQAHYGKKEFNFFPQSFVLPQDIKLLKKAWEEGGNRQKWIVKPPASARGMGIQVIHKWSQLPKKRPLLVQRYLHKPYLISGSKFDLRIYVYVTSFDPLRIYMFTDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKNNADYQANPDQTACQGHKWALKALWNYLNQKGFNSDRIWEKIKDIVIKTIIASDPYVNSFVKMYVQSPYCCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPSKDEVCTASPSGSSISESSA------GKDKGHSLEIVAEEKMKRARYLIQKI---------PDKDLYATVLDHLTPEDVRVLVETEDELSRCGQFERIFPS---PITSRYLRFFEQPRYLNILTNQWEQKYYTDRERGRDLLRSFCLKNYH 1013          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Xenopus
Match: sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:Xenbase;Acc:XB-GENE-1013438])

HSP 1 Score: 515.383 bits (1326), Expect = 9.976e-163
Identity = 244/509 (47.94%), Postives = 352/509 (69.16%), Query Frame = 3
Query: 1848 FSK--FSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY 3368
            FSK  F NV P + F  + EK+E LP+  RK L+W+ S +TP +VK TI RS F+ ++           +  DW+  +G HMK   FKS+R YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L K+ WE GG++ KWI+KPPASARG+G++V++KW+Q+PK+RP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++Y++ DGLVRFAS KYS+S+K+L N+++HLTNYS+NK N +Y  N D  AC+GHKW+LK+LWNY+ ++G N+D +W +IKD+V+KT+I+++  +++ V +Y +S Y   ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   +V  A+   +   E+          D+   L   + +++ + ++ +            P  +L   +LD LTP DVR LV+  DE  R G FER++P      + RYL +FE+  YLN+L   +  KY
Sbjct:  514 FSKSLFPNVHPTLYFGTQEEKVELLPWAQRKLLKWKMSNVTPNVVKHTIARSHFRVTK-----------KNQDWLGCWGHHMKSTAFKSLRAYQKLNHFPGSFQIGRKDRLWRNLSKMQAHYGKKEFNFFPQSFVLPQDIKLLKKAWEEGGNRQKWIVKPPASARGMGIQVIHKWSQLPKKRPLLVQRYLHKPYLISGSKFDLRIYVYVTSFDPLRIYMFTDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKNNADYQANPDQTACQGHKWALKALWNYLNQKGFNSDRIWEKIKDIVIKTIIASDPYVNSFVKMYVQSPYCCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPSKDEVCTASPSGSSISESSA------GKDKGHSLEIVAEEKMKRARYLIQKI---------PDKDLYATVLDHLTPEDVRVLVETEDELSRCGQFERIFPS---PITSRYLRFFEQPRYLNILTNQWEQKY 993          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Xenopus
Match: sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:Xenbase;Acc:XB-GENE-1013438])

HSP 1 Score: 500.745 bits (1288), Expect = 4.166e-157
Identity = 234/489 (47.85%), Postives = 341/489 (69.73%), Query Frame = 3
Query: 1902 KIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY 3368
            ++E LP+  RK L+W+ S +TP +VK TI RS F+ ++           +  DW+  +G HMK   FKS+R YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L K+ WE GG++ KWI+KPPASARG+G++V++KW+Q+PK+RP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++Y++ DGLVRFAS KYS+S+K+L N+++HLTNYS+NK N +Y  N D  AC+GHKW+LK+LWNY+ ++G N+D +W +IKD+V+KT+I+++  +++ V +Y +S Y   ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   +V  A+   +   E+          D+   L   + +++ + ++ +            P  +L   +LD LTP DVR LV+  DE  R G FER++P      + RYL +FE+  YLN+L   +  KY
Sbjct:  451 ELELLPWAQRKLLKWKMSNVTPNVVKHTIARSHFRVTK-----------KNQDWLGCWGHHMKSTAFKSLRAYQKLNHFPGSFQIGRKDRLWRNLSKMQAHYGKKEFNFFPQSFVLPQDIKLLKKAWEEGGNRQKWIVKPPASARGMGIQVIHKWSQLPKKRPLLVQRYLHKPYLISGSKFDLRIYVYVTSFDPLRIYMFTDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKNNADYQANPDQTACQGHKWALKALWNYLNQKGFNSDRIWEKIKDIVIKTIIASDPYVNSFVKMYVQSPYCCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPSKDEVCTASPSGSSISESSA------GKDKGHSLEIVAEEKMKRARYLIQKI---------PDKDLYATVLDHLTPEDVRVLVETEDELSRCGQFERIFPS---PITSRYLRFFEQPRYLNILTNQWEQKY 910          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Xenopus
Match: sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:Xenbase;Acc:XB-GENE-1013438])

HSP 1 Score: 434.491 bits (1116), Expect = 5.131e-138
Identity = 224/533 (42.03%), Postives = 326/533 (61.16%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEK-------IEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTK-YSRNNQGTRLLENLCQKKLH 3425
            S F NV P + F  + EK       +E LP+  RK L+W+ S +TP +VK TI RS F+ ++           +  DW+  +G HMK   FKS+R YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L K+ WE GG++ KWI+KPPASARG+G++V++KW+Q+PK+RP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++Y++ DGLVRFAS K                                         +LK+LWNY+ ++G N+D +W +IKD+V+KT+I+++  +++ V +Y +S Y   ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   +V  A+   +   E+          D+   L   + +++ + ++ +            P  +L   +LD LTP DVR LV+  DE  R G FER++P      + RYL +FE+  YLN+L   +  K Y+   +G  LL + C K  H
Sbjct:   20 SLFPNVHPTLYFGTQEEKGKFSQYFVELLPWAQRKLLKWKMSNVTPNVVKHTIARSHFRVTK-----------KNQDWLGCWGHHMKSTAFKSLRAYQKLNHFPGSFQIGRKDRLWRNLSKMQAHYGKKEFNFFPQSFVLPQDIKLLKKAWEEGGNRQKWIVKPPASARGMGIQVIHKWSQLPKKRPLLVQRYLHKPYLISGSKFDLRIYVYVTSFDPLRIYMFTDGLVRFASCK-----------------------------------------ALKALWNYLNQKGFNSDRIWEKIKDIVIKTIIASDPYVNSFVKMYVQSPYCCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPSKDEVCTASPSGSSISESSAGK------DKGHSLEIVAEEKMKRARYLIQKI---------PDKDLYATVLDHLTPEDVRVLVETEDELSRCGQFERIFPS---PITSRYLRFFEQPRYLNILTNQWEQKYYTDRERGRDLLRSFCLKNYH 482          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Mouse
Match: Ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:MGI Symbol;Acc:MGI:1914784])

HSP 1 Score: 554.288 bits (1427), Expect = 6.051e-176
Identity = 273/550 (49.64%), Postives = 366/550 (66.55%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            LI+S F NV P I F    E++E LP++ R+ LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQ+F LP D +L ++ WES  S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++G+N+D +W +IKD+VVKT+IS+E  ++  + LY +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   D+       +    +    +S     R      P      KMK    +          P  +    +LD LTP DVR LV+  DE+ RRG FER++P      S RYL +FE+  Y N+L T +  KY  N  +G  LL N C K       H G   DS  +W +P S
Sbjct:  570 LIYSLFPNVTPTIYFGTRDERVEKLPWEQRRLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPGFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDSKLLRKAWESS-SRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLSNKFMHLTNYSVNKKNTEYQANADETACQGHKWALKALWNYLSQKGINSDAIWEKIKDVVVKTIISSEPYVTNLLKLYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPNMEDI---ISSSSSPSSSSGSSTSLPSSPRDKCQMTPEHFTAQKMKKAYYLTQK------IPDQDFYASVLDVLTPDDVRVLVEMEDEFSRRGQFERIFPS---RISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRNWCYKGF-----HTGIVSDSAPLWSLPTS 1090          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Mouse
Match: Ttll4 (tubulin tyrosine ligase-like family, member 4 [Source:MGI Symbol;Acc:MGI:1914784])

HSP 1 Score: 379.793 bits (974), Expect = 5.442e-112
Identity = 192/408 (47.06%), Postives = 264/408 (64.71%), Query Frame = 3
Query: 2322 PASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDV---------------EPATLGRAK---SPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            PASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++G+N+D +W +IKD+VVKT+IS+E  ++  + LY +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   D+                  +  R K   +PE+FT       + + ++L    T +I     + SV                   LD LTP DVR LV+  DE+ RRG FER++P      S RYL +FE+  Y N+L T +  KY  N  +G  LL N C K       H G   DS  +W +P S
Sbjct:  654 PASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLSNKFMHLTNYSVNKKNTEYQANADETACQGHKWALKALWNYLSQKGINSDAIWEKIKDVVVKTIISSEPYVTNLLKLYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPNMEDIISSSSSPSSSSGSSTSLPSSPRDKCQMTPEHFTAQK----MKKAYYL----TQKIPDQDFYASV-------------------LDVLTPDDVRVLVEMEDEFSRRGQFERIFPS---RISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRNWCYKGF-----HTGIVSDSAPLWSLPTS 1026          

HSP 2 Score: 87.8113 bits (216), Expect = 6.645e-17
Identity = 45/95 (47.37%), Postives = 60/95 (63.16%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQK 2126
            LI+S F NV P I F    E++E LP++ R+ LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK
Sbjct:  570 LIYSLFPNVTPTIYFGTRDERVEKLPWEQRRLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPGFRSIREHQK 653          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 301.597 bits (771), Expect = 3.393e-89
Identity = 164/433 (37.88%), Postives = 258/433 (59.58%), Query Frame = 3
Query: 2064 ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFL 3359
            +++ G H+K  + +++ + QKVNHFP S++L RKDRL++NI RMQ   G   F  +PQTF LP +   F  C      +  WI+KP AS+RG GV ++   NQI     I+V +YI+NP LI+D KFD+RLYV +T  +PL +YLY++GL RFA+ +Y    K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++  Y+K+ G +T  +   ++DL++KT+ISAE AI+ +   +     S  EL+GFDV++D  LKPW+LEVN+SPSL  D+PLD+ IK  MI DMF + G+V  +P+     T  R+  P   +  SS     ++     P +   ++MK+ V+ A      +   S       +  L+  +++ L +  +E +RRG F R++P       + Y SY E    +N ++ + L
Sbjct:   98 LMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEF--CNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQ---RTSNRSIYP---SFESSRRNPFQKPQRTRPLSASDAEMKNLVASAREKVPGKLGGS-------VLGLSMEEIKVLRRVKEENDRRGGFIRIFPTS--ETWEIYGSYLEHKTSMNYMLATRL 513          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 291.582 bits (745), Expect = 3.168e-87
Identity = 138/308 (44.81%), Postives = 207/308 (67.21%), Query Frame = 3
Query: 2064 ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPS 2984
            +++ G H+K  + +++ + QKVNHFP S++L RKDRL++NI RMQ   G   F  +PQTF LP +   F  C      +  WI+KP AS+RG GV ++   NQI     I+V +YI+NP LI+D KFD+RLYV +T  +PL +YLY++GL RFA+ +Y    K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++  Y+K+ G +T  +   ++DL++KT+ISAE AI+ +   +     S  EL+GFDV++D  LKPW+LEVN+SPSL  D+PLD+ IK  MI DMF + G+V  +P+
Sbjct:   98 LMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEF--CNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPA 403          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Mouse
Match: Ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:MGI Symbol;Acc:MGI:2443657])

HSP 1 Score: 291.582 bits (745), Expect = 3.168e-87
Identity = 138/308 (44.81%), Postives = 207/308 (67.21%), Query Frame = 3
Query: 2064 ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPS 2984
            +++ G H+K  + +++ + QKVNHFP S++L RKDRL++NI RMQ   G   F  +PQTF LP +   F  C      +  WI+KP AS+RG GV ++   NQI     I+V +YI+NP LI+D KFD+RLYV +T  +PL +YLY++GL RFA+ +Y    K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++  Y+K+ G +T  +   ++DL++KT+ISAE AI+ +   +     S  EL+GFDV++D  LKPW+LEVN+SPSL  D+PLD+ IK  MI DMF + G+V  +P+
Sbjct:   98 LMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEF--CNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGSKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGKDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDNTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPA 403          
BLAST of tubulin polyglutamylase TTLL4-like vs. UniProt/SwissProt
Match: sp|Q80UG8|TTLL4_MOUSE (Tubulin polyglutamylase TTLL4 OS=Mus musculus OX=10090 GN=Ttll4 PE=1 SV=3)

HSP 1 Score: 554.288 bits (1427), Expect = 4.232e-175
Identity = 273/550 (49.64%), Postives = 366/550 (66.55%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            LI+S F NV P I F    E++E LP++ R+ LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQ+F LP D +L ++ WES  S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++G+N+D +W +IKD+VVKT+IS+E  ++  + LY +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+SPLDI IKG MI+D+ N+ G+VLP   D+       +    +    +S     R      P      KMK    +          P  +    +LD LTP DVR LV+  DE+ RRG FER++P      S RYL +FE+  Y N+L T +  KY  N  +G  LL N C K       H G   DS  +W +P S
Sbjct:  570 LIYSLFPNVTPTIYFGTRDERVEKLPWEQRRLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPGFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDSKLLRKAWESS-SRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLSNKFMHLTNYSVNKKNTEYQANADETACQGHKWALKALWNYLSQKGINSDAIWEKIKDVVVKTIISSEPYVTNLLKLYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPNMEDI---ISSSSSPSSSSGSSTSLPSSPRDKCQMTPEHFTAQKMKKAYYLTQK------IPDQDFYASVLDVLTPDDVRVLVEMEDEFSRRGQFERIFPS---RISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRNWCYKGF-----HTGIVSDSAPLWSLPTS 1090          
BLAST of tubulin polyglutamylase TTLL4-like vs. UniProt/SwissProt
Match: sp|Q14679|TTLL4_HUMAN (Tubulin polyglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2)

HSP 1 Score: 541.191 bits (1393), Expect = 3.377e-170
Identity = 275/550 (50.00%), Postives = 373/550 (67.82%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNN-QGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            LI+S F NVPP I F    E++E LP++ RK LRW+ S +TP IVKQTIGRS FK S+             +DW+  +G HMK P F+SIR++QK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQ+F LP D +L ++ WES  S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI+ SKFDLR+YV++T  +PL++YL+ DGLVRFAS KYS S+K+L N+++HLTNYS+NK+N EY  N D  AC+GHKW+LK+LWNY+ ++GVN+D +W +IKD+VVKT+IS+E  +++ + +Y +  YS  ELFGFD++LDENLKPW+LEVN+SPSLHS SPLDI IKG MI+D+ N+ G+VLP   D+    +    S  + T        D+     E  T +  K  ++++           P  +    +LD LTP DVR LV+  DE+ RRG FER++P    + S RYL +FE+  Y N+L T +  KY  N  +G  LL + C K  H+     G   DS  VW +P S
Sbjct:  575 LIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISK-----------RNDDWLGCWGHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESS-SRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDI----ISSPSSCSSSTTSLPTSPGDKCRMAPEHVTAQKMKKAYYLTQKI--------PDQDFYASVLDVLTPDDVRILVEMEDEFSRRGQFERIFPS---HISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRSWCYKGFHM-----GVVSDSAPVWSLPTS 1092          
BLAST of tubulin polyglutamylase TTLL4-like vs. UniProt/SwissProt
Match: sp|Q09647|TTLL4_CAEEL (Tubulin polyglutamylase ttll-4 OS=Caenorhabditis elegans OX=6239 GN=ttll-4 PE=1 SV=3)

HSP 1 Score: 343.199 bits (879), Expect = 4.362e-103
Identity = 196/525 (37.33%), Postives = 295/525 (56.19%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKG-HKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSF-LTKYSRNNQGTRLLENLCQKK 3419
            S+F++VPP I F  +G K+     +++  L W  + L P++++QT+  S F           +DE+    ++ Y+G+H+K   +++++ +QKVNHFPG+F +GRKDRLW +I R QQE    EFD +P T+ LPTD +   +  E+  S+H  I+KPPASARG G+ V  K    P    +V Q YI  P  IN +KFDLRLY ++    PL+VY+YD GLVRFAS  YS+S+ T+ N+Y+HLTNYSINK     L   D  A K   KW+L  LW +  + GV+ + +   I+++++K  IS E+ I   ++ + +  +   ELFG D+ILDE+ KPW+LEVN+SPSLHS +PLD+ +K  + KD+ N+ G  +P PS  + +    +  P N    + +  I    W        ++  K  + V  N              +I   LTP D R LV+  DE ER G F+ V+P      +  Y  YF    Y+N+L+  + + +    + G   LE LC++K
Sbjct:  112 SQFTDVPPTIRFYTKGTKVTKPARKIQARLTWCHNSLLPIVMRQTLAASHFTV---------VDESLF--YVGYWGRHLKSAQYRALQPHQKVNHFPGAFHIGRKDRLWMHI-RKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINK-----LAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVP-PSFDKLSDADYSTRPRN-GRKNREQLIKEASW--------VAAYKDQLGVIDN--------------RIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAH---TSHYQKYFAETIYMNILLQQWQIAQEDDRSIGINRLEQLCRQK 591          
BLAST of tubulin polyglutamylase TTLL4-like vs. UniProt/SwissProt
Match: sp|A8X9V4|TTLL4_CAEBR (Tubulin polyglutamylase ttll-4 OS=Caenorhabditis briggsae OX=6238 GN=ttll-4 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 2.831e-98
Identity = 194/525 (36.95%), Postives = 290/525 (55.24%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKG-HKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSF-LTKYSRNNQGTRLLENLCQKK 3419
            S+F++VPP I F  +G K+     +++  L W  + L P++++QT+  S F           +DE+  +  I Y+G+H+K   +K+++ +QKVNHFPG+F +GRKDRLW +I    +  G  EF+ +P T+ LPTD +   +  E+  ++H  IIKPPASARG G+ V  K    P    +V Q YI  P  IN +KFDLRLY ++    PL+VY+YD GLVRFAS  Y+ S+  + N+Y+HLTNYSINK     L   D  A K   KW+L  LW+Y  + GVN+  +   I+D++VK  IS E+ I   ++ + +  +   ELFG D+ILDE+ KPW+LEVN+SPSLHS + LD+ +K  + KD+ N+ G  +P PS  +  T   +  P N T                         +  V  A+    +R D    +  +I   LTP D R LV+  DE +R G F+ V+P      +  Y  +F    Y+N+L+  + + +    + G   LE LC++K
Sbjct:  108 SQFTDVPPTIRFYTKGTKVTKPARKIQSRLTWCHNSLLPIVMRQTLSASHFT---------IVDESLFH--IGYWGRHLKSAQYKALQPHQKVNHFPGAFHIGRKDRLWMHIRNRLEHFGE-EFEIMPFTYILPTDRQELLKYLETDVNRHV-IIKPPASARGSGITVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYNPSVTNISNKYMHLTNYSINK-----LAEADGIANKPVPKWALHQLWDYFDQMGVNSQKIQKEIEDVIVKAFISCEKPIREHMSRFLEQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSGTSLDVSVKAPLAKDVLNLAGIHVP-PSFDKLHTADYSCRPRNGT----------------------KTREQLVKEASWVAAYR-DQHGAIDNRIFKRLTPEDTRALVEFEDELDRIGDFKLVFPTAQ---TAHYQKFFAEPIYMNILLQQWQIAQEGDRSIGIDRLEQLCRQK 587          
BLAST of tubulin polyglutamylase TTLL4-like vs. UniProt/SwissProt
Match: sp|Q6EMB2|TTLL5_HUMAN (Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3)

HSP 1 Score: 304.679 bits (779), Expect = 3.329e-84
Identity = 168/444 (37.84%), Postives = 263/444 (59.23%), Query Frame = 3
Query: 2034 DLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKS-PENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFL 3359
            ++  + T+  +++ G H+K  + +++ + QKVNHFP S++L RKDRL++NI RMQ   G   F  +PQTF LP +   F  C      +  WI+KP AS+RG GV ++   NQI     I+V +YI+NP LI+D KFD+RLYV +T  +PL +YLY++GL RFA+ +Y    K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++  Y+K+ G +T  +   ++DL++KT+ISAE AI+ +   +     S  EL+GFDV++D  LKPW+LEVN+SPSL  D+PLD+ IK  MI DMF + G+V  +P+        RA + P   T  SS     ++     P +   ++MK+ V  A      R      L   +L  L+  +++ L +  +E +RRG F R++P       + Y SY E    +N ++ + L
Sbjct:   88 EVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEF--CNSYSKDRGPWIVKPVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQ-------RASTRPIYPTFESSRRNPFQKPQRCRPLSASDAEMKNLVGSA------REKGPGKLGGSVLG-LSMEEIKVLRRVKEENDRRGGFIRIFPTS--ETWEIYGSYLEHKTSMNYMLATRL 513          
BLAST of tubulin polyglutamylase TTLL4-like vs. TrEMBL
Match: A0A1S3HCV7 (tubulin polyglutamylase TTLL4-like OS=Lingula unguis OX=7574 GN=LOC106154113 PE=4 SV=1)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 284/562 (50.53%), Postives = 394/562 (70.11%), Query Frame = 3
Query: 1809 TAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSR-NNQGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNSS 3491
             A ++ +    L  S FSNVPP INFV +GEK+E LP++++K L+WR S +TP +VK  I RSGF+ ++           + +DW+  +GKHMK   F++IR+YQK+NHFPGSFQ+GRKDRLWRN+ R+Q   G  EF F PQTF LP D++L K+ WE GGSK KWIIKPPASARGIG+KV++KWNQ+PKRRP++VQKY+S PYLIN+SKFDLR+YV++T ++PL++Y++ DGLVRFAS KYS+S+K L+N+Y+HLTNYSINK+N  Y  N D+  C+GHKWSLKSLW Y++K+GVN   +W  IKDLV+KT++ AE  +++ V   C+STYSV ELFGFDV+LDE LKPWILEVN+SPSLHS+S LD+ +KG MIKD+ N+ G+ +P+ +DV       A++  N  +P S+L +D+R +    + DE +K  ++     +         D +   +LD LTP D+R L+  VDE  R+G FERV+P      S +YL +FE+  Y NLL+  ++ +Y++   +G  LL++ CQK +H+ S       D  H W  PN++
Sbjct:  610 AALRDYELQPALTASLFSNVPPTINFVADGEKVESLPWEIKKLLKWRLSPVTPNVVKNCINRSGFRITK-----------KNHDWLGCWGKHMKANAFRAIREYQKLNHFPGSFQIGRKDRLWRNLSRLQVHFGRREFGFFPQTFVLPYDMKLLKRAWEDGGSKQKWIIKPPASARGIGIKVIHKWNQVPKRRPVIVQKYLSRPYLINESKFDLRIYVYVTSLDPLRLYVFQDGLVRFASMKYSSSMKNLNNKYMHLTNYSINKKNSGYQANGDDTVCQGHKWSLKSLWGYLQKKGVNYGPIWESIKDLVIKTIVCAEAPMNSLVKSNCQSTYSVHELFGFDVMLDEQLKPWILEVNISPSLHSNSQLDMNVKGQMIKDLHNLAGFQIPDKNDVVQNPSAPAET-SNIKVP-SELIMDKRLFTQNMAPDERAKHAYYCQKYQD---------DQIQQTVLDTLTPDDIRVLIATVDEDSRKGGFERVFPTAK---SSKYLKFFEQPRYYNLLLNQWVQRYNKMEARGVALLDSFCQKWVHVQSPI----TDPYHQWSPPNAT 1142          
BLAST of tubulin polyglutamylase TTLL4-like vs. TrEMBL
Match: V4B6F6 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_139346 PE=4 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 281/548 (51.28%), Postives = 392/548 (71.53%), Query Frame = 3
Query: 1851 SKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNNQ-GTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNSS 3491
            S F N+PP INF+ E EK+E LP+++RK L+WR S +TP IVK  + R GF+ S+           + +DW+  FGKHMK   FK+I++YQK+NHFPGSFQ+GRKDRLWRN+ RMQ   G  EF F PQT+ LP DL+L K+ WE GGSK KWIIKPPASARGIG+KV++KW QIP+R+P++VQ+Y+S PYLINDSKFD+R+YV+++  +PL++Y+Y+DGL RFAS KYS+S+K+L+N+Y+HLTNYSINK+N EY  N D+  C+GHKWSLKSLW+++KKRGVNT  +W  IKDL +KT+IS+E  I++ +    KS Y V ELFGFDV+LDE LKPWI+EVN+SPSLHS+S LDI IKG MIKD+FNI G+++P+ SDV  A  G +    +F LPS+D  +D+R +    S DE +K  ++   + +         +++   ILD +TP D+R L  C+DE  R+G F+RV+P  +   + +YL +FE+  Y NLL+  ++ +++R  Q G  ++ + C+++ HL  Q+  D +   H W  PN++
Sbjct:   15 SLFPNIPPTINFISENEKVELLPWEIRKLLKWRMSPITPNIVKSALARVGFRISK-----------KNHDWLGCFGKHMKSQGFKAIKEYQKLNHFPGSFQIGRKDRLWRNLSRMQVHFGKKEFGFFPQTYVLPQDLKLLKRAWEDGGSKQKWIIKPPASARGIGIKVIHKWTQIPRRKPVIVQRYLSRPYLINDSKFDMRVYVYVSGYDPLRIYIYEDGLARFASCKYSSSMKSLNNKYMHLTNYSINKRNTEYQSNTDDTVCQGHKWSLKSLWSFLKKRGVNTTAIWDSIKDLAIKTIISSESPINSMIKANVKSRYCVHELFGFDVMLDETLKPWIIEVNISPSLHSNSQLDINIKGQMIKDLFNIAGFLVPDKSDV--AHPGSSTQISDFRLPSNDYCMDKRLFTSVFSPDERAKHAYYCQRSQD---------EHIMQTILDIMTPDDLRTLTSCIDEDSRKGGFQRVFPTPT---THKYLRFFEQPRYYNLLLDQYIQRFNRMEQKGISMISSYCEEEEHL--QNPTDNVS--HQWNPPNAT 533          
BLAST of tubulin polyglutamylase TTLL4-like vs. TrEMBL
Match: A0A210PWS8 (Tubulin polyglutamylase TTLL4 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19085 PE=4 SV=1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 283/562 (50.36%), Postives = 386/562 (68.68%), Query Frame = 3
Query: 1809 TAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNNQ-GTRLLENLCQKKLHLISQHNGDKIDSK-HVWKMPNS 3488
            T+ KET  H PL  S F  +PP +NFV EGEK+E LP++ RKFL+WR S +TP IVK T+ R GF+ ++             +DW+  +GKHMK   FK+IR+YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F PQTF LP D +L K+ WE GG+K KWIIKPPASARGIG+KV+ KWNQIP++R ++VQ+Y+  PYLINDSKFD+R+YV+++  +PL+VY+++DGL RFAS KYS+S+K L+N+++HLTNYSINK+N EY  N D + C+GHKW LK+LWNYMK++G+NT  +W  IKDLV+KT+I A+  I++ +    +S Y + ELFGFD++LDENLKPWILEVN+SPSLHS+S LDI IKG MI+D+FNI G+ +PE SDV   +     S  +   PS+D  +D+R +    S DE SK  ++     +         + +   +LD LTP D+R L + +DE  R+G F+RV+P  + +   +Y+ YFE   Y NLL+  ++ +Y+R  Q G  LLE  C + +HL      +  DS  H W  P+S
Sbjct:  601 TSEKETVLHPPLRQSLFPRIPPTVNFVIEGEKVEQLPWEYRKFLKWRMSPITPNIVKHTLARVGFRITK-----------RNHDWLGCWGKHMKSQGFKAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQLHSGKKEFGFFPQTFVLPYDNKLLKRAWEDGGNKQKWIIKPPASARGIGIKVISKWNQIPRKRAVIVQRYLGRPYLINDSKFDMRIYVYVSSYDPLRVYVFEDGLARFASCKYSSSMKNLNNKFMHLTNYSINKKNEEYQANGDEKLCQGHKWGLKALWNYMKRQGINTAAIWENIKDLVIKTIICADSPINSMIKANVRSRYCIHELFGFDILLDENLKPWILEVNISPSLHSNSQLDINIKGQMIRDLFNIAGFRIPEKSDVVVHSTQTTSSDLSHHNPSNDYCMDKRLFAQNHSPDERSKHAYYSQRHQD---------EQVLQTVLDVLTPDDIRILTESIDEDSRKGSFQRVFPTPNTH---KYMHYFETHRYYNLLLDQYVQRYNRMEQKGIALLELYCDEGVHL-----ENPTDSPYHQWAPPSS 1134          
BLAST of tubulin polyglutamylase TTLL4-like vs. TrEMBL
Match: A0A093F1G5 (Tubulin polyglutamylase TTLL4 (Fragment) OS=Gavia stellata OX=37040 GN=N328_07651 PE=4 SV=1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 273/555 (49.19%), Postives = 381/555 (68.65%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYE---PSTDEISKMKHFVSVATNGTEFRFD--PSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            L+ S F NVPP I F    E++E LP++ RK LRW+   +TP IVKQT+GRS F+ S+           E+NDW+  +G HMK P F++IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L ++ WE G S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI   KFDLR+YV++T  +PL+VYL+ DGLVRFAS KYS+S+K+L N++VHLTNYS+NK+N+EY  N+D  AC+GHKW+LK+LWNY+ ++GVN++ +W +IKD+V+KT+I++E  +++ V  Y +  Y   ELFGFD++LDENLKPWILEVN+SPSLHS+SPLD+ IKG MI+D+ N+ G+VLP    +  A+  + +S    +L S+         L E   P+++      HF++       +     P  +    +LD LTP DVR LV+  DEY RRG FERV+P    + S RYL +FE+  Y N+LVT +  KY  N ++G  LL+N C K       H G  +D    W +P S
Sbjct:   62 LVCSLFPNVPPTIYFSTRDERVEKLPWEQRKLLRWKMCTVTPNIVKQTVGRSHFRVSK-----------ESNDWLGCWGHHMKSPSFRAIREHQKLNHFPGSFQIGRKDRLWRNLLKMQARCGKKEFNFFPQSFILPQDIKLLRKAWEEGASRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLIGGKKFDLRIYVYVTCYDPLRVYLFKDGLVRFASCKYSSSMKSLSNKFVHLTNYSVNKKNMEYKSNSDETACQGHKWALKALWNYLTQKGVNSEAIWEKIKDIVIKTIIASEPYVNSLVKTYVRRPYCCHELFGFDIMLDENLKPWILEVNISPSLHSNSPLDVSIKGQMIRDLLNLAGFVLPSTDSM--ASKPQMRSGSTCSLDSA---------LKEKPKPASE------HFIAEKMKKAYYLTQKIPDQDFYSSVLDILTPDDVRILVETEDEYSRRGQFERVFPT---HISMRYLRFFEQPRYFNILVTQWELKYYLNKHKGLELLKNWCVK-----GYHTGAGMDLAQTWSLPKS 580          
BLAST of tubulin polyglutamylase TTLL4-like vs. TrEMBL
Match: A0A087QTS8 (Tubulin polyglutamylase TTLL4 (Fragment) OS=Aptenodytes forsteri OX=9233 GN=AS27_06739 PE=4 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 274/571 (47.99%), Postives = 383/571 (67.08%), Query Frame = 3
Query: 1797 LLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDV--EPATLGR----AKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS 3488
            L + T  +E      L+ S F NVPP I F    E++E LP++ RK LRW+   +TP IVKQT+GRS F+ S+           ++NDW+  +G HMK P F++IR++QK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF+F PQ+F LP D++L ++ WE G S+ KWI+KPPASARGIG++V++KW+Q+PKRRP++VQ+Y+  PYLI   KFDLR+YV++T  +PL+VYL+ DGLVRFAS KYS+S+K+L N++VHLTNYS+NK+N EY  N+D  AC+GHKW+LK+LW+Y+ ++GVN++ +W +IKD+V+KT+I++E  +++ V +Y +  Y   ELFGFD++LDENLKPWILEVN+SPSLHS+SPLD+ IKG MI+D+ N+ G+VLP    V   P T G       + +    P+S+ FI  +            K  ++++           P  +    +LD LTP DVR LV+  DEY RRG FERV+P    + S RYL +FE+  Y N+LVT +  KY  N ++G  LL+N C K       H G  +D    W +P S
Sbjct:   47 LAQPTEAQEKVLKPALVCSLFPNVPPTIYFSTRDERVEKLPWEQRKLLRWKMCTVTPNIVKQTVGRSHFRVSK-----------KSNDWLGCWGHHMKSPSFRAIREHQKLNHFPGSFQIGRKDRLWRNLLKMQARCGKKEFNFFPQSFILPQDIKLLRKAWEEGASRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLIGGKKFDLRIYVYVTCYDPLRVYLFKDGLVRFASCKYSSSMKSLSNKFVHLTNYSVNKKNTEYKSNSDETACQGHKWALKALWSYLTQKGVNSEAIWEKIKDIVIKTIIASEPYVNSLVKMYVRRPYCCHELFGFDIMLDENLKPWILEVNISPSLHSNSPLDVSIKGQMIRDLLNLAGFVLPSTDSVASRPQTSGSTCSLGSALKEKPKPASEHFIAEKM-----------KKAYYLTQKI--------PDQDFYSSVLDILTPDDVRILVETEDEYSRRGQFERVFPT---HISMRYLRFFEQPRYFNILVTQWELKYYLNKHKGLELLKNWCVK-----GYHTGAGMDLAQTWSLPKS 579          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Cavefish
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:103047112])

HSP 1 Score: 543.502 bits (1399), Expect = 9.503e-173
Identity = 267/557 (47.94%), Postives = 376/557 (67.50%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLG------------RAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            L+ S F  + P + F    EK+E LPF+ RK L+W+ S +TP IVK TI RS FK ++           +++DW+  +G HMK   F++IR+YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L K+ WE GGS+ KWIIKPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL+VY+++DGLVRFAS KYS+S+K+L N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  RGVNT  +W +IKD+VVKT+I+A+  +++ V ++ +S+YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+S LD+ IKG MI+D+ N+ G+VLP   DV P                R KS  +    S+D  + R F+L +                      RF   D     +LD LTP DVR L +  DE  R+G FERV+P  +   S RYL +FE   YLN+L+  +  K+ +N ++G   L +LCQ+K+HL     G+   S H W
Sbjct:  535 LVSSLFPFMSPTLYFSTANEKVELLPFEQRKLLKWKMSSVTPNIVKHTITRSHFKVTK-----------KSHDWLGCWGHHMKSLGFRAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFVLPQDMKLLKKAWEDGGSRQKWIIKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRVYIFNDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKKNSEYQTNSDDKACQGHKWALKALWQYLGYRGVNTTLIWDKIKDMVVKTIIAADPYVNSLVKMHLRSSYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSALDVSIKGQMIRDVLNLAGFVLPHSEDVLPPGSSDSSSTSSLCGGVREKSRSDL---SADEKVKRAFYLTQ----------------------RFGDQD-FYSTVLDVLTPDDVRVLAETEDELSRQGEFERVFPSPT---SSRYLRFFEHPRYLNILLNQWEQKFCQNRSKGIEQLRSLCQRKVHL-----GNLDGSVHHW 1046          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Cavefish
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:103047112])

HSP 1 Score: 543.502 bits (1399), Expect = 1.200e-172
Identity = 267/557 (47.94%), Postives = 375/557 (67.32%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLG------------RAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            L+ S F  + P + F    EK+E LPF+ RK L+W+ S +TP IVK TI RS FK ++           +++DW+  +G HMK   F++IR+YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L K+ WE GGS+ KWIIKPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL+VY+++DGLVRFAS KYS+S+K+L N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  RGVNT  +W +IKD+VVKT+I+A+  +++ V ++ +S+YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+S LD+ IKG MI+D+ N+ G+VLP   DV P                R KS  +    S+D  + R F+L +                      RF   D     +LD LTP DVR L +  DE  R+G FERV+P      S RYL +FE   YLN+L+  +  K+ +N ++G   L +LCQ+K+HL     G+   S H W
Sbjct:  535 LVSSLFPFMSPTLYFSTANEKVELLPFEQRKLLKWKMSSVTPNIVKHTITRSHFKVTK-----------KSHDWLGCWGHHMKSLGFRAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFVLPQDMKLLKKAWEDGGSRQKWIIKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRVYIFNDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKKNSEYQTNSDDKACQGHKWALKALWQYLGYRGVNTTLIWDKIKDMVVKTIIAADPYVNSLVKMHLRSSYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSALDVSIKGQMIRDVLNLAGFVLPHSEDVLPPGSSDSSSTSSLCGGVREKSRSDL---SADEKVKRAFYLTQ----------------------RFGDQD-FYSTVLDVLTPDDVRVLAETEDELSRQGEFERVFPS---PTSSRYLRFFEHPRYLNILLNQWEQKFCQNRSKGIEQLRSLCQRKVHL-----GNLDGSVHHW 1046          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Cavefish
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:103047112])

HSP 1 Score: 543.502 bits (1399), Expect = 1.432e-172
Identity = 267/557 (47.94%), Postives = 375/557 (67.32%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLG------------RAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            L+ S F  + P + F    EK+E LPF+ RK L+W+ S +TP IVK TI RS FK ++           +++DW+  +G HMK   F++IR+YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L K+ WE GGS+ KWIIKPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL+VY+++DGLVRFAS KYS+S+K+L N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  RGVNT  +W +IKD+VVKT+I+A+  +++ V ++ +S+YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+S LD+ IKG MI+D+ N+ G+VLP   DV P                R KS  +    S+D  + R F+L +                      RF   D     +LD LTP DVR L +  DE  R+G FERV+P      S RYL +FE   YLN+L+  +  K+ +N ++G   L +LCQ+K+HL     G+   S H W
Sbjct:  535 LVSSLFPFMSPTLYFSTANEKVELLPFEQRKLLKWKMSSVTPNIVKHTITRSHFKVTK-----------KSHDWLGCWGHHMKSLGFRAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFVLPQDMKLLKKAWEDGGSRQKWIIKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRVYIFNDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKKNSEYQTNSDDKACQGHKWALKALWQYLGYRGVNTTLIWDKIKDMVVKTIIAADPYVNSLVKMHLRSSYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSALDVSIKGQMIRDVLNLAGFVLPHSEDVLPPGSSDSSSTSSLCGGVREKSRSDL---SADEKVKRAFYLTQ----------------------RFGDQD-FYSTVLDVLTPDDVRVLAETEDELSRQGEFERVFPS---PTSSRYLRFFEHPRYLNILLNQWEQKFCQNRSKGIEQLRSLCQRKVHL-----GNLDGSVHHW 1046          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Cavefish
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:103047112])

HSP 1 Score: 543.502 bits (1399), Expect = 1.531e-172
Identity = 267/557 (47.94%), Postives = 376/557 (67.50%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLG------------RAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            L+ S F  + P + F    EK+E LPF+ RK L+W+ S +TP IVK TI RS FK ++           +++DW+  +G HMK   F++IR+YQK+NHFPGSFQ+GRKDRLWRN+ +MQ   G  EF F P++F LP D++L K+ WE GGS+ KWIIKPPASARGIG++V++KW+Q+P++RP++VQKY+  PYLI+ +KFDLR+YV++T  +PL+VY+++DGLVRFAS KYS+S+K+L N+++HLTNYS+NK+N EY  N+D++AC+GHKW+LK+LW Y+  RGVNT  +W +IKD+VVKT+I+A+  +++ V ++ +S+YS  ELFGFD++LDENLKPW+LEVN+SPSLHS+S LD+ IKG MI+D+ N+ G+VLP   DV P                R KS  +    S+D  + R F+L +                      RF   D     +LD LTP DVR L +  DE  R+G FERV+P  +   S RYL +FE   YLN+L+  +  K+ +N ++G   L +LCQ+K+HL     G+   S H W
Sbjct:  535 LVSSLFPFMSPTLYFSTANEKVELLPFEQRKLLKWKMSSVTPNIVKHTITRSHFKVTK-----------KSHDWLGCWGHHMKSLGFRAIREYQKLNHFPGSFQIGRKDRLWRNLSKMQARFGKREFGFFPRSFVLPQDMKLLKKAWEDGGSRQKWIIKPPASARGIGIQVIHKWSQMPRKRPLLVQKYLHKPYLISGNKFDLRIYVYVTSYDPLRVYIFNDGLVRFASCKYSSSMKSLGNKFMHLTNYSVNKKNSEYQTNSDDKACQGHKWALKALWQYLGYRGVNTTLIWDKIKDMVVKTIIAADPYVNSLVKMHLRSSYSCHELFGFDIMLDENLKPWVLEVNISPSLHSNSALDVSIKGQMIRDVLNLAGFVLPHSEDVLPPGSSDSSSTSSLCGGVREKSRSDL---SADEKVKRAFYLTQ----------------------RFGDQD-FYSTVLDVLTPDDVRVLAETEDELSRQGEFERVFPSPT---SSRYLRFFEHPRYLNILLNQWEQKFCQNRSKGIEQLRSLCQRKVHL-----GNLDGSVHHW 1046          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 310.071 bits (793), Expect = 9.687e-87
Identity = 160/413 (38.74%), Postives = 257/413 (62.23%), Query Frame = 3
Query: 2052 TNDW-ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEP--SDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPV 3278
            +ND+ +++ G H+K  + ++++D+Q+VNHFP S +L RKDRL++NI RMQQ  G   F  +PQTF LP + + F  C      K  WIIKP AS+RG G+ +V   +QIP    ++V +YI+NP LI+D KFD+RLYV +T  +P+ +Y+Y++GL RFA+ KY +++K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++  Y+++ G +T  +  +I+DL++K ++SAE  I+ +  ++     +  EL+GFDV++D NLKPW+LEVN+SPSL  D+PLD+ IK  MI DMF++ G+V  +P    +     G   S +N T  +   F          +    SK+      AT+    + +       + LD LT  + + L +  +E+ERRG F R++P 
Sbjct:   88 SNDYNLMWTGTHLKTYLLRTLQDFQRVNHFPRSHELTRKDRLYKNIQRMQQTYGFQNFHIVPQTFVLPAEYQEF--CNYFSKDKGPWIIKPVASSRGRGIYLVSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLIDSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLVGFVCQDPVVKQMRSDKAGLDSSVKNQTQKTQRSF---------SAQSAKSKVHQRPLSATDTDADQKEKQGGKQVERLD-LTAEEAKVLRRTQEEHERRGGFIRIFPT 488          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008895.1 (pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 gene:ENSPMAG00000008053.1 transcript:ENSPMAT00000008895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.202 bits (622), Expect = 8.817e-72
Identity = 134/346 (38.73%), Postives = 213/346 (61.56%), Query Frame = 3
Query: 1932 KFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDW-ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICG 2963
            KF+R  + L     V+  +G  GF                +ND+ +++ G H K    +S+ D+QKVNHFP S++L RKDRL +N+ RMQQ  G   F+ IP TF LP + + F  C      +  WI+KP AS+RG GV +V   NQ+     I+V +Y+ NP LI+D KFD+RLYV +T   PL +YLY++GL RFA+ KY  + K + N+++HLTNYS+NK++ +Y+  +D E    G+KWS+ ++   +K+ G +T  +  RI+DL+VKT++S E+ I++SV ++     +   + G  V+L +  + ++L +++S +L SD+PLD+ +K  M+ DMF++ G
Sbjct:   68 KFVRTESRL-----VRNILGSHGFHEV----------HPSSNDFNLMWTGTHPKPFSLRSLTDFQKVNHFPRSYELTRKDRLCKNVQRMQQSHGHKHFNIIPATFLLPAEYQDF--CSAHSKDRGPWIVKPVASSRGRGVYLVNSPNQVTMDENILVSRYLGNPLLIDDFKFDVRLYVLVTSYEPLVIYLYEEGLTRFATVKYDRNSKFIKNQFMHLTNYSVNKKSRDYVSCDDPEVEDFGNKWSMSAMLRCLKQDGHDTTALMARIEDLIVKTILSVEQTIASSVRMFVPHRGNCFGMMGLGVLLYKRGRTFLLHLDLSLTLCSDAPLDLKVKASMVSDMFSLVG 396          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004193.1 (pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 gene:ENSPMAG00000003831.1 transcript:ENSPMAT00000004193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.842e-30
Identity = 51/99 (51.52%), Postives = 75/99 (75.76%), Query Frame = 3
Query: 2658 SLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFN 2954
            +LK+LW Y+  +GV+   +W +IKD+ VKT+I++E  +S+ +  +  +  S  ELFGFDV+LDE LKPW+LEVN+SPSLHS+SPLD+ +K  +IKD+ N
Sbjct:    1 ALKALWGYLCDKGVDCRTIWEQIKDIAVKTVIASEPFVSSLLAQFVGNRRSCHELFGFDVMLDEKLKPWLLEVNISPSLHSNSPLDVAVKVQLIKDLVN 99          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 97.4413 bits (241), Expect = 5.580e-21
Identity = 66/263 (25.10%), Postives = 126/263 (47.91%), Query Frame = 3
Query: 2223 DFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARG----IGV----------KVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYS-NSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVN---TDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNI 2957
            +  PQ   L   L   +   +  G+++ W++KP A +RG     GV          ++V     + K    +VQKY+  P LI+ +KFD+R +  +TD NPL V+ Y D  +RF++  +  +++ T     +HL N SI K + E       +  + + W  +   +Y++  G+       V   +K  ++  + +A++ + A    +        EL+G D +L E+ +PW+LE+N SP++   +P+   +   +  D+  +
Sbjct:  266 ELAPQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDNLDT----SIHLCNNSIQK-HFENAQGRSAQLPRDNIWHGRQFVSYLESLGLGFAWEGVVVPGMKQAIIHALQAAQDVVDARRGSF--------ELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRV 515          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 97.4413 bits (241), Expect = 5.950e-21
Identity = 66/263 (25.10%), Postives = 126/263 (47.91%), Query Frame = 3
Query: 2223 DFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARG----IGV----------KVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYS-NSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVN---TDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNI 2957
            +  PQ   L   L   +   +  G+++ W++KP A +RG     GV          ++V     + K    +VQKY+  P LI+ +KFD+R +  +TD NPL V+ Y D  +RF++  +  +++ T     +HL N SI K + E       +  + + W  +   +Y++  G+       V   +K  ++  + +A++ + A    +        EL+G D +L E+ +PW+LE+N SP++   +P+   +   +  D+  +
Sbjct:  293 ELAPQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDNLDT----SIHLCNNSIQK-HFENAQGRSAQLPRDNIWHGRQFVSYLESLGLGFAWEGVVVPGMKQAIIHALQAAQDVVDARRGSF--------ELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRV 542          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Sea Lamprey
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 73.1738 bits (178), Expect = 1.159e-13
Identity = 61/265 (23.02%), Postives = 107/265 (40.38%), Query Frame = 3
Query: 2223 DFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRR--------------------PIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEY-------------LDNNDNEACKGHK-----WSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSD 2903
            DF P T  L    E   + ++S     KWI KP    +G G+ ++     +   R                      +VQ+Y++NP L++  KFD+R Y+ I    P  + L+  G  R +   YS     L     HLTN  + K++  Y              +++ NE C  HK     W L +                 R++ ++    ++ +  +   + L+        +L G D ++DE+ K W+LE+N +P+L ++
Sbjct:  100 DFFPHTLRLDVRGER-DEFFDSYQEGEKWICKPTGLNQGRGIFLLRSAGDVAALRERLLLDADAGPRTPRAHVPQARIVQRYVTNPLLLDGRKFDVRSYMLIASAAP-PIVLFRHGYARLSCQSYSPESNDLT---AHLTNQYMQKKSPVYQEVKEETVWTMSRFNDHVNEHCAPHKGLPKDWVLTTFTK--------------RMQQVMTHCFLATKSKLEGKLGLF--------DLIGCDFLIDEDFKVWLLEMNCNPALQTN 337          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Nematostella
Match: EDO38145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP2])

HSP 1 Score: 499.204 bits (1284), Expect = 1.109e-164
Identity = 247/511 (48.34%), Postives = 338/511 (66.14%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQN-IEYLDNNDNEACKGHKW-SLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKY 3368
            L  S F+ V P I+F  EGEK+E LP  LRK LRW+ S +TP +VKQ I  SGF+P++             +DW+ Y+GKHMK   FKSIR+YQKVNHFPG+FQ+GRKDRLWRN+ +M    G  EF F+PQT+ LP D +L K+ W+ GGS+ KWI+KPPASARGIG++V++KW QIP++RP++VQKY+  P+LIN SKFDLR+YV++T  +PL++Y+++DGLVRFA+ KYS+S+K+L NR++HLTNYS+NK+N   Y  N D+  C+GHKW  LKSLW Y K+ G+N   VW  +KD++VK +I+++  ++  +    +      ELFG DV+LDENLKPW+LEVN+SPSLHS+S LD  IKG MI+D+ N+  + +PE  ++   T   A S  +F    S   +         S+DE  + KH   V  N  E            ILD LTP DVR L++  DEY RRG F+R +P      S +YL +FE   Y N+L+  +  K+
Sbjct:    4 LTASLFAYVQPTIHFTVEGEKVESLPSDLRKLLRWKMSSITPNVVKQCIAWSGFRPTK-----------RAHDWLGYWGKHMKSTTFKSIREYQKVNHFPGTFQIGRKDRLWRNLSKMMVHHGKKEFGFLPQTYVLPYDFKLLKRAWDEGGSRQKWILKPPASARGIGIRVIHKWTQIPRKRPVIVQKYLHKPFLINGSKFDLRIYVYVTSYDPLRIYIFEDGLVRFATCKYSSSVKSLSNRFMHLTNYSVNKKNEGAYQSNADDSLCQGHKWYYLKSLWGYFKRMGINHAQVWDSVKDVIVKAIIASDSFVNTLIKQNVRHRSCCHELFGCDVMLDENLKPWLLEVNISPSLHSNSQLDRNIKGQMIRDLMNLAAFRIPE--NLVTTTTASASSLNSFVQDKSTTSL---------SSDE--RAKHAFYVGRNVDE-------RTRQSILDILTPSDVRILMETEDEYSRRGCFQRAFPSM---VSHKYLRFFESTRYYNILLDEWTRKF 480          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Nematostella
Match: EDO40146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W3])

HSP 1 Score: 285.034 bits (728), Expect = 5.232e-85
Identity = 155/424 (36.56%), Postives = 246/424 (58.02%), Query Frame = 3
Query: 2034 DLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDS---------KFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACK-GHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 3275
            ++    +N  +++ G H+K    + ++D+QK+NHFP S++L RKDRL++NI R+Q   G   FDFIP +F LP +   F   +     +  WI+KP AS+RG G+ ++   +Q+P    ++V +YI+NP LI+ +         KFD+RLYV +T  +PL++YLY++GL RFA+ KY  S K + N  +HLTNYS+NK++  ++   D E    G+KWS+ ++  ++K +G++T  +  RI+D+VVKT+I+ E  I+++  ++     +  E++GFD+++DENL+PW+LEVN+SPSL  DSPLD+ IK  ++ DMFN+ G+V  +P    P          N T    D    R     +  T     +       T+    R    + L       LTP + R L Q  +EY RRG F R++P
Sbjct:   31 EVHPNSSNFNLMWTGSHLKPHSLRGMQDFQKINHFPRSYELTRKDRLYKNIQRLQHSKGLKHFDFIPNSFVLPEEYNEFYAAFMK--ERGHWIVKPVASSRGRGIFLISHPSQVPLDDHLLVCRYITNPLLIDGNIYCFNFIGFKFDVRLYVGVTCYDPLRIYLYEEGLSRFATVKYDKSGKNIRNSCMHLTNYSVNKKSENFVSCQDPEVEDYGNKWSMSAMLRFIKHKGIDTTALMMRIEDVVVKTIIAGELPIASACKMFMPHPGNCFEIYGFDILIDENLRPWLLEVNLSPSLACDSPLDLKIKSHLVTDMFNLIGFVAHDPLIRRP----------NGTRRVPDYAAARNKKYQKQRTQSAGALSTSGLRPTSAAARRKAVDEEL------TLTPEESRILRQTKEEYARRGGFVRIFP 436          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Nematostella
Match: EDO42060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K6])

HSP 1 Score: 207.608 bits (527), Expect = 1.528e-59
Identity = 112/291 (38.49%), Postives = 171/291 (58.76%), Query Frame = 3
Query: 2100 FKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCW--ESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGY 2966
            ++  R +Q++NHFP +  + RKD L RN+ RM+   G++ F+F P +F LP D   F   +  +   +K+ WI KP   +RG G+ +      +      VVQ+YIS+P LI   KFDLRLYV +T  +PL +Y+Y +G+VRF++ K+   + TL N + HLTN SINKQ   Y  + +     G KW+L  L  Y  +  +    +WHRI  +++ T+++    +S       KS  +  EL+GFD+++DENLKPW+LEVN SPSL SD  +D+ IK  ++ D F +  +
Sbjct:   53 YEDCRPWQRLNHFPKTSAITRKDCLARNLRRMRGVYGNYLFNFAPLSFNLPNDYRKFVAEYSKKKDATKNIWICKPADLSRGRGIFLFENLLDLTYDSAAVVQRYISSPLLICGYKFDLRLYVLVTSFHPLCIYVYHEGMVRFSTEKFD--LSTLSNLFSHLTNSSINKQGPSYSLDKERIG-TGCKWTLSQLRAYFHQHNIGDGMLWHRINTIIILTLLTQAPEVS-------KSCTNCFELYGFDILIDENLKPWLLEVNFSPSLGSDCLVDLTIKKPLLNDTFELLNF 333          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Nematostella
Match: EDO45410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT71])

HSP 1 Score: 204.527 bits (519), Expect = 1.820e-56
Identity = 145/478 (30.33%), Postives = 238/478 (49.79%), Query Frame = 3
Query: 2100 FKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQ-CWESGGSKHK--WIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIK-TLHNRYVHLTNYSINKQNIEY-LDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQ------ELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYE--RRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNSSG 3494
            F  ++ YQ++NHFPG  ++ RKD L RNI +M++     E+ F PQT+ LP +   F+  C E    K    +I+KP   A G G+ ++   ++IP    +V+Q+YI  P+L++  KFDLR+YV +T  +PL++++Y+DGLVR  +  Y    +  +   ++HLTNYSINK N  +  D ND+    G K S+K L  +++    + + +W  I +++VKT+I A+  +  S  + C+   +        EL GFD++LD  LKPW+LE+N SPS  +DS LD  +KGG ++D   +         +++P+   R  + E        L    +   Y  S  E+ K K  ++   N  + R           L+ L     R      +E+E    G+F RVYP      +++Y         L L   +   +   N   + L E   ++ L L+ Q   D+  ++ +   P S G
Sbjct:   51 FIELKPYQRINHFPGMGEICRKDSLARNIAKMKR-AHPDEYSFAPQTWVLPAEYAAFQMYCRELKKKKRAKTFIMKPANGAMGNGISLIRNGDRIPSHEQLVIQEYIDRPFLLDGYKFDLRVYVLVTSCDPLRIFVYNDGLVRLGTECYEPPTEDNMDELFMHLTNYSINKHNENFERDENDD---MGSKRSIKWLNEWLQSMDYDVNFLWRGITEVIVKTLIVAQPHVLHSYRM-CRPGAATGSDSVCFELLGFDILLDRKLKPWLLEINRSPSFGTDSKLDQEVKGGALRDTLRLL--------NIKPSDRRRGMAAEKAE-SQRRLLTQPKRSEYTMSVSELDKKKMILNKRRNELKER-----------LNQLRRESAR------EEFENINMGNFRRVYPPDDRAKNEKYTGLLADAFKLFLSGRAAALQKDGNQPFSTLRE---EEILDLLEQCEADENTAQPLGYRPLSKG 494          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Nematostella
Match: EDO34389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH2])

HSP 1 Score: 188.348 bits (477), Expect = 1.047e-51
Identity = 108/312 (34.62%), Postives = 180/312 (57.69%), Query Frame = 3
Query: 2049 ETNDWILYF-GKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSN-SIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTY----SVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGY 2966
            E +DW L++    +       ++ YQK+NHFPG  ++ RKD L RN+ R+ ++    ++   P+T+ LP D   F Q +        +I KP + ++G G+ +      I     +V Q+Y+S P+LI+  KFDLR+YV +T  +PL+V++Y+DGL RFA++KY+      L +  +HLTNYSINK + +++   D E   G K  + ++ N+  + G +   +W  I+D ++KT+++A   +  +    C   +    +  E+ GFDV+LD+ LKPW++EVN SPS  +DSPLD  IK G++ D   +  +
Sbjct:   28 EEDDWSLFWIDCSVALERCMEMKRYQKINHFPGMSEICRKDLLARNMNRLWKQF-PKDYAVFPKTWVLPADYGDF-QSYCRQKKNKTFITKPESGSQGKGIVITKNPKDIKPGEHLVCQQYVSKPFLIDGFKFDLRIYVLVTSCDPLRVFVYEDGLARFATSKYTEPQNNNLDDICMHLTNYSINKHSKDFI--RDEEI--GSKRRITTINNWFVENGYDLKEIWDGIEDCIIKTLVTAHPILKHNYRT-CFPNHNKGSACFEILGFDVLLDKKLKPWVIEVNHSPSFTTDSPLDKEIKEGLMSDALALLNF 332          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Medaka
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:NCBI gene;Acc:101171290])

HSP 1 Score: 508.064 bits (1307), Expect = 1.968e-161
Identity = 255/555 (45.95%), Postives = 369/555 (66.49%), Query Frame = 3
Query: 1818 KETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEP--STDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLNLLVTSFLTKYSRN-NQGTRLLENLCQKKLHLISQHNGDKIDSKHVW 3473
            +E +    L+ S F  +PP + F    EK+E LP + R+ L+W+ S +TP +VK T+ RS FK ++           + +DW+  +G HM+   FK + ++QK+NHFPG+FQ+GRKDRLWRN+ +M+   G  EF F P+TF LP D++  ++ WE GGSK KWIIKPPASARG+G++V++KW+Q+P +RP++VQKY+  PYLI+ +KFDLR+YV++   +PL++Y++ DGLVRFAS KYS+S+KTL N+++HLTNYS+NKQN EY  N+D++AC+GHKW+LK+LW  +  RGVNT  +W +IKD+V+KT+I++E  +   + ++ KS YS  ELFGFD++LDENLKPWILEVN+SPSLHS S LD+ IKG MI+D+ N+ G+ LP+  + E +    A S  + +  SS   +       +P  S DE  K   ++S      +F  D   +L   +LD LTP DVR L +  DE  RRG FER++P  S   S RYL +FE   Y N+L+  +  KY  +  +   LL+ LCQ+++HL +       D  H+W
Sbjct:  355 EEREERPALVPSLFPFIPPTLYFSTANEKVELLPAEQRRLLKWKLSTVTPNVVKYTVDRSHFKVTK-----------KGHDWLGCWGHHMRSLGFKELGEHQKLNHFPGTFQIGRKDRLWRNLSKMRLRYGKQEFSFFPRTFILPQDIKRLRKAWEDGGSKQKWIIKPPASARGVGIQVIHKWSQMPHKRPLLVQKYLHKPYLISGNKFDLRIYVYVPCYDPLRIYIFSDGLVRFASCKYSSSMKTLGNKFMHLTNYSVNKQNAEYQTNSDDKACQGHKWALKALWQLLGSRGVNTTLIWEKIKDIVIKTVIASEPYVHNLMKMHVKSPYSCHELFGFDIMLDENLKPWILEVNISPSLHSSSALDVSIKGQMIRDLLNLAGFRLPQREEEEASPCSSASSSASSSASSSTSSLS----GSKPTVSADERVKRSFYLS------QFHVD--QDLLVSVLDVLTPEDVRVLAESEDELSRRGDFERIFPSPS---SSRYLRFFETQRYFNILLDQWEQKYWNDWTKRIDLLKALCQERVHLGTS------DPAHMW 877          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Medaka
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:101164261])

HSP 1 Score: 194.897 bits (494), Expect = 5.015e-51
Identity = 106/307 (34.53%), Postives = 173/307 (56.35%), Query Frame = 3
Query: 2049 ETNDW-ILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKT-LHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQ----ELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMF 2951
            E  DW +L+    +     K ++ YQK+NHFPG  ++ RKD L RN+ RM + +   +++  P+T+CLP D   F Q +        +I KP    +G G+ +      I     ++ Q YIS P +I+  KFDLR+YV +T  +P  ++++ +GL RF ++KY+   +T + +  +HLTNYSINK +  ++ + D     G K  L +L  +++    NT+ +W  I+D+++KT+ISA   +  + +  C   ++      E+ GFDV+LD  LKPW+LEVN SPS  +DS LD  +K  ++ D  
Sbjct:   78 EDEDWTLLWTDCSVSLDRVKDMKCYQKINHFPGMNEICRKDSLARNLNRMLK-LFPKDYNIFPKTWCLPADYSDF-QVYTRAKKSKTYICKPDTGCQGKGIFITKSSKDIQHEEHMICQVYISKPLIIDGYKFDLRIYVLVTSCDPFSIFMFREGLARFCTSKYNEPTRTNVEHVCMHLTNYSINKNSENFVRDEDT----GSKRKLSTLNRHLESLNCNTEKMWEDIEDIIIKTLISAHPILKHNYHT-CFPNHTAGSACFEILGFDVLLDHRLKPWVLEVNHSPSFTTDSQLDREVKDALLYDTL 377          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 187.578 bits (475), Expect = 2.428e-48
Identity = 109/310 (35.16%), Postives = 171/310 (55.16%), Query Frame = 3
Query: 2034 DLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLP---TDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKY-SNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCK------STYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGG 2933
            D DET    W     +H K      +R+YQ++NHFPG  ++ RKD L RN+ +M +     E+ FIP+T+  P   T L+ + +       +  +I+KP   A G G+ ++    ++P +   +VQ+Y+  P+L+   KFDLR+Y+ +T  +PL+++LY+DGLVR  + KY + S   L   Y+HLTNYS+NK N  +    D    KG K S+     +++    +    W  I +LVVKT+I AE  +  +  + C+      S     E+ GFD+ILD  LKPW+LE+N +PS  +D  +D  +K G
Sbjct:   67 DDDETANLIWNDSAVQHEK---IAELRNYQRINHFPGMGEICRKDCLARNMSKMIK-CQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENF--ERDETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRM-CRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKG 369          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 187.963 bits (476), Expect = 2.608e-48
Identity = 109/310 (35.16%), Postives = 171/310 (55.16%), Query Frame = 3
Query: 2034 DLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLP---TDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKY-SNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCK------STYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGG 2933
            D DET    W     +H K      +R+YQ++NHFPG  ++ RKD L RN+ +M +     E+ FIP+T+  P   T L+ + +       +  +I+KP   A G G+ ++    ++P +   +VQ+Y+  P+L+   KFDLR+Y+ +T  +PL+++LY+DGLVR  + KY + S   L   Y+HLTNYS+NK N  +    D    KG K S+     +++    +    W  I +LVVKT+I AE  +  +  + C+      S     E+ GFD+ILD  LKPW+LE+N +PS  +D  +D  +K G
Sbjct:   67 DDDETANLIWNDSAVQHEK---IAELRNYQRINHFPGMGEICRKDCLARNMSKMIK-CQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENF--ERDETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRM-CRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKG 369          
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 188.348 bits (477), Expect = 2.780e-48
Identity = 109/310 (35.16%), Postives = 171/310 (55.16%), Query Frame = 3
Query: 2034 DLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLP---TDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKY-SNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCK------STYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGG 2933
            D DET    W     +H K      +R+YQ++NHFPG  ++ RKD L RN+ +M +     E+ FIP+T+  P   T L+ + +       +  +I+KP   A G G+ ++    ++P +   +VQ+Y+  P+L+   KFDLR+Y+ +T  +PL+++LY+DGLVR  + KY + S   L   Y+HLTNYS+NK N  +    D    KG K S+     +++    +    W  I +LVVKT+I AE  +  +  + C+      S     E+ GFD+ILD  LKPW+LE+N +PS  +D  +D  +K G
Sbjct:   67 DDDETANLIWNDSAVQHEK---IAELRNYQRINHFPGMGEICRKDCLARNMSKMIK-CQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENF--ERDETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRM-CRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKG 369          
BLAST of tubulin polyglutamylase TTLL4-like vs. Planmine SMEST
Match: SMESG000056158.1 (SMESG000056158.1)

HSP 1 Score: 1938.31 bits (5020), Expect = 0.000e+0
Identity = 1076/1079 (99.72%), Postives = 1079/1079 (100.00%), Query Frame = 3
Query:   39 MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCXXXXXXXXXXXXXXXXXXXXXXRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKCDSSFEAEKTNEKSQIKINNEVVXXXXXXXXXXXXXXXXXXXNNSVTXXXXXXXXXXXXXXXXXXXXXGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 3275
            MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSSESEDESSNEASSSDNESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIENCKDEN+KEKNLKNDSSSESTDNEVESEESSSADLSLHKCDSSFEAEKTNEKSQIKINNEV+STSTSASLSRSLSSAKPSRNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRK+LRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP
Sbjct:    1 MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSSESEDESSNEASSSDNESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIENCKDENVKEKNLKNDSSSESTDNEVESEESSSADLSLHKCDSSFEAEKTNEKSQIKINNEVLSTSTSASLSRSLSSAKPSRNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKYLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 1079          
BLAST of tubulin polyglutamylase TTLL4-like vs. Planmine SMEST
Match: SMESG000056158.1 (SMESG000056158.1)

HSP 1 Score: 1934.07 bits (5009), Expect = 0.000e+0
Identity = 1064/1080 (98.52%), Postives = 1072/1080 (99.26%), Query Frame = 3
Query:   39 MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCXXXXXXXXXXXXXXXXXXXX-XXRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKCDSSFEAEKTNEKSQIKINNEVVXXXXXXXXXXXXXXXXXXXNNSVTXXXXXXXXXXXXXXXXXXXXXGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 3275
            MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSS   ++ S+  +SS + ESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIENCKDEN+KEKNLKNDSSSESTDNEVESEESSSADLSLHKCDSSFEAEKTNEKSQIKINNEV+STSTSASLSRSLSSAKPSRNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRK+LRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP
Sbjct:    1 MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSSSESEDESSNEASSSDNESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIENCKDENVKEKNLKNDSSSESTDNEVESEESSSADLSLHKCDSSFEAEKTNEKSQIKINNEVLSTSTSASLSRSLSSAKPSRNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKYLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 1080          
BLAST of tubulin polyglutamylase TTLL4-like vs. Planmine SMEST
Match: SMESG000056158.1 (SMESG000056158.1)

HSP 1 Score: 1914.43 bits (4958), Expect = 0.000e+0
Identity = 1021/1080 (94.54%), Postives = 1033/1080 (95.65%), Query Frame = 3
Query:   39 MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCXXXXXXXXXXXXXXXXXXXX-XXRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVINNAGTKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHKCDSSFEAEKTNEKSQIKINNEVVXXXXXXXXXXXXXXXXXXXNNSVTXXXXXXXXXXXXXXXXXXXXXGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 3275
            MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSS   ++ S+  +SS + ESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSV  +   K++  +  +                              LHKCDSSFEAEKTNEKSQIKINNEV+STSTSASLSRSLSSAKPSRNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRK+LRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP
Sbjct:    1 MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVLNNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNREPCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSNEIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLSLNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIYNPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKESLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQEIISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSSSESEDESSNEASSSDNESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENKISIPQNENYSVQKSKIVKMKIEESSSADLS--------------------------LHKCDSSFEAEKTNEKSQIKINNEVLSTSTSASLSRSLSSAKPSRNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHLPLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKYLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTLPSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQILDCLTPRDVRCLVQCVDEYERRGHFERVYP 1054          
BLAST of tubulin polyglutamylase TTLL4-like vs. Planmine SMEST
Match: SMESG000073336.1 (SMESG000073336.1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.342e-137
Identity = 201/384 (52.34%), Postives = 280/384 (72.92%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGS-HEFDFIPQTFCLPTDLELFKQCW--ESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKR-GVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEP 2981
             I S FSN+PPVI FV EGE +  +P   R  L+WR S +TP +VK+ + RSGFK +  +G            WI YFG H+K   F++I ++QK+NH PGSFQ+GRKDRLWRN+  +  +    HEF+F+P+T+CLP DL+L K+ W  E    K KWI+KPPA+ARGIGV+V+ KW+Q+PK+R  ++Q YIS P+LINDSKFDLR+YV IT  +PL++Y+Y +GLVRFAS KYS S K + NR++HLTNYS+NK+N +YL+N D+  C+GHKW+L++LW + ++   ++   +W  IKD ++KT+IS E  I++++ ++C +   V ELFGFDV+LD NLKPW+LEVNVSPSLHS+SPLDI +K  +I D+FN+ G+ L +P
Sbjct:  318 FINSLFSNIPPVIRFVREGESVMEIPRGYRPMLKWRYSAITPNVVKRAVKRSGFKLTNKSGV----------KWIGYFGSHLKSSGFRTINEHQKINHMPGSFQIGRKDRLWRNVTALSSKKSKIHEFNFLPKTYCLPADLKLLKRIWDDEESRKKAKWILKPPAAARGIGVRVISKWSQVPKKRAALIQNYISRPFLINDSKFDLRIYVAITSCDPLRIYVYREGLVRFASHKYSKSSKNISNRFIHLTNYSVNKKNSDYLNNEDHNKCQGHKWTLQTLWRHFEQDLRIDWIPIWKNIKDCIIKTIISVESHINSNIKMFCTNKNCVYELFGFDVLLDHNLKPWVLEVNVSPSLHSNSPLDIEVKSSLIADLFNLVGFQLYQP 691          
BLAST of tubulin polyglutamylase TTLL4-like vs. Planmine SMEST
Match: SMESG000073336.1 (SMESG000073336.1)

HSP 1 Score: 440.654 bits (1132), Expect = 6.995e-136
Identity = 201/384 (52.34%), Postives = 280/384 (72.92%), Query Frame = 3
Query: 1842 LIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTIGRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHFPGSFQLGRKDRLWRNIYRMQQEIGS-HEFDFIPQTFCLPTDLELFKQCW--ESGGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDSKFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNYSINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKR-GVNTDNVWHRIKDLVVKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSPSLHSDSPLDIIIKGGMIKDMFNICGYVLPEP 2981
             I S FSN+PPVI FV EGE +  +P   R  L+WR S +TP +VK+ + RSGFK +  +G            WI YFG H+K   F++I ++QK+NH PGSFQ+GRKDRLWRN+  +  +    HEF+F+P+T+CLP DL+L K+ W  E    K KWI+KPPA+ARGIGV+V+ KW+Q+PK+R  ++Q YIS P+LINDSKFDLR+YV IT  +PL++Y+Y +GLVRFAS KYS S K + NR++HLTNYS+NK+N +YL+N D+  C+GHKW+L++LW + ++   ++   +W  IKD ++KT+IS E  I++++ ++C +   V ELFGFDV+LD NLKPW+LEVNVSPSLHS+SPLDI +K  +I D+FN+ G+ L +P
Sbjct:  318 FINSLFSNIPPVIRFVREGESVMEIPRGYRPMLKWRYSAITPNVVKRAVKRSGFKLTNKSGVK----------WIGYFGSHLKSSGFRTINEHQKINHMPGSFQIGRKDRLWRNVTALSSKKSKIHEFNFLPKTYCLPADLKLLKRIWDDEESRKKAKWILKPPAAARGIGVRVISKWSQVPKKRAALIQNYISRPFLINDSKFDLRIYVAITSCDPLRIYVYREGLVRFASHKYSKSSKNISNRFIHLTNYSVNKKNSDYLNNEDHNKCQGHKWTLQTLWRHFEQDLRIDWIPIWKNIKDCIIKTIISVESHINSNIKMFCTNKNCVYELFGFDVLLDHNLKPWVLEVNVSPSLHSNSPLDIEVKSSLIADLFNLVGFQLYQP 691          
The following BLAST results are available for this feature:
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL41.337e-17250.00tubulin tyrosine ligase like 4 [Source:HGNC Symbol... [more]
TTLL47.031e-17150.00tubulin tyrosine ligase like 4 [Source:HGNC Symbol... [more]
TTLL47.031e-17150.00tubulin tyrosine ligase like 4 [Source:HGNC Symbol... [more]
TTLL43.161e-10548.21tubulin tyrosine ligase like 4 [Source:HGNC Symbol... [more]
TTLL56.933e-8537.84tubulin tyrosine ligase like 5 [Source:HGNC Symbol... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll-43.429e-10437.33Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-44.210e-10437.33Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-44.210e-10437.33Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-52.238e-6235.53Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-55.881e-6235.53Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL4B1.951e-13843.40gene:FBgn0031574 transcript:FBtr0077501[more]
TTLL4B1.951e-13843.40gene:FBgn0031574 transcript:FBtr0334832[more]
TTLL4B2.846e-13843.40gene:FBgn0031574 transcript:FBtr0077502[more]
TTLL4A1.959e-13542.00gene:FBgn0026147 transcript:FBtr0304950[more]
TTLL4A1.959e-13542.00gene:FBgn0026147 transcript:FBtr0304952[more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll44.930e-17547.16tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll41.036e-17346.80tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll46.929e-17246.80tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll46.929e-17246.80tubulin tyrosine ligase-like family, member 4 [Sou... [more]
ttll42.788e-14142.17tubulin tyrosine ligase-like family, member 4 [Sou... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sart32.568e-16547.26squamous cell carcinoma antigen recognized by T ce... [more]
sart32.073e-16447.26squamous cell carcinoma antigen recognized by T ce... [more]
sart39.976e-16347.94squamous cell carcinoma antigen recognized by T ce... [more]
sart34.166e-15747.85squamous cell carcinoma antigen recognized by T ce... [more]
sart35.131e-13842.03squamous cell carcinoma antigen recognized by T ce... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttll46.051e-17649.64tubulin tyrosine ligase-like family, member 4 [Sou... [more]
Ttll45.442e-11247.06tubulin tyrosine ligase-like family, member 4 [Sou... [more]
Ttll53.393e-8937.88tubulin tyrosine ligase-like family, member 5 [Sou... [more]
Ttll53.168e-8744.81tubulin tyrosine ligase-like family, member 5 [Sou... [more]
Ttll53.168e-8744.81tubulin tyrosine ligase-like family, member 5 [Sou... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80UG8|TTLL4_MOUSE4.232e-17549.64Tubulin polyglutamylase TTLL4 OS=Mus musculus OX=1... [more]
sp|Q14679|TTLL4_HUMAN3.377e-17050.00Tubulin polyglutamylase TTLL4 OS=Homo sapiens OX=9... [more]
sp|Q09647|TTLL4_CAEEL4.362e-10337.33Tubulin polyglutamylase ttll-4 OS=Caenorhabditis e... [more]
sp|A8X9V4|TTLL4_CAEBR2.831e-9836.95Tubulin polyglutamylase ttll-4 OS=Caenorhabditis b... [more]
sp|Q6EMB2|TTLL5_HUMAN3.329e-8437.84Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HCV70.000e+050.53tubulin polyglutamylase TTLL4-like OS=Lingula ungu... [more]
V4B6F60.000e+051.28Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A210PWS80.000e+050.36Tubulin polyglutamylase TTLL4 OS=Mizuhopecten yess... [more]
A0A093F1G50.000e+049.19Tubulin polyglutamylase TTLL4 (Fragment) OS=Gavia ... [more]
A0A087QTS80.000e+047.99Tubulin polyglutamylase TTLL4 (Fragment) OS=Apteno... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll49.503e-17347.94tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll41.200e-17247.94tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll41.432e-17247.94tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll41.531e-17247.94tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll59.687e-8738.74tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008895.18.817e-7238.73pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 g... [more]
ENSPMAT00000004193.11.842e-3051.52pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 ge... [more]
ttll35.580e-2125.10tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll35.950e-2125.10tubulin tyrosine ligase-like family, member 3 [Sou... [more]
TTLL101.159e-1323.02tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO381451.109e-16448.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401465.232e-8536.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420601.528e-5938.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454101.820e-5630.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343891.047e-5134.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll41.968e-16145.95tubulin tyrosine ligase like 4 [Source:NCBI gene;A... [more]
ttll65.015e-5134.53tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
ttll72.428e-4835.16tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll72.608e-4835.16tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll72.780e-4835.16tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
back to top
BLAST of tubulin polyglutamylase TTLL4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056158.10.000e+099.72SMESG000056158.1[more]
SMESG000056158.10.000e+098.52SMESG000056158.1[more]
SMESG000056158.10.000e+094.54SMESG000056158.1[more]
SMESG000073336.12.342e-13752.34SMESG000073336.1[more]
SMESG000073336.16.995e-13652.34SMESG000073336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018939 ID=SMED30018939|Name=tubulin polyglutamylase TTLL4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3829bp
AATCTATATAAATCTTATATGTATCAAATCAAAGAAAAATGAACAAAGAA
AATCCTTCTTTACAAAGAGATCAAATTAAGCGTCCGAATTTTCACAAATT
AGTCAACTCACATTCTAATGGTCTTTCATCTCCTTTTCCATTTATGGAAT
TCGGTTTGAGCAATCAATCTAGTCTTAATTATGTTTTGAATAACTTTTCT
CGTGAATTTATCAACTCAGTTAAATCATCATCAAGCATGTCTGAAACTCA
AAATCCAAAAAAATCAACTTTAATAGACCCATATTTAAAGCCTTTAAGTT
TGGATCGTTTAAAATCAGCCAATATTTTGAATCGAGAGCCTTGTAATAAT
TCTCTAAACTCAAGTCATGATTTTATCAAATCATCGAATAATAACTTGAA
AAATAATGATTTTTCTGCCAATTTCTTTCTGCGAATTCAATCAACTAAAA
CTGATAATAATGCAGAAAACTTCCAAAGAAAATCAAACGAAATCTTTAGA
AATGGTGAAATAAAACATTCTCAAAATCAGTCGAATGGAGTTCGACCGTT
CTTTCGAGAAAATTATCCAGGCGCCACCTTGTTAGCACCAAAAGTTCCGG
CAGTTTACAAAGAAATGAAGAAAGAATCATCACTGTCATTAAATCAATCG
GAATTCTCAAAGTATTCAATCAGACCAAATACGGCGGGTCCGACTATCAA
GTCATTAAAAGATTCAATCCCAGTATCTTTGGCACCTCCGGCACCTAAAT
TCTATGTCAAGTCTTTCAAAACCGAAGCATTAATTTACAATCCAGTAGTA
AAACCAACTGAAACAATTCCAACAGAAACCAGTTTAGAATTGAATTTTAT
CTCAAATCGAAAAATTTCAAATACTCAAAATCTTTATCTACAAGTCAAAC
AAGAAGTCGAAGAATATAGAAAACAGAGACGAAAAGAATCACTATTGGAT
GTAAATATTATTCCGGAAATCAAAACTGTTGCGTCTGAAGACCTATTTCC
CATGACCTTATCCGAAGAAACTCAATCTAATATTTATCAAAATAAACCTA
TTATAATTACAAAATCCGATAAAAAAAATTTACAAGAAATCATTTCAACA
AATACTGAGAAAAGATTCATTAAACCGGAAATCAATGAAAATTCTAACGG
GAAAACAACCGCAAGACCAAAAAGTGTCACTTTTAATGACAAAATCGAAA
CGAGAGATTTTTGTGACGAGTCCAGTTCAGAAAGTGAAGATGAAAGTTCA
AACGAAGCGTCAAGTTCAGATAATGAAAGTCGTGGTTCAATTGTCTCGAC
AGAATCAGAATCTGAAGAAAATTACTCAAAATCTCCAGGAATTGAAAATA
GAAATAATGACACCCAAGAAGCATTTGTAGAAAATAAAATATCAATACCA
CAAAATGAAAATTACTCGGTTATAAATAATGCAGGTACAAAAATCGAAAA
TTGTAAAGATGAAAATCTAAAGGAAAAAAATTTGAAAAATGATAGTTCAA
GTGAGTCAACAGATAACGAAGTTGAAAGTGAAGAGAGCTCTTCTGCTGAT
CTTAGTTTACATAAATGTGATTCATCTTTTGAGGCTGAGAAAACAAATGA
AAAGTCACAAATTAAAATAAACAATGAAGTTGTCTCTACATCAACATCTG
CCTCTCTATCACGATCTTTAAGTTCTGCAAAGCCTTCTAGGAACAATTCA
GTTACCTCTAAGTCATTGGCGCATTCAGAAAAACATCATAAAAAGCTACA
TTCAGAATCAAAATCCAAAGGCAGTGAATTCCTAACCAAGCATGACCTTC
TTGAAATGACTGCTTTCAAAGAAACTAAACATCATTTGCCATTAATATTT
TCCAAGTTTTCAAACGTTCCACCTGTTATTAATTTCGTCGGAGAAGGCGA
AAAAATCGAACCTTTGCCATTTCAACTTCGCAAGTTTTTAAGATGGCGAA
CAAGTCTTCTAACTCCTGTTATTGTCAAACAGACCATTGGTAGATCAGGG
TTCAAACCATCAAGATACACTGGATCAGGTGACGATTTAGACGAAACGGA
AACTAATGATTGGATTCTATATTTTGGAAAGCATATGAAAGGTCCAGTAT
TTAAATCCATAAGAGACTATCAAAAAGTAAATCATTTTCCTGGATCATTT
CAACTTGGTCGTAAAGACAGGTTATGGCGTAATATCTATCGAATGCAACA
AGAAATTGGGTCTCATGAATTTGATTTTATTCCTCAAACATTTTGTCTCC
CTACAGATTTGGAGTTATTCAAGCAATGCTGGGAGTCTGGAGGCAGTAAA
CATAAATGGATAATTAAACCACCAGCATCAGCTAGAGGAATCGGAGTGAA
GGTTGTATACAAATGGAATCAAATACCGAAGAGACGGCCTATTGTTGTTC
AAAAATATATTTCGAATCCCTACCTTATAAACGACAGCAAATTCGATCTA
CGACTTTACGTATTCATAACTGATATTAACCCTTTGAAAGTTTATCTCTA
CGATGATGGCTTAGTTCGATTTGCATCTACAAAATATTCAAATTCCATCA
AAACTCTTCATAATAGATATGTTCATCTTACTAATTATTCGATAAATAAA
CAAAACATTGAGTATCTAGACAACAATGATAATGAGGCTTGCAAGGGTCA
CAAATGGTCATTAAAATCCCTATGGAATTATATGAAGAAACGAGGAGTTA
ATACTGATAATGTATGGCATAGAATTAAAGATTTAGTTGTCAAAACCATG
ATATCGGCAGAAGAGGCAATTAGTGCATCAGTAAACCTGTATTGCAAATC
GACATACTCAGTGCAAGAATTATTTGGATTCGATGTGATATTAGACGAAA
ATTTGAAACCCTGGATCCTTGAAGTCAATGTGTCTCCTAGCCTTCATTCC
GATTCACCACTTGATATAATCATAAAAGGTGGAATGATTAAGGATATGTT
TAACATTTGTGGTTATGTATTGCCTGAACCTTCTGATGTTGAACCAGCTA
CATTGGGTAGAGCAAAATCCCCTGAGAACTTTACCCTACCATCTTCAGAT
TTATTCATTGATCGTCGCTTCTGGCTGTATGAGCCTAGTACAGACGAAAT
TTCAAAAATGAAACACTTTGTTTCAGTTGCAACAAATGGTACTGAATTTA
GATTTGATCCTTCTGATAATCTTCCTTATCAAATACTTGATTGTTTGACT
CCACGAGATGTCAGATGTTTAGTTCAGTGTGTTGACGAATACGAAAGACG
AGGACATTTTGAAAGAGTTTATCCAGTTTGTTCTATTAATGCTTCAAAAA
GGTATTTGTCATATTTTGAAAGAGTTCATTATCTCAATCTATTGGTGACT
TCCTTCTTGACCAAATATAGCCGCAATAATCAAGGAACACGTTTGTTGGA
AAATTTGTGCCAAAAAAAATTACATTTAATCTCTCAGCATAACGGGGATA
AAATTGACTCGAAACACGTGTGGAAGATGCCAAATTCCTCTGGAGATAAT
TATTAGATTATTTATATTTTATTGAATTTTATTTTTTCTCGACAATTCAA
AACGTGCCTTTAAATTACAAACGATTTAAATTAATGTGATTTATATTTTT
CTACTATCAAAATTTCCTGTCGATTACTTGACACGAAAATGTCACTACTT
CTTATTGAAAACTGACAACGATTTTAGATCTATTTAAATATGTGACAATC
TTTCATCGCATTTATTCGCTCATGGAGCTCTATCTATGGAACAATGTTCG
TAAAGTATTTATTGAACTATTGTAAGTTATTTAAGTAATAAAAATGTGGA
AATTATATTGAAAATATAATTGAAATGAC
back to top

protein sequence of SMED30018939-orf-1

>SMED30018939-orf-1 ID=SMED30018939-orf-1|Name=SMED30018939-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1156bp
MNKENPSLQRDQIKRPNFHKLVNSHSNGLSSPFPFMEFGLSNQSSLNYVL
NNFSREFINSVKSSSSMSETQNPKKSTLIDPYLKPLSLDRLKSANILNRE
PCNNSLNSSHDFIKSSNNNLKNNDFSANFFLRIQSTKTDNNAENFQRKSN
EIFRNGEIKHSQNQSNGVRPFFRENYPGATLLAPKVPAVYKEMKKESSLS
LNQSEFSKYSIRPNTAGPTIKSLKDSIPVSLAPPAPKFYVKSFKTEALIY
NPVVKPTETIPTETSLELNFISNRKISNTQNLYLQVKQEVEEYRKQRRKE
SLLDVNIIPEIKTVASEDLFPMTLSEETQSNIYQNKPIIITKSDKKNLQE
IISTNTEKRFIKPEINENSNGKTTARPKSVTFNDKIETRDFCDESSSESE
DESSNEASSSDNESRGSIVSTESESEENYSKSPGIENRNNDTQEAFVENK
ISIPQNENYSVINNAGTKIENCKDENLKEKNLKNDSSSESTDNEVESEES
SSADLSLHKCDSSFEAEKTNEKSQIKINNEVVSTSTSASLSRSLSSAKPS
RNNSVTSKSLAHSEKHHKKLHSESKSKGSEFLTKHDLLEMTAFKETKHHL
PLIFSKFSNVPPVINFVGEGEKIEPLPFQLRKFLRWRTSLLTPVIVKQTI
GRSGFKPSRYTGSGDDLDETETNDWILYFGKHMKGPVFKSIRDYQKVNHF
PGSFQLGRKDRLWRNIYRMQQEIGSHEFDFIPQTFCLPTDLELFKQCWES
GGSKHKWIIKPPASARGIGVKVVYKWNQIPKRRPIVVQKYISNPYLINDS
KFDLRLYVFITDINPLKVYLYDDGLVRFASTKYSNSIKTLHNRYVHLTNY
SINKQNIEYLDNNDNEACKGHKWSLKSLWNYMKKRGVNTDNVWHRIKDLV
VKTMISAEEAISASVNLYCKSTYSVQELFGFDVILDENLKPWILEVNVSP
SLHSDSPLDIIIKGGMIKDMFNICGYVLPEPSDVEPATLGRAKSPENFTL
PSSDLFIDRRFWLYEPSTDEISKMKHFVSVATNGTEFRFDPSDNLPYQIL
DCLTPRDVRCLVQCVDEYERRGHFERVYPVCSINASKRYLSYFERVHYLN
LLVTSFLTKYSRNNQGTRLLENLCQKKLHLISQHNGDKIDSKHVWKMPNS
SGDNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR013815ATP_grasp_subdomain_1
IPR027748TTLL-4
IPR001024PLAT/LH2_dom
IPR004344TTL/TTLL_fam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0015631tubulin binding
GO:0016874ligase activity
GO:0070739protein-glutamic acid ligase activity
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
GO:0018095protein polyglutamylation
GO:0018200peptidyl-glutamic acid modification
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 282..302
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 712..957
e-value: 1.4E-65
score: 223.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 544..565
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 372..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 544..584
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 482..496
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 368..445
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 482..514
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 415..445
NoneNo IPR availablePANTHERPTHR12241TUBULIN TYROSINE LIGASE-RELATEDcoord: 486..1132
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 734..979
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 739..799
e-value: 1.4E-65
score: 223.2
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePFAMPF03133TTLcoord: 700..982
e-value: 3.2E-94
score: 315.4
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePROSITEPS51221TTLcoord: 637..992
score: 53.727
IPR027748Tubulin polyglutamylase TTLL-4PANTHERPTHR12241:SF145TUBULIN POLYGLUTAMYLASE TTLL4coord: 486..1132