GCR073

Overview
NameGCR073
Smed IDSMED30018934
Length (bp)1180
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR073 (SMED30018934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR073 (SMED30018934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018934SMESG000074847.1 SmedASXL_000094SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018934SMESG000074847.1 dd_Smed_v6_41405_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR073 vs. Ensembl Human
Match: NPSR1 (neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:HGNC:23631])

HSP 1 Score: 95.5153 bits (236), Expect = 3.776e-21
Identity = 89/326 (27.30%), Postives = 148/326 (45.40%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYP-LVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +F T + +K+S++++      + QLA  D    L  +LT   W     +     +C++++  Q   +Y STY++  +S+DR  AI  P+  L    +  +++I+  W  SFL +IP +++F         V  +     D+     M +   LVY + + +I I      Y ++I TI ++SK YE                                          VI+  S+      KL S   + L+S+AKIK  + S III  F+ CW PY+++ +   L N  L+  T  +  + SV IQ+L +LNSA NP+IY
Sbjct:   66 GNSVVLFSTWRRKKKSRMTF-----FVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQG-EKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIM-----YGIVIRTIWIKSKTYET-----------------------------------------VISNCSDG-----KLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDI---LDNFNLLPDT-QERFYASVIIQNLPALNSAINPLIY 330          
BLAST of GCR073 vs. Ensembl Human
Match: NPSR1 (neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:HGNC:23631])

HSP 1 Score: 95.5153 bits (236), Expect = 4.577e-21
Identity = 89/326 (27.30%), Postives = 148/326 (45.40%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYP-LVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +F T + +K+S++++      + QLA  D    L  +LT   W     +     +C++++  Q   +Y STY++  +S+DR  AI  P+  L    +  +++I+  W  SFL +IP +++F         V  +     D+     M +   LVY + + +I I      Y ++I TI ++SK YE                                          VI+  S+      KL S   + L+S+AKIK  + S III  F+ CW PY+++ +   L N  L+  T  +  + SV IQ+L +LNSA NP+IY
Sbjct:   66 GNSVVLFSTWRRKKKSRMTF-----FVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQG-EKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIM-----YGIVIRTIWIKSKTYET-----------------------------------------VISNCSDG-----KLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDI---LDNFNLLPDT-QERFYASVIIQNLPALNSAINPLIY 330          
BLAST of GCR073 vs. Ensembl Human
Match: NPSR1 (neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:HGNC:23631])

HSP 1 Score: 94.7449 bits (234), Expect = 6.020e-21
Identity = 89/326 (27.30%), Postives = 148/326 (45.40%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYP-LVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +F T + +K+S++++      + QLA  D    L  +LT   W     +     +C++++  Q   +Y STY++  +S+DR  AI  P+  L    +  +++I+  W  SFL +IP +++F         V  +     D+     M +   LVY + + +I I      Y ++I TI ++SK YE                                          VI+  S+      KL S   + L+S+AKIK  + S III  F+ CW PY+++ +   L N  L+  T  +  + SV IQ+L +LNSA NP+IY
Sbjct:   66 GNSVVLFSTWRRKKKSRMTF-----FVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQG-EKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIM-----YGIVIRTIWIKSKTYET-----------------------------------------VISNCSDG-----KLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDI---LDNFNLLPDT-QERFYASVIIQNLPALNSAINPLIY 330          
BLAST of GCR073 vs. Ensembl Human
Match: AVPR1A (arginine vasopressin receptor 1A [Source:HGNC Symbol;Acc:HGNC:895])

HSP 1 Score: 93.9745 bits (232), Expect = 2.056e-20
Identity = 83/342 (24.27%), Postives = 145/342 (42.40%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD---------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +   L L +  + + R ++  I  L+ AD+ V  F VL Q  W+I   +RG  +LC+++K  Q F ++ S Y++ +++ DR IA+C P+  L    R  +++I   W+ SF+L+ PQ  +F                 +  PW +  +    T        ++V P+V           IL TCY  I + I  NVR K     +                          A+ +G       ++   +S   +             +SRAKI+T +M+ +I++ +++CW P+++  +        +   +    I I+     L SLNS  NP IY
Sbjct:   68 GNSSVL---LALHRTPRKTSR-MHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGG------IFVAPVV-----------ILGTCYGFICYNIWCNVRGKTASRQS------------------------KGAEQAGVAFQKGFLLAPCVSSVKS-------------ISRAKIRTVKMTFVIVTAYIVCWAPFFIIQMWSVWDPMSVWTESENPTITITAL---LGSLNSCCNPWIY 348          
BLAST of GCR073 vs. Ensembl Human
Match: AVPR1B (arginine vasopressin receptor 1B [Source:HGNC Symbol;Acc:HGNC:896])

HSP 1 Score: 89.7373 bits (221), Expect = 4.917e-19
Identity = 84/347 (24.21%), Postives = 149/347 (42.94%), Query Frame = 2
Query:  107 GNTHTIFFTLKL--QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF---DAYRG------------PWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI----NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYW-VYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            G    +  TL    +KRS++     +  ++ LA  D+ V LF VL Q +W+I   ++G   LC+ +K  Q  S++ STY++  ++LDR +A+C P+  L    ++  ++I   W+ + + ++PQV +F   +  +G            PW    +   TT      L ++V P+             L  CY++I H I     V+++ +         +  P        T   P                   +R+S  +              +SRAKI+T +M+ +I+  ++ CW P++ V    +  KNA     T   N+  ++ +  L +LNS  NP IY
Sbjct:   50 GGNLAVLLTLGQLGRKRSRM-----HLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTT------LAIFVLPVTM-----------LTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLP-------------------SRVSSINT-------------ISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDST---NVAFTISML-LGNLNSCCNPWIY 338          
BLAST of GCR073 vs. Ensembl Celegans
Match: gnrr-1 (GoNadotropin-Releasing hormone Receptor (GnRHR) related [Source:UniProtKB/TrEMBL;Acc:H1ZUW9])

HSP 1 Score: 81.2629 bits (199), Expect = 1.183e-16
Identity = 73/322 (22.67%), Postives = 136/322 (42.24%), Query Frame = 2
Query:  167 RSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGP---WKTVTFYQCTTSDNL--------------NILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            R ++ +++ +  A +LV L  +  + + N  V+W  G  +C++ K    F+I LS  ++  ++LDR  +I  P++ + +  ++++ ++   W  SF+ + PQ+ LF     P   W T    QC + + +              NI+Q+Y+ PL            + V CY++I+  I+ +SK   E                                               E+  + + LL    Q  + +AK +T +M+ +I+  F+ CW PY +   L  L++   I   + K      FI + A LNSA +P +Y
Sbjct:   54 RRVHSLLLHMNIAHLLVTLVVMPKEILHNYMVAWFAGDVMCRICKFFDVFAISLSMNVLICITLDRFYSIFFPLYAMRA-RKSVQRMVSFAWTISFVTSAPQLYLFKTATHPCFDWYT----QCVSKNFIGELSNDVVFFFSIVNIIQVYIAPL-----------FVTVVCYSLILWRISRKSKLVGE----------------------------------------------KESEKSSELLLRRNGQNNLEKAKSRTLKMTFVIVLAFIFCWTPYSILMFLHFLRHTDWIPKDIRK------FIYAFAVLNSAISPYLY 307          
BLAST of GCR073 vs. Ensembl Celegans
Match: gnrr-1 (GoNadotropin-Releasing hormone Receptor (GnRHR) related [Source:UniProtKB/TrEMBL;Acc:H1ZUW9])

HSP 1 Score: 80.4925 bits (197), Expect = 1.758e-16
Identity = 79/342 (23.10%), Postives = 145/342 (42.40%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGP---WKTVTFYQCTTSDNL--------------NILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN  T+F  L   +  K+  R ++ +++ +  A +LV L  +  + + N  V+W  G  +C++ K    F+I LS  ++  ++LDR  +I  P++ + +  ++++ ++   W  SF+ + PQ+ LF     P   W T    QC + + +              NI+Q+Y+ PL            + V CY++I+  I+ +SK   E                                               E+  + + LL    Q  + +AK +T +M+ +I+  F+ CW PY +   L  L++   I   + K      FI + A LNSA +P +Y
Sbjct:   37 GNV-TMFLILCRNQLVKV--RRVHSLLLHMNIAHLLVTLVVMPKEILHNYMVAWFAGDVMCRICKFFDVFAISLSMNVLICITLDRFYSIFFPLYAMRA-RKSVQRMVSFAWTISFVTSAPQLYLFKTATHPCFDWYT----QCVSKNFIGELSNDVVFFFSIVNIIQVYIAPL-----------FVTVVCYSLILWRISRKSKLVGE----------------------------------------------KESEKSSELLLRRNGQNNLEKAKSRTLKMTFVIVLAFIFCWTPYSILMFLHFLRHTDWIPKDIRK------FIYAFAVLNSAISPYLY 307          
BLAST of GCR073 vs. Ensembl Celegans
Match: ntr-2 (Nematocin receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:O62169])

HSP 1 Score: 69.707 bits (169), Expect = 7.597e-13
Identity = 71/327 (21.71%), Postives = 140/327 (42.81%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAI-WNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWN-RNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN   +F   +  +  K     +  +I+    AD+L  L  + T+ +    +  + G +F+CKLM+  Q F +Y S +++  +S DR  AIC+P+ H  S   R    +    W  + +L+IPQ  ++  +    +  T Y      N N +++  Y +++  L  L+P  +    Y  +   + + S +              ++ D +    ++        SG+  D     I  + + S  F++ +S        R +++T R++  I++C    W+P+ +  V+  L       +    +I    ++  L +LNS  NP IY
Sbjct:   37 GNLFLLFVIFRANQVMKRRVSPVQLLIIHTCVADLLFALLSLGTEILTLRTYPQYYGSNFVCKLMRYVQMFPMYASPFLLVAISADRYQAICRPLAHFRSSRYRRPNWMAAIAWGLALVLSIPQFFVWTKHSKTGRCSTIY----GQNKNTVKI-TYVIMFNTLAWLLPSILAAVFYYCVCKAVRLSSTK------------SVRAMDSQKRNGKY-------SSGATED----YIEELRKKSKGFRQQMSE-----FDRKRVQTVRLTITIVACNFFLWMPFCLINVIQAL-------WPEISHIMFINYVAILGNLNSCLNPWIY 323          
BLAST of GCR073 vs. Ensembl Celegans
Match: gnrr-5 (GoNadotropin-Releasing hormone Receptor (GnRHR) related [Source:UniProtKB/TrEMBL;Acc:O44536])

HSP 1 Score: 69.3218 bits (168), Expect = 1.070e-12
Identity = 38/141 (26.95%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  131 TLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKI------IIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTT 535
            +L+   R+  +   +  + + L  AD++    +V  Q IW I   W GG FLC+       FS YL++++++ +++DR        +++ S N + K       ++ C W+ +FLL++PQ ++F     P++ + F QC T
Sbjct:   56 SLRAFSRTHKAKSQILLLRITLNLADLMTLFLYVPKQIIWLITYQWYGGEFLCRACAFFSTFSFYLNSFVIACIAIDRVFG----AYNISSLNAHRKAYIRCRNLLGCGWVLAFLLSLPQAVVFTT-TSPYENIDFKQCAT 191          
BLAST of GCR073 vs. Ensembl Celegans
Match: daf-38 (G-protein coupled receptor daf-38 [Source:UniProtKB/Swiss-Prot;Acc:Q9U320])

HSP 1 Score: 69.3218 bits (168), Expect = 1.193e-12
Identity = 85/362 (23.48%), Postives = 163/362 (45.03%), Query Frame = 2
Query:  134 LKLQKRSKLSYRS----LYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNI---KIIIICLWIYSFLLAIPQVLLFDAYRG-P---W-KTVTFYQCTTSDNLNILQM-------YVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQ---------FPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKT-------------YRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISV-----FIQSLASLNSAFNPIIY 1081
            L L   ++LS R     L  +   L ++D+LV   +V ++A W +   WRGG  LCK++KM   F+   S+ ++  +++DR +++  P H  HS N+ +   K+++I  WI + +++ PQ+ ++ AY   P   W + +  ++    +  N  Q+       + Y +++  L+  IP  I++  Y ++I  + + S+    H S      H   D  + +  +         F  + + K          IV++  +E     +  +S  +   + R  + T              R+S +++  +++CWLP    Y LI+     LI+F L ++ + S      F Q L   NS  NP +Y
Sbjct:   52 LNLAAYTQLSERPTSTRLDLLKRSLNYSDLLVLFIYVPSRACWLLTYDWRGGDALCKIVKMFHTFAFQSSSNVIVCIAVDRLLSVLSPSH--HSPNKALKRTKMMLIVAWIVALVISCPQLFIWKAYLALPEYNWSQCLQIWEIARMEKFNKPQVVPEFDAEFWYSILHISLVFWIPCIIIMLSYIIVISWVWINSRPSIRHTSS--FSFHTGCDTVDTVLTRASEWNPLKTFSRHVNIKEPEKPMTTPRIVVSDETEVPLTQRPSISPSEASAVMRTGVHTSTSYNANLNRSRALRVSLLLVVAYIICWLP----YNLIS-----LIQF-LDRDFFSSYLKHVHFCQQLIIFNSVVNPWLY 399          
BLAST of GCR073 vs. Ensembl Fly
Match: CrzR (gene:FBgn0036278 transcript:FBtr0075989)

HSP 1 Score: 105.916 bits (263), Expect = 1.966e-24
Identity = 94/329 (28.57%), Postives = 155/329 (47.11%), Query Frame = 2
Query:  107 GNTHTIF--FTLKLQKR-SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNI-LQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN  TI+  +  ++ +R S+ ++ ++Y ++  L+ AD+LV  F ++ +A W   V W      CKL+K+ Q FS+YLSTY++ L+ +DR IA+  P+  L+   R  + ++   +I S +L++PQ  +F   RGP+    FYQC T        Q  +Y     V   L+P+ IL   Y     TI+   K ++             S    + T + P                           N Q+L+ HK       AK+K+ R+S +II  FL+CW PY+V  ++    N       LG ++  ++F   ++  NS  NP+IY
Sbjct:  135 GNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKRCHR-LLGGTYILSLVLSLPQFFIFHVARGPF-VEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCILFGTYMSTFRTISSSEKMFQ------------GSKLANYSTAKLP------------------------TQTNRQRLI-HK-------AKMKSLRISVVIIIAFLICWTPYYVMMIMFMFLNP---DKRLGDDLQDAIFFFGMS--NSLVNPLIY 412          
BLAST of GCR073 vs. Ensembl Fly
Match: CrzR (gene:FBgn0036278 transcript:FBtr0330069)

HSP 1 Score: 105.531 bits (262), Expect = 2.979e-24
Identity = 94/329 (28.57%), Postives = 155/329 (47.11%), Query Frame = 2
Query:  107 GNTHTIF--FTLKLQKR-SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNI-LQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN  TI+  +  ++ +R S+ ++ ++Y ++  L+ AD+LV  F ++ +A W   V W      CKL+K+ Q FS+YLSTY++ L+ +DR IA+  P+  L+   R  + ++   +I S +L++PQ  +F   RGP+    FYQC T        Q  +Y     V   L+P+ IL   Y     TI+   K ++             S    + T + P                           N Q+L+ HK       AK+K+ R+S +II  FL+CW PY+V  ++    N       LG ++  ++F   ++  NS  NP+IY
Sbjct:  135 GNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKRCHR-LLGGTYILSLVLSLPQFFIFHVARGPF-VEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCILFGTYMSTFRTISSSEKMFQ------------GSKLANYSTAKLP------------------------TQTNRQRLI-HK-------AKMKSLRISVVIIIAFLICWTPYYVMMIMFMFLNP---DKRLGDDLQDAIFFFGMS--NSLVNPLIY 412          
BLAST of GCR073 vs. Ensembl Fly
Match: AkhR (gene:FBgn0025595 transcript:FBtr0079310)

HSP 1 Score: 88.1965 bits (217), Expect = 9.259e-19
Identity = 55/175 (31.43%), Postives = 89/175 (50.86%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNL------------NILQMYVYPL---VYC 586
            GN+  ++   K + R  L    +  M+M LA AD++V L  +  + +W   V W     +C+LM   + F +YLS+Y+M  +SLDR  AI KP+    S+NR  +I++ C W+ S + +IPQ  LF     P  T  ++QC   ++             ++  MY +PL   +YC
Sbjct:   55 GNSTVLYLLTKRRLRGPLR---IDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLK--RSYNRG-RIMLACAWLGSVVCSIPQAFLFHLEEHPAVT-GYFQCVIFNSFRSDFDEKLYQAASMCSMYAFPLIMFIYC 222          
BLAST of GCR073 vs. Ensembl Fly
Match: AkhR (gene:FBgn0025595 transcript:FBtr0332331)

HSP 1 Score: 88.1965 bits (217), Expect = 9.409e-19
Identity = 55/175 (31.43%), Postives = 89/175 (50.86%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNL------------NILQMYVYPL---VYC 586
            GN+  ++   K + R  L    +  M+M LA AD++V L  +  + +W   V W     +C+LM   + F +YLS+Y+M  +SLDR  AI KP+    S+NR  +I++ C W+ S + +IPQ  LF     P  T  ++QC   ++             ++  MY +PL   +YC
Sbjct:   55 GNSTVLYLLTKRRLRGPLR---IDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLK--RSYNRG-RIMLACAWLGSVVCSIPQAFLFHLEEHPAVT-GYFQCVIFNSFRSDFDEKLYQAASMCSMYAFPLIMFIYC 222          
BLAST of GCR073 vs. Ensembl Fly
Match: AkhR (gene:FBgn0025595 transcript:FBtr0079309)

HSP 1 Score: 88.1965 bits (217), Expect = 9.409e-19
Identity = 55/175 (31.43%), Postives = 89/175 (50.86%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNL------------NILQMYVYPL---VYC 586
            GN+  ++   K + R  L    +  M+M LA AD++V L  +  + +W   V W     +C+LM   + F +YLS+Y+M  +SLDR  AI KP+    S+NR  +I++ C W+ S + +IPQ  LF     P  T  ++QC   ++             ++  MY +PL   +YC
Sbjct:   55 GNSTVLYLLTKRRLRGPLR---IDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLK--RSYNRG-RIMLACAWLGSVVCSIPQAFLFHLEEHPAVT-GYFQCVIFNSFRSDFDEKLYQAASMCSMYAFPLIMFIYC 222          
BLAST of GCR073 vs. Ensembl Zebrafish
Match: gnrhr1 (gonadotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-090128-2])

HSP 1 Score: 94.3597 bits (233), Expect = 6.245e-21
Identity = 80/314 (25.48%), Postives = 144/314 (45.86%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNL-NILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            + R +     L  +I  LA AD+++    +   AIWNI V W  G  +CKL+   + F+++ + +I+ +VSLDR  AI  P+  L +  RN ++++   WI S LLA PQ+ +F A +   + V F QC T  +  +  Q   Y + + V + + P+ ++  CYT I+  IN                             Q P        G     E                 L      ++ +A++KT +M+ II++ F++CW PY++  +    +  R+++ T  + +  ++F+    +LN+  +P+IY
Sbjct:   65 RGRGRHLASHLRPLIASLASADLVMTFVVMPLDAIWNITVQWYAGDAMCKLLCFLKLFAMHSAAFILVVVSLDRHHAILHPLEALDAGRRNRRMLLAA-WILSVLLASPQLFIFRAIKA--EGVDFVQCATHGSFQHRWQETAYNMFHFVTLYVFPLLVMSFCYTRILVEIN----------------------------RQMP-------RGKGKGGE---------------PCLRRSGADMIPKARMKTLKMTIIIVASFVVCWTPYYLLGIWYWFQ-PRMLQVT-PEYVHHALFV--FGNLNTCCDPVIY 321          
BLAST of GCR073 vs. Ensembl Zebrafish
Match: oxtr (oxytocin receptor [Source:ZFIN;Acc:ZDB-GENE-110805-2])

HSP 1 Score: 92.0485 bits (227), Expect = 3.899e-20
Identity = 91/330 (27.58%), Postives = 140/330 (42.42%), Query Frame = 2
Query:  152 SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPY-----WVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            +K S   +Y  +  L+ AD++V +F VL Q IW+I   + G   LC+L+K  Q   ++ STY++ L+S+DR +AIC+P+  LH   R  +  +IC W  S L +IPQV +F               +  PW    +    +      L +Y+ P+            IL  CY +I   I  N + K               K D C  LT         K S  N       + R+S               +L+S+AKI T +M+ +I+  +++CW P+     W  +     + A  + F +            LASLNS  NP IY
Sbjct:   69 AKHSQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDILCRLVKYLQTVGMFASTYMLVLMSIDRCMAICQPLRSLH--KRKDRCYVICSWALSLLFSIPQVYIFSLREVGSGVYDCWGDFVQPWGAKAYITWIS------LTIYIIPVT-----------ILSVCYGLISFKIWQNFKRKT--------------KRDQCITLT--------PKASKGN------ALARVSS-------------VKLISKAKITTVKMTFVIVLAYIVCWTPFFSVQMWSAWDPEAPREA--MPFIIS---------MLLASLNSCCNPWIY 327          
BLAST of GCR073 vs. Ensembl Zebrafish
Match: oxtr (oxytocin receptor [Source:ZFIN;Acc:ZDB-GENE-110805-2])

HSP 1 Score: 92.0485 bits (227), Expect = 3.899e-20
Identity = 91/330 (27.58%), Postives = 140/330 (42.42%), Query Frame = 2
Query:  152 SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPY-----WVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            +K S   +Y  +  L+ AD++V +F VL Q IW+I   + G   LC+L+K  Q   ++ STY++ L+S+DR +AIC+P+  LH   R  +  +IC W  S L +IPQV +F               +  PW    +    +      L +Y+ P+            IL  CY +I   I  N + K               K D C  LT         K S  N       + R+S               +L+S+AKI T +M+ +I+  +++CW P+     W  +     + A  + F +            LASLNS  NP IY
Sbjct:   69 AKHSQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDILCRLVKYLQTVGMFASTYMLVLMSIDRCMAICQPLRSLH--KRKDRCYVICSWALSLLFSIPQVYIFSLREVGSGVYDCWGDFVQPWGAKAYITWIS------LTIYIIPVT-----------ILSVCYGLISFKIWQNFKRKT--------------KRDQCITLT--------PKASKGN------ALARVSS-------------VKLISKAKITTVKMTFVIVLAYIVCWTPFFSVQMWSAWDPEAPREA--MPFIIS---------MLLASLNSCCNPWIY 327          
BLAST of GCR073 vs. Ensembl Zebrafish
Match: avpr1ab (arginine vasopressin receptor 1Ab [Source:ZFIN;Acc:ZDB-GENE-041210-105])

HSP 1 Score: 89.3521 bits (220), Expect = 4.033e-19
Identity = 88/332 (26.51%), Postives = 144/332 (43.37%), Query Frame = 2
Query:  134 LKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF---------DAYR------GPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQS-LASLNSAFNPIIY 1081
            L +    K S R ++  I  L+ AD++V  F VL Q  W I   + G  FLC+++K  Q   ++ STY+M +++LDR IAIC P+  L    R   I+I   W+ S LL+ PQ  +F         D Y        PW    +    T      + +++ P+V           IL+ CY  I H+I    K   +  +     H+PKS                            +I + S +S             ++SRAK++T +M+ +I+  +++CW P++     + + +     F+   +   +V + + LASLNS  NP IY
Sbjct:   47 LAMHNTKKKSSR-MHLFIKHLSLADLVVAFFQVLPQLCWEITYRFYGPDFLCRIVKHLQVLGMFASTYMMVMMTLDRYIAICHPLKTLQQPTRRAYIMICSTWLCSLLLSTPQYFIFSLSEIQNGSDVYDCWGHFIEPWGIRAYITWIT------VGIFLIPVV-----------ILMICYGFICHSIWKNFKCKTKRGAA----HNPKSG---------------------------MIGKASVSS-----------VTIISRAKLRTVKMTFVIVLAYIVCWAPFFT----VQMWSVWDENFSWDDSENAAVTLSALLASLNSCCNPWIY 314          
BLAST of GCR073 vs. Ensembl Zebrafish
Match: oxtrl (oxytocin receptor like [Source:ZFIN;Acc:ZDB-GENE-110805-1])

HSP 1 Score: 88.5817 bits (218), Expect = 6.785e-19
Identity = 84/330 (25.45%), Postives = 139/330 (42.12%), Query Frame = 2
Query:  152 SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF-------------DAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPY-----WVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            SK     +Y  +  L+ AD++V +F VL Q IW+I   + G  FLC+L+K  Q   ++ STY++ L+S+DR +AI +P+  L    R  +  ++  WI S L ++PQV +F               +  PW    +    +      L +Y+ P+            IL  CY +I + I  N R K               + D C  LT +                +   ++R+S               +L+S+AKI+T +M+ +I+  +++CW P+     W  +  +  + A              +    LASLNS  NP IY
Sbjct:   71 SKHGQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVKYLQVVGMFASTYMLVLMSIDRCLAIWQPLRSLR--RRKDRFYVLASWIISLLFSLPQVYIFSLREVGDGVFDCWGDFVQPWGAKAYVTWIS------LTIYIIPVA-----------ILSVCYGLISYKIWQNFRLKT--------------RRDQCLSLTPR--------------PTKGAALSRVSS-------------VKLISKAKIRTVKMTFVIVMAYIICWTPFFFVQMWSAWDPMAPREAMAF-----------IIAMLLASLNSCCNPWIY 329          
BLAST of GCR073 vs. Ensembl Xenopus
Match: cdcp1 (CUB domain containing protein 1 [Source:Xenbase;Acc:XB-GENE-968387])

HSP 1 Score: 92.8189 bits (229), Expect = 2.906e-20
Identity = 87/320 (27.19%), Postives = 151/320 (47.19%), Query Frame = 2
Query:  173 LYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQS--LASLNSAFNPIIY 1081
            +Y  +  L+ AD++V LF VL Q IW+I   +    F+C+++K  Q   ++ STY++ L+SLDR +AIC+P+  LH   R+  + ++  WI SFLL++PQ+ +F              ++  PW   T+    T      + +Y+ P++           IL  CY +I + I  N+R K   E +SV +                             + N+   ++R+S               +L+S+AKI+T +M+ II+  +++CW P++ +  + ++ +    K         S+FI +  L SLNS  NP IY
Sbjct:   80 MYFFMKHLSIADLVVALFQVLPQLIWDITFRFYAPDFVCRIVKYLQVVGMFASTYMLLLMSLDRCLAICQPLRSLH--RRSDCVYVVLTWILSFLLSVPQIHIFSLKEVGNKVYDCSASFIEPWGLKTYITWIT------ITVYILPVM-----------ILSVCYGLISYKIWQNIRLKTMCE-SSVRL-----------------------------SSNKRATLSRVSS-------------VRLISKAKIRTVKMTFIIVLAYIVCWTPFF-FVQMWSVWDPDAPKED-------SLFIIAMLLGSLNSCCNPWIY 329          
BLAST of GCR073 vs. Ensembl Xenopus
Match: nrg3 (neuregulin 3 [Source:Xenbase;Acc:XB-GENE-984146])

HSP 1 Score: 92.0485 bits (227), Expect = 5.415e-20
Identity = 73/271 (26.94%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  146 KRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNI-LQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWV 955
            KR K   R L   I+ L+ AD+LV    +   A+WN+ V W  G   CK++  G+ F++Y +  ++ ++SLDR  AI  P+    +  RN +I++   WI S LLA PQ+ LF     P   V F QC T  +     Q   Y +     + + P+ +++ CYT I+  I  + K   E                               + S ND                          L+S+A++KT +M+ +I+  F++CW PY++
Sbjct:   68 KRCKSHLRVL---ILSLSVADLLVTFLVMPLDALWNVMVQWYAGELSCKVLNFGKLFAMYSAALVLVVISLDRHWAILYPLSFTSAGQRN-RIMLWTAWITSLLLASPQLFLFRLRTAP--GVNFTQCATHGSFTQHWQETAYNMFTFCTLFVTPLVVMIVCYTRILWEIGKQMKHKNE------------------------------LARSKND--------------------------LISKARLKTLKMTLVIVVSFMVCWTPYYL 276          
BLAST of GCR073 vs. Ensembl Xenopus
Match: AVPR1A (arginine vasopressin receptor 1A [Source:NCBI gene;Acc:100488869])

HSP 1 Score: 92.0485 bits (227), Expect = 6.641e-20
Identity = 84/331 (25.38%), Postives = 141/331 (42.60%), Query Frame = 2
Query:  149 RSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD--------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSG--SNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNA--RLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            +SK     ++  I  L+ AD+ V  F VL Q  W +   +RG   LC+++K  Q F ++ S Y++ +++ DR IAIC P+  L    +   ++II  WI SFLL+IPQ  +F                +  PW    +    T+       ++V P+            IL TCY  I + I  N++ K   E N                        +  K  G  S + +    I+R                      AKI+T +M+ +I++ ++LCW P+++    + +++   +  ++T  ++I  +V    L SLNS  NP IY
Sbjct:   77 KSKKKTSRMHLFIKHLSLADLAVAFFQVLPQLCWEVTYRFRGPDILCRIVKHLQVFGMFASAYMLVVMTADRYIAICHPLKTLQQPTKRSYVMIISAWIISFLLSIPQYFIFSFSPVNGSEVYDCWAHFIQPWGARAYITWMTAS------IFVVPVA-----------ILTTCYGFICYNIWRNIQCKTKREEN------------------------EGRKSHGLLSTSVSSVKTISR----------------------AKIRTVKMTLVIVTAYILCWAPFFI----VQMRSVWDKNFEWTDSEDIATTV-TALLGSLNSCCNPWIY 339          
BLAST of GCR073 vs. Ensembl Xenopus
Match: AVPR1B (arginine vasopressin receptor 1B [Source:NCBI gene;Acc:100487856])

HSP 1 Score: 90.5077 bits (223), Expect = 1.846e-19
Identity = 81/328 (24.70%), Postives = 143/328 (43.60%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDA---------------YRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            Q+R K++   L+  I+ L F D+ V LF +L Q IW+I   + G   LC+ +K  Q  S++ STY++ ++++DR IA+C P+  L   ++   ++I   WI S +L++PQ+ +F                 +R PW    +    T      + ++  P+           GIL+ CY++I   I                        C++L  +          G    N  +V +R+S               + +SRAKI+T +M+ +I+  ++LCW P++   +          + +      I++    LASL+S  NP IY
Sbjct:   56 QRRKKMTRMHLF--IVHLTFTDLAVALFQILPQMIWDITFRFIGSDILCRAVKYTQVMSMFASTYMLMMMTIDRYIAVCHPLKTLQQPSKQAYLMIGGTWILSCILSLPQIFIFSMKEISQGAGVIDCWADFRYPWGAKAYITWIT------VSIFFVPV-----------GILLLCYSLICCEI------------------------CKNLKGKM----QTSGVGQRESNGQVVPSRVSS-------------IRTISRAKIRTVKMTFVIVLSYILCWTPFFSVQMWSVWDENSPDEDSTDFAFTITML---LASLSSCSNPWIY 320          
BLAST of GCR073 vs. Ensembl Xenopus
Match: evx1 (even-skipped homeobox 1 [Source:Xenbase;Acc:XB-GENE-483664])

HSP 1 Score: 88.1965 bits (217), Expect = 3.974e-19
Identity = 87/333 (26.13%), Postives = 147/333 (44.14%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKR-SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDN-----LNILQMYVY--PLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  ++ T K +KR S++++      + QLA  D L  +  +    IW     +     +CK ++  Q   +Y STY++  +S+DR  AI  P+  L    +  K++I   W  SFL +IP  ++F   + P   +  +     D+     + I+ + VY  PL+           I+   Y ++I TI V+SK                                            ++I+  ++   NF    SH+   L+S+AK+K  + S ++I  F+LCW PY+++ +   L N  ++  T  +  + SV IQ L  LNSA NPIIY
Sbjct:   17 GNSVVLYLTWKERKRKSRMTF-----FVTQLAITDYLTGIISISVNIIWRFTGEFMAPEIVCKTVRYLQVVLLYASTYVLVSLSIDRYHAIVHPMKFLQG-EKQAKVLIAVSWTLSFLFSIPTFIIFGKLKLPNGEMQCWALWPDDSYWTPYMTIVALLVYFIPLI-----------IISVIYFIVIRTIWVKSK-----------------------------------------GHAVIISNYTD--GNFCTSYSHRG--LISKAKMKAIKYSIVVILAFILCWSPYFLFDI---LDNFEMLPET-KERFYASVIIQHLPFLNSAINPIIY 283          
BLAST of GCR073 vs. Ensembl Mouse
Match: Avpr1a (arginine vasopressin receptor 1A [Source:MGI Symbol;Acc:MGI:1859216])

HSP 1 Score: 98.5969 bits (244), Expect = 3.512e-22
Identity = 93/348 (26.72%), Postives = 151/348 (43.39%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQ-----VLLFDAYRG------------PWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLL----SHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +   L L +  + + R ++  I  L+ AD+ V  F VL Q  W+I   +RG  +LC+++K  Q F+++ S+Y++ +++ DR IA+C P+  L    R  +++I   W  SF+L+IPQ     V+ F+   G            PW T  +    TS       ++V P++           IL TCY  I + I  NVR K     +                           K SG              E +  F K L         + +SRAKI+T +M+ +I+S ++LCW P+++  +        +   +   +  I+     LASLNS  NP IY
Sbjct:   68 GNSSVL---LALHRTPRKTSR-MHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWMTSG------VFVVPVI-----------ILGTCYGFICYHIWRNVRGKTASRQS------------------------KGGKGSG--------------EAAGPFHKGLLVTPCVSSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL---LASLNSCCNPWIY 353          
BLAST of GCR073 vs. Ensembl Mouse
Match: Npsr1 (neuropeptide S receptor 1 [Source:MGI Symbol;Acc:MGI:2441738])

HSP 1 Score: 89.7373 bits (221), Expect = 2.676e-19
Identity = 83/330 (25.15%), Postives = 147/330 (44.55%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDN-----LNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +F T + +++S++++      + QLA  D    L  +LT  IW     +     +C++++  Q   +Y STY++  +S+DR  AI  P+  L    +  K++I   W  SFL +IP +++F         V  +     D+     + I+   VY +   ++ ++         Y ++I TI ++SK +E                                          VI+  S+      KL     + L+S+AKIK  + S +II  F+ CW PY+++ +   L N  ++  T  +  + SV IQ+L +LNSA NP+IY
Sbjct:   66 GNSVVLFSTCRRKRKSRMTF-----FVTQLAITDSFTGLINILTDIIWRFTGDFMAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQG-EKQAKVLIGIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLAIISVI---------YGLVIRTIWMKSKTHET-----------------------------------------VISNCSDG-----KLCCSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDI---LDNFNVLPDT-KERFYASVIIQNLPALNSAINPLIY 330          
BLAST of GCR073 vs. Ensembl Mouse
Match: Avpr1b (arginine vasopressin receptor 1B [Source:MGI Symbol;Acc:MGI:1347010])

HSP 1 Score: 81.2629 bits (199), Expect = 2.102e-16
Identity = 75/304 (24.67%), Postives = 130/304 (42.76%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQ--KRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF---DAYRG------------PWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI----NVRSKEYEEHNSVTILFHHPK--SDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPY 949
            G    +   L LQ  KRS++     +  ++ LA  D+ V LF VL Q +W+I   ++G   LC+ +K  Q  S++ STY++  ++LDR +A+C P+  L   +++   +I   W+ + +L++PQV +F   +  +G             W    +   TT      + ++V P+V           +L  CY +I H I     V+++   E          PK  S      T   P                   +R+S  S              +SRAKI+T +M+ +I+  ++ CW P+
Sbjct:   50 GGNLAVLLILGLQGHKRSRM-----HLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQGSGVLDCWADFYFSWGPRAYITWTT------MAIFVLPVV-----------VLTACYGLICHEIYKNLKVKTQAGREERR-----GWPKSSSSAAAAATRGLP-------------------SRVSSIST-------------ISRAKIRTVKMTFVIVLAYIACWAPF 294          
BLAST of GCR073 vs. Ensembl Mouse
Match: Gnrhr (gonadotropin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:95790])

HSP 1 Score: 72.0182 bits (175), Expect = 7.819e-14
Identity = 50/144 (34.72%), Postives = 78/144 (54.17%), Query Frame = 2
Query:  128 FTLKLQK--RSKLSYRSLYRM---IMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDA---YRGPWKTVTFYQCTT 535
            F LKLQK  + +   + L RM   +  L  A++L  L  +    +WNI V W  G FLCK++   + FS+Y   ++M ++SLDR++AI +P+  + S ++  + +I   WI S + A PQ+ +F       G   TV F QC T
Sbjct:   56 FLLKLQKWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITQPL-AVQSNSKLEQSMISLAWILSIVFAGPQLYIFRMIYLADGSGPTV-FSQCVT 197          
BLAST of GCR073 vs. Ensembl Mouse
Match: Oxtr (oxytocin receptor [Source:MGI Symbol;Acc:MGI:109147])

HSP 1 Score: 73.1738 bits (178), Expect = 9.120e-14
Identity = 36/114 (31.58%), Postives = 68/114 (59.65%), Query Frame = 2
Query:  146 KRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD 487
            + ++  +  L+  +  L+ AD++V +F VL Q +W+I   + G   LC+L+K  Q   ++ STY++ L+SLDR +AIC+P+  L    R  ++ ++  W+   + ++PQV +F 
Sbjct:   65 RTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLR--RRTDRLAVLATWLGCLVASVPQVHIFS 176          
BLAST of GCR073 vs. UniProt/SwissProt
Match: sp|Q2V2K5|GNRHR_OCTVU (Gonadotropin-releasing hormone receptor OS=Octopus vulgaris OX=6645 GN=GNRHR PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.239e-27
Identity = 100/356 (28.09%), Postives = 167/356 (46.91%), Query Frame = 2
Query:   26 LPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNIL-QMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITL---KNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            LP  P F+   + K      VF IS  GNT  I    +++     S  ++  +I+ LA AD++V  F +L   IW+  V W  G+ +CK+MK    F ++LSTYI   ++LDR  AI  P+    +  R ++I+I   W+ S + +IPQ ++F   R  ++   F+QC   D+ N L Q  +Y     +L+ +IP+ I+VT Y +I+ TI   S+++ +          P S  C                                 S N  ++ +H    L  RA+ ++ RMSA+I++ F+LCW PY++ ++        N+R +           ++  +L + N   NP+IY
Sbjct:   21 LPDAPRFDNVYVSKLCVLGTVFVISFFGNTLVIIQIFRIRG----SRSTIQSLILNLAIADLMVSFFNILMDIIWSATVEWLAGNTMCKIMKYLTVFGLHLSTYITVSIALDRCFAILSPMSRSKAPLR-VRIMITMAWVLSAIFSIPQAVIFQEQRKMFRQGMFHQC--RDSYNALWQKQLYSASSLILLFVIPLIIMVTSYLLILKTIVKTSRQFHDTP------ISPTSMSCY--------------------------------SVNHGQIRTH----LFERARKRSSRMSAVIVAAFILCWTPYYIIFLGFAFFQWDNSRTV-----------IYFFTLGTSNCMLNPLIY 316          
BLAST of GCR073 vs. UniProt/SwissProt
Match: sp|Q75W84|ANR_EISFE (Annetocin receptor OS=Eisenia fetida OX=6396 GN=anr PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.083e-22
Identity = 90/343 (26.24%), Postives = 154/343 (44.90%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIK-IIIICLWIYSFLLAIPQVLLFD-----AYRGPWKTVTFYQCTTSDNLNI----LQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENS--NNFQKLLSHKKQQ------LMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN   +   + L +   L    +Y MI  L+ AD+ V +F +L Q +W++   +RGG  LCKL+K  Q  ++Y S Y++   ++DR  AIC P+   H+W       ++I  W+ + + A+PQ+++FD        G +  V  ++   +  + I    L +YV PLV                 T+ +    V  K     ++  I      S   E      P  DDA  S +  D   + ++        +     LSH++QQ      ++SRAK KT +++  ++  +L+CW P++V ++          +   G  + I++    L SLNS  NP IY
Sbjct:   64 GNAAVLAMIVSLSRHKDLG--RMYTMIGHLSCADLFVAIFNLLPQLLWDVTHRFRGGRVLCKLVKYVQVVAMYASAYVLMSTAVDRYTAICHPMRS-HTWTSTTAHYLVIGAWVLALVFAVPQLVIFDYVEVVPGSGVYDCVDHFRPRWTLPVYITWFALAVYVIPLVVLA--------------TIYLRICVVVWKSANRKSTPMINVAARTSGATEQ-----PSLDDASVSFNVADGGGVDLDPSGGGGSLSRHAAQLSHRQQQQQANNVVLSRAKTKTVKLTLTVVISYLVCWAPFFVSHIWSAWDPHAPFE---GTEMVITLL---LGSLNSCINPWIY 378          
BLAST of GCR073 vs. UniProt/SwissProt
Match: sp|P30560|V1AR_RAT (Vasopressin V1a receptor OS=Rattus norvegicus OX=10116 GN=Avpr1a PE=1 SV=4)

HSP 1 Score: 100.908 bits (250), Expect = 3.555e-22
Identity = 94/348 (27.01%), Postives = 151/348 (43.39%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-----------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLL----SHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +   L L +  + + R ++  I  L+ AD+ V  F VL Q  W+I   +RG  +LC+++K  Q F+++ S Y++ +++ DR IA+C P+  L    R  +++I   W+ SF+L+ PQ  +F                   +  PW T  +    TS       ++V P+V           +L TCY  I + I  N+R K        T    H K D               K SG              E    F K L         + +SRAKI+T +M+ +I+S ++LCW P+++  +        +   +   +I I+     LASLNS  NP IY
Sbjct:   68 GNSSVL---LALHRTPRKTSR-MHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFILSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSG------VFVAPVV-----------VLGTCYGFICYHIWRNIRGK--------TASSRHSKGD---------------KGSG--------------EAVGPFHKGLLVTPCVSSVKSISRAKIRTVKMTFVIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITAL---LASLNSCCNPWIY 354          
BLAST of GCR073 vs. UniProt/SwissProt
Match: sp|Q9WTV9|V1AR_MICOH (Vasopressin V1a receptor OS=Microtus ochrogaster OX=79684 GN=Avpr1a PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.827e-22
Identity = 92/348 (26.44%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-----------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLL----SHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +   L L +  + + R ++  I  L+ AD+ V  F VL Q  W+I   +RG  +LC+++K  Q F+++ S Y++ +++ DR IA+C P+  L    R  +++I   W+ SFLL+ PQ  +F                   +  PW T  +    TS       ++V P+V           IL TCY  I + I  NVR K                                +K SG              E+   F K L         + +SRAKI+T +M+ +I++ ++LCW P+++  +     +  +   +   +I I+     LASLNS  NP IY
Sbjct:   68 GNSSVL---LALHRTPRKTSR-MHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPTRRSRLMIAASWVLSFLLSTPQYFIFSMIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSG------VFVVPVV-----------ILGTCYGFICYHIWRNVRGKTASRQ---------------------------SKGSG--------------EDVAPFHKGLLVTPCVSSVKTISRAKIRTVKMTFVIVTAYILCWAPFFIVQMWSVWDDNFIWTDSENPSITITAL---LASLNSCCNPWIY 350          
BLAST of GCR073 vs. UniProt/SwissProt
Match: sp|Q9WTV8|V1AR_MICMA (Vasopressin V1a receptor OS=Microtus montanus OX=88450 GN=Avpr1a PE=3 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.137e-21
Identity = 92/348 (26.44%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-----------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLL----SHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            GN+  +   L L +  + + R ++  I  L+ AD+ V  F VL Q  W+I   +RG  +LC+++K  Q F+++ S Y++ +++ DR IA+C P+  L    R  +++I   W+ SFLL+ PQ  +F                   +  PW T  +    TS       ++V P+V           IL TCY  I + I  NVR K                                +K SG              E+   F K L         + +SRAKI+T +M+ +I++ ++LCW P+++  +     +  +   +   +I I+     LASLNS  NP IY
Sbjct:   68 GNSSVL---LALHRTPRKTSR-MHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWVLSFLLSTPQYFIFSMIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSG------VFVVPVV-----------ILGTCYGFICYHIWRNVRGKTASRQ---------------------------SKGSG--------------EDVAPFHKGLLVTPCVSSVKTISRAKIRTVKMTFVIVTAYILCWAPFFIVQMWSVWDDNFIWTDSENPSITITAL---LASLNSCCNPWIY 350          
BLAST of GCR073 vs. TrEMBL
Match: A0A193KUK2 (GCR073 OS=Schmidtea mediterranea OX=79327 GN=gcr073 PE=2 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 387/388 (99.74%), Postives = 387/388 (99.74%), Query Frame = 2
Query:    2 YNSSNNLTLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIYXXXXXXXXXXXXXXXXXXQKNRRKMQFQ 1165
            YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFH PKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIYGFFNRNFFLFFMRKNFGGQKNRRKMQFQ
Sbjct:    2 YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHQPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIYGFFNRNFFLFFMRKNFGGQKNRRKMQFQ 389          
BLAST of GCR073 vs. TrEMBL
Match: X1YZA9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.011e-35
Identity = 101/364 (27.75%), Postives = 175/364 (48.08%), Query Frame = 2
Query:   26 LPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDN------------LNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            LP+IP FN  ++ K+V    +F ++ +GNT T+    ++++R      ++  +++ LA AD+LV  F ++++A+W   + W  G+F+CKL+K  Q F +YLSTYI+ +++LDR +AI  P+    +  R ++ +I   WI +   + PQV++F   RGP+    F+QC T               L++  M++ PLV            +V+ Y +I HTI  +S++++   S                        D    G                           + QL  +AK+K+ RM+A+I+  F++CW PY+V  +L T  + +L +     ++WI  F       NS  NP+IY
Sbjct:   61 LPRIPIFNEMSMIKTVVLSCMFVVAFIGNTATLVQMYRMRRRKS----TINLLLLHLAIADLLVTFFCIVSEAVWASTIQWFAGNFMCKLVKFLQVFGLYLSTYIIVIIALDRCLAILDPMSRNRA-PRRVRTMITVAWIMAGFFSTPQVIIFKVERGPFPE-DFFQCVTYGTYSQPWQEQLYSCLSVGFMFIIPLV-----------AMVSAYMLIFHTIAKKSRDFQRGAS------------------------DMLSRGP-------------------------VRGQLFRKAKVKSLRMTAVIVVAFIVCWTPYFVILILHTFSSNKLDE---KSSLWIFFF----GMANSMINPLIY 351          
BLAST of GCR073 vs. TrEMBL
Match: R7TQD2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_126901 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 3.476e-35
Identity = 100/364 (27.47%), Postives = 175/364 (48.08%), Query Frame = 2
Query:   26 LPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDN------------LNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            LP+IP FN  ++ K+V    +F ++ +GNT T+    ++++R      ++  +++ LA AD+LV  F ++++A+W   + W  G+F+CKL+K  Q F +YLSTYI+ +++LDR +AI  P+    +  R ++ +I   WI +   + PQ+++F   RGP+    F+QC T               L++  M++ PLV            +V+ Y +I HTI  +S++++   S                        D    G                           + QL  +AK+K+ RM+A+I+  F++CW PY+V  +L T  + +L +     ++WI  F       NS  NP+IY
Sbjct:   61 LPRIPIFNEMSMIKTVVLSCMFVVAFIGNTATLVQMYRMRRRKS----TINLLLLHLAIADLLVTFFCIVSEAVWASTIQWFAGNFMCKLVKFLQVFGLYLSTYIIVIIALDRCLAILDPMSRNRA-PRRVRTMITVAWIMAGFFSTPQIIIFKVERGPFPE-DFFQCVTYGTYSQPWQEQLYSCLSVGFMFIIPLV-----------AMVSAYMLIFHTIAKKSRDFQRAAS------------------------DMLSRGP-------------------------VRGQLFRKAKVKSLRMTAVIVVAFIVCWTPYFVILILHTFSSNKLDE---KSSLWIFFF----GMANSMINPLIY 351          
BLAST of GCR073 vs. TrEMBL
Match: A0A291FE86 (Gonadotropin-releasing hormone receptor 1 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.129e-32
Identity = 106/357 (29.69%), Postives = 183/357 (51.26%), Query Frame = 2
Query:   23 TLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNIL-QMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHK--KQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKN-ARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            TLP  P+ N  +  K+     +F IS++GNT T+    ++++R      ++  +IM LA AD++V  F  L  +IW   V W  G+ +CKL+K  Q F +YLSTYI+ ++++DRA AI  P+   +   R ++++II  W+ S + + PQ  +F   RGP+ +  +YQC T    N   Q  +Y ++  +L+ +IP+ I++T Y +I  TI  +S++ ++     IL    +S  C                             ISE       +LS    + +L  +AK+K+ +M+ +I+  F++CW PY+V ++  T  +    +K+    ++WI  F     + NS  NP+IY
Sbjct:   69 TLPPPPTANRMSTIKTSVLSTLFVISLVGNTATLVQMFRMRRRRS----TINTLIMHLATADLIVTFFCFLADSIWVTTVQWLAGNIMCKLVKWLQVFGLYLSTYIVVIIAIDRAYAILDPMSR-NKAPRRVRLMIITAWVLSAIFSAPQAYIFSVQRGPY-SAPYYQCVTFGAYNARWQEQMYSIISALLMFIIPLIIMITAYMLIFTTIAKKSRDLKKG----ILI---RSSCC-----------------------------ISETEQAAADMLSQAPVRGELFQKAKVKSLKMTTLIVLAFIICWSPYYVIFLAYTFTDMTPQLKYA---SMWIFCF----GTGNSLLNPLIY 376          
BLAST of GCR073 vs. TrEMBL
Match: A0A3S6BUP0 (Putative gonadotropin releasing-hormone receptor OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 6.154e-32
Identity = 110/359 (30.64%), Postives = 189/359 (52.65%), Query Frame = 2
Query:   14 NNLTLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNIL-QMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVF--IQSLASLNSAFNPIIY 1081
            +N+T    P+F   +L K++ F ++F IS +GN  TI    +L++R      ++  +I+ LA AD+LV  F +  +A W + V W  GS +CK +K  Q F++YLSTYI   +SLDR +AI  P+    +  R ++ +I+  WI+S L +IPQ ++F+  RGP+K V FYQC T  + +   Q+ +Y +   +L+ ++P+ ++ T Y +I  TI+ +SKE+   +S+ +     +        N       A  S   +   +I+ N   +++          +  L+ +AK K+  MS +I+  F++CW PY++ ++ IT          L K I   +F     +   NS  NP+IY
Sbjct:   95 SNVTSENAPTFTTTSLIKTIVFGIMFGISFVGNMATIVQMRRLRRRKS----TINTLIVNLALADLLVTFFCIAGEAAWTVTVQWLAGSVMCKFVKYMQVFALYLSTYITVAISLDRCVAILDPMRRKSAAQR-VRTMIVFAWIFSALFSIPQPIVFNVLRGPFKEV-FYQCVTFGSYDSAWQLQMYAIASLMLMFVLPLAVMGTAYGLIFTTISRKSKEHSVMDSIQM---PARKTWVTRWVNYKRCLCMAFCSKPISRRSSIMSNYSEDHAAR-----GPVRSYLLRKAKRKSLIMSFVIVLAFMVCWTPYYIIFICITF---------LDKVIDPVIFNYFSFIGLSNSMLNPMIY 430          
BLAST of GCR073 vs. Ensembl Cavefish
Match: ENSAMXT00000039545.1 (gonadotropin-releasing hormone II receptor-like [Source:NCBI gene;Acc:103037789])

HSP 1 Score: 92.0485 bits (227), Expect = 2.819e-20
Identity = 77/314 (24.52%), Postives = 142/314 (45.22%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNIL-QMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            + R +     L  +I+ L  AD+++    +    +WN+ V W GG  LCKL+   + F++  S +I+ ++SLDR  AI  P+  L++  RN +++I+  W  S LL  PQ+ +F   +   + V F QC T  +     Q  VY + + V + +IP+ ++  CYT I+  IN      +EH                                          N+  E+       L   +  ++ +A++KT +M+ II+  F++CW PY++  +    +   ++K T     ++   +    +LN+  +P+IY
Sbjct:   69 RGRGRRLASHLRPLIISLVVADLMMTFIVMPLDMVWNVTVQWYGGDGLCKLLSFLKLFAMQASAFILVVISLDRHHAILHPLDSLNAHRRNRRMLILA-WSLSLLLGSPQLFIFRTIKA--ERVDFTQCVTHGSFRERWQETVYNMFHFVTLYVIPLLVMSCCYTHILIEIN-----RQEHK-----------------------------------------NKAGESC------LRRSRTDMIPKARMKTLKMTIIIVMSFIVCWTPYYLLGIWYWFQ-PEMLKVT---PEYVHHLLFVFGNLNTCCDPVIY 323          
BLAST of GCR073 vs. Ensembl Cavefish
Match: gnrhr1 (gonadotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-090128-2])

HSP 1 Score: 90.1225 bits (222), Expect = 1.344e-19
Identity = 69/283 (24.38%), Postives = 122/283 (43.11%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNL---------NILQ---MYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWV 955
            + R +     L  +I  LA AD+++    +   A+WN+ V W  G  +CKL+   + F+++ + +I+ +VSLDR  AI  P+  L +  RN K+++   W  S +LA PQ+ +F A +   + V F QC T             N+ Q   +YV+PL+           ++  CYT I+  IN +    ++           K + C                                        L      ++ +A++KT +M+ II++ F++CW PY++
Sbjct:   64 RGRGRRLASHLRPLIGSLALADLVMTFVVMPLDAVWNVTVQWYAGDAMCKLLCFLKLFAMHSAAFILVVVSLDRHHAILHPLDALDAGRRNRKMLMTA-WTLSVVLASPQLFIFRAIKA--EGVDFVQCATHGRFQKHWQETAYNMFQFVTLYVFPLL-----------VMSFCYTRILVEINRQMNRSKD-----------KGEPC----------------------------------------LRRSGMDMIPKARMKTLKMTIIIVASFVICWTPYYL 281          
BLAST of GCR073 vs. Ensembl Cavefish
Match: oxtr (isotocin receptor [Source:NCBI gene;Acc:103033855])

HSP 1 Score: 79.7221 bits (195), Expect = 4.431e-16
Identity = 37/105 (35.24%), Postives = 66/105 (62.86%), Query Frame = 2
Query:  173 LYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD 487
            +Y  +  L+ AD++V +F VL Q IW+I   + G   LC+L+K  Q   ++ STY++ L+S+DR +A+C+P+  L    R  ++ ++C W+ S + ++PQV +F 
Sbjct:   81 MYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDLLCRLVKYLQIVGMFASTYMLVLMSVDRCLAVCQPLRSLR--RRTDRLYVLCSWLLSLIFSVPQVGIFS 183          
BLAST of GCR073 vs. Ensembl Cavefish
Match: oxtr (isotocin receptor [Source:NCBI gene;Acc:103033855])

HSP 1 Score: 79.7221 bits (195), Expect = 4.431e-16
Identity = 37/105 (35.24%), Postives = 66/105 (62.86%), Query Frame = 2
Query:  173 LYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD 487
            +Y  +  L+ AD++V +F VL Q IW+I   + G   LC+L+K  Q   ++ STY++ L+S+DR +A+C+P+  L    R  ++ ++C W+ S + ++PQV +F 
Sbjct:   81 MYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDLLCRLVKYLQIVGMFASTYMLVLMSVDRCLAVCQPLRSLR--RRTDRLYVLCSWLLSLIFSVPQVGIFS 183          
BLAST of GCR073 vs. Ensembl Cavefish
Match: gnrhr4 (gonadotropin-releasing hormone II receptor-like [Source:NCBI gene;Acc:103034933])

HSP 1 Score: 77.0258 bits (188), Expect = 4.698e-15
Identity = 67/263 (25.48%), Postives = 120/263 (45.63%), Query Frame = 2
Query:  182 MIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVT----FYQCTTSDN-LNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWV 955
            +I+ L  AD+LV    +   A WNI V W  G F C+L+   +  ++Y   ++  ++SLDR  AI  P+  +    +  KI++   W  S +L++PQ+ +F        T+T    F QCTT  + +   Q  +Y +   V + L+P+ I++ CYT I+  I+ R                                     S  N  ++ + + R    SNN+           + +A+++T +MS +I++ F++CW PY++
Sbjct:   92 LIINLTVADLLVTFIVMPVDAAWNITVQWLAGDFACRLLMFLKLVAMYSCAFVTVVISLDRHSAILNPL-AISEAKKKSKIMLSAAWAMSIVLSVPQMFIFHTV-----TITVPANFTQCTTRGSFVKHWQETLYNMFTFVCLFLLPLVIMIFCYTRILLEISQR------------------------------------LSKGNISSKEVHLRR----SNNY-----------IPKARMRTLKMSIVIVTSFIVCWTPYYL 297          
BLAST of GCR073 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001380.1 (pep scaffold:Pmarinus_7.0:GL477135:197258:202768:-1 gene:ENSPMAG00000001242.1 transcript:ENSPMAT00000001380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 6.752e-19
Identity = 80/331 (24.17%), Postives = 136/331 (41.09%), Query Frame = 2
Query:  140 LQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD--------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWIS-VFIQSLASLNSAFNPIIY 1081
            +  R K S   L+  IM L+ AD++V  F VL Q IW I   + G  FLC+ +K  Q   ++ STY++ ++ LDR IAIC P+  L   ++    +I   W  S L ++PQ  +F                +  PW T  +    T        +++ P++  +            CY +I   I  N+++K  E                            D++H+ + +   + V                    + +S+AKI+T +M+ +II  +++CW P++   +     ++   +     N  I    +  LASLNS  NP IY
Sbjct:   76 INTRKKTSRMHLF--IMHLSIADLVVAFFQVLPQLIWKITYRFNGSDFLCRAIKYLQILGMFASTYVLIMMGLDRYIAICHPLRTLRQSSKQSYQMIFVSWFLSMLFSLPQAFIFSMSEVENSGIIDCWAEFIKPWGTKAYITWMTGS------VFIIPVIILIW-----------CYGMITFAIWKNIKAKTQE---------------------------GDSRHNPAKSSAPSRV-----------------SSVRSISKAKIRTAKMTFVIIMVYIICWTPFFFVQMWSVWDSSAPFEVIENNNKSIPFAIVMLLASLNSCTNPWIY 343          
BLAST of GCR073 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010165.1 (pep scaffold:Pmarinus_7.0:GL493405:1402:3508:1 gene:ENSPMAG00000009199.1 transcript:ENSPMAT00000010165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.814e-15
Identity = 50/169 (29.59%), Postives = 86/169 (50.89%), Query Frame = 2
Query:  182 MIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNL------NILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKE 670
            +I+ L  AD+L+    +   A+W+I   W  G F C+L+   +  ++Y S +I  ++SLDR  AI  P+    +  +N K ++   W+ S LLA+PQ+ LF   + P     F QC T  N       N+  M+ +  ++ +     P+ I++ CY  I+  I+ R +E
Sbjct:   90 LIVNLTTADLLITFIVMPLDAVWHITTQWYAGEFACRLLMFLRLLAMYSSAFITVVISLDRHSAILNPLGIGKAKAKN-KTMLSVAWVLSVLLAVPQLFLFHV-KSPKGNKNFVQCVTHGNFVEQWHHNLYYMFTFVFLFIL-----PLFIMIFCYCRILLEISKRMRE 251          
BLAST of GCR073 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008459.1 (pep scaffold:Pmarinus_7.0:GL478345:24256:33787:1 gene:ENSPMAG00000007650.1 transcript:ENSPMAT00000008459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 8.277e-13
Identity = 80/328 (24.39%), Postives = 133/328 (40.55%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFD-------------AYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            + R K S  +L+  +  L+ AD+ V  F VL Q  W++   +RG   LC+L+K  Q   ++ STY+++L          +P    H+       ++ C W  S LL+ PQV++F               +  PW    +    T      + +YV P++           IL  CY  I+  I  N+R K             +PK               D + S S    ++ V +R+S               + +SRAK++T +M+ +II  +++CW P++V  +            +      I +    L+SLNS  NP IY
Sbjct:   72 RTRRKASRMNLF--VKHLSVADLAVAAFQVLPQLSWDVTFRFRGPDALCRLVKYLQVVGMFASTYVLTLRRRG------EPRKQAHA-------MVACAWALSALLSTPQVVIFSLREVEEGVFDCWADFGQPWGMRAYVTWIT------VSVYVAPVL-----------ILAACYGAILLEICRNLRLKTRG---------RYPK---------------DPRGSQS----QSPVCSRVSS-------------VRCISRAKVRTIKMTLVIIVVYVVCWTPFFVIQMWAAWDETAPDDDSSDPTYTIVML---LSSLNSCTNPWIY 323          
BLAST of GCR073 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011358.1 (pep scaffold:Pmarinus_7.0:GL483841:12771:13418:-1 gene:ENSPMAG00000010331.1 transcript:ENSPMAT00000011358.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.741e-12
Identity = 30/98 (30.61%), Postives = 57/98 (58.16%), Query Frame = 2
Query:  182 MIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQV 475
            +++ L+ AD+L  L  +   A WN+ + WR G   C+L+   + F++Y S ++ +++SLDR  A+  P+    +  R+ ++ +   W  S +LA+PQV
Sbjct:  120 LMLHLSAADLLFTLLVMPLDAAWNVTLQWRAGDAACRLLMFLKLFAMYASAFVTAVISLDRYSAVVNPLAFGQAKRRS-RVTLCLAWALSAVLALPQV 216          
BLAST of GCR073 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010661.1 (pep scaffold:Pmarinus_7.0:GL479584:296:6514:-1 gene:ENSPMAG00000009652.1 transcript:ENSPMAT00000010661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 6.301e-12
Identity = 40/135 (29.63%), Postives = 70/135 (51.85%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADI---LVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGP 502
            GN   + + L L +R++    +    ++ LA AD+   L CL F  T+ +     SW  G+ LC L++  Q  S+ +S Y ++ + +DR  A+C P+H   + +R  K++I  +W  S  +++    L  A RGP
Sbjct:   16 GNA-VVVWVLALGRRARTDISAF---LINLALADLTMALFCLPFTFTEVLLQ---SWLFGALLCPLVRFAQTLSVSVSIYTLTTIGIDRYYAVCHPLHSRMTKSRG-KVLIALIWAVSISISLSTTTLAVATRGP 142          
BLAST of GCR073 vs. Ensembl Nematostella
Match: EDO39861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Q1])

HSP 1 Score: 51.6026 bits (122), Expect = 2.617e-7
Identity = 64/278 (23.02%), Postives = 118/278 (42.45%), Query Frame = 2
Query:  176 YRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTF--YQCTTSDNLNILQMY-VYPLVYCVXXXXXXXXXXVTCYTVI-----IHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNND-NETIVINRISENSNNFQKLLSHKK-----QQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVL 967
            Y +   LA A+ LV   F+L   I+    +W  G F+C L    Q  S  + T+ M+L+S+ R + I  P      + +  +++++ LW+ +  +  P  +       P+   T+  +     D+L+    Y  Y +V  +L  ++PI I++  Y  +      H   +R+     H+ +T+      S     +        D + S  NND N  +++    + S  F    S        + L+   +    RM   II  F++C++PY V+Y L
Sbjct:   70 YTLTTNLAIAE-LVSTIFLLMLVIYEEIKTWPFGDFMCHLTSPIQILSGLVVTWSMALISIHRFVVITSPGSQ---YIKKQELLMVLLWLAATAITFPLFMYSKMVMSPFDPDTYWCFVLFPGDSLSSFPSYRTYHMVRFMLNYILPIVIMIAAYGALGFRLKYHIAFIRTV----HSELTVPNSGTHSTGAVTVNGN----TDIEASEPNNDNNNDVILAGTKDPSRQFHASFSQTSSDVVYENLLIDLESDLLRMIYAIILIFVVCYIPYQVFYFL 335          
BLAST of GCR073 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 51.6026 bits (122), Expect = 2.927e-7
Identity = 76/352 (21.59%), Postives = 144/352 (40.91%), Query Frame = 2
Query:  116 HTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILV---CLFFVLTQAI----WNIFVSWRGGSF------LCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSW-NRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLL----SHKKQQLMSRA------KIKTYRMSAIIISCFLLCWLPYWVYYVLIT------LKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            +++F+  +L  RS  +Y     +++ LA +D+LV    L F L Q +    W   +   G  F      LC    M            ++ +S DR +AI +P+ +     ++   I+I+ +WIY+   A    L F  + G      + QC        ++  VY  +  +     P+ I++ CY +++      + + ++      L   P+ +   H           + SG  +     VI   +  S++ +K +     H K +  + +      +IK  +  A+++  F+LCW P++V +V             R+      K + + +F+  L   NSA NPIIY
Sbjct:   46 YSVFYYRRL--RSPTNY-----LVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVN----------LAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAF---LSFVEWEGESTIAAYPQCG-------IRARVYITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEKEQIALNVSPEPNSNNH-----------EESGETSLASPPVIRLKTSRSSSHRKDINFANGHAKHRNPASSTFHIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAV--KRVLLIIFVYVLPVSNSAANPIIY 357          
BLAST of GCR073 vs. Ensembl Nematostella
Match: EDO48332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJU0])

HSP 1 Score: 48.9062 bits (115), Expect = 1.449e-6
Identity = 36/114 (31.58%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  134 LKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQV 475
            L +  RS+L  R +   IM LA  D+  C+  V    +  +   W  GSFLCK++   Q   I ++ Y +  +SL+R  AI +P       +R + +II  LW++S  L  P +
Sbjct:    9 LAVYNRSRL--RIIDYFIMNLAATDLATCIISVPFDFVEILSAKWPFGSFLCKIVYPLQTMLISVAVYTLLCMSLERRRAIIRPFKP-RIKSRRVLLIIALLWVFSISLVGPYI 119          
BLAST of GCR073 vs. Ensembl Nematostella
Match: EDO49911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF82])

HSP 1 Score: 48.9062 bits (115), Expect = 1.702e-6
Identity = 36/116 (31.03%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  167 RSLYRM-------IMQLAFADILVCLFFVLTQAIWNI------FVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQV 475
            RS YRM       I  +AFAD+L  +F ++    W I       V    G  LCK ++  Q  S+  S + M+ +S+DR  AI +P+  + ++ +  K II  +W  S L++ P +
Sbjct:   25 RSAYRMRTVTNYFITNVAFADLLTTVFNMMPTLFWIIERKDPWSVGGTLGEILCKTLQFFQCVSVACSVFSMAAISMDRFFAIFRPLKRIITF-KLAKFIIALIWASSCLISSPLI 139          
BLAST of GCR073 vs. Ensembl Nematostella
Match: EDO36453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH9])

HSP 1 Score: 47.3654 bits (111), Expect = 4.655e-6
Identity = 36/122 (29.51%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  107 GNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADI-LVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIP 469
            GNT      LK   R K+   + Y  I+ LA AD+ L C+       +  +   W  G+ +CK++   Q  +++ S Y ++ VSL R  AI  P+    S ++  K ++I +W+ S L   P
Sbjct:   52 GNTLVCIVILK---RKKMKTVTNY-FILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSK-AKTLVIAIWVLSLLPVAP 168          
BLAST of GCR073 vs. Ensembl Medaka
Match: oxtr (oxytocin receptor [Source:NCBI gene;Acc:100861587])

HSP 1 Score: 92.8189 bits (229), Expect = 1.666e-20
Identity = 87/312 (27.88%), Postives = 141/312 (45.19%), Query Frame = 2
Query:  152 SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            +K S   +Y  +  L+ AD++V +F VL Q IW+I   + G   LC+L+K  Q   ++ STY++ L+S+DR +AIC+P+H LH   R  +I +I  W+ S + +IPQ+ +F            Y C   D +       Y     + I +IP+ IL  CY +I   I  N + K               K + C +LT +                        +  +N   ++ S K   L+S+AKI T +M+ +I+  +++CW P++   +      A        +     +    LASLNS  NP IY
Sbjct:   70 TKHSQSRMYYFMKHLSIADLVVAIFQVLPQLIWDITFRFYGPDILCRLVKYLQVVGMFASTYMLVLMSIDRCLAICQPLHSLH--RRKDRIYVILSWLLSLIFSIPQMFIFSLREVGSAGSGVYDC-WGDFVKPWGAKAYITWISLTIYIIPVAILSICYGLISFKIWQNFKLKT--------------KREQCINLTPK------------------------TSQNNTLARVSSVK---LISKAKITTVKMTFVIVVAYIVCWTPFFSVQMWSAWDQAA------PREAMPFIISMLLASLNSCCNPWIY 331          
BLAST of GCR073 vs. Ensembl Medaka
Match: v1ar2 (arg8-vasotocin receptor-like [Source:NCBI gene;Acc:101174343])

HSP 1 Score: 91.2781 bits (225), Expect = 7.065e-20
Identity = 85/328 (25.91%), Postives = 142/328 (43.29%), Query Frame = 2
Query:  149 RSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF---------DAYR------GPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTI--NVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            + K+S   L+  I  L+ AD++V  F VL Q  W I   + G  FLC+++K  Q   ++ STY+M +++LDR IAIC P+  L    +   I+I   W+ S +L+ PQ  +F         D Y        PW    +    T      + +++ P+V           IL+ CY  I H+I  N++ K+ +                                +G++N N  I  N +S  +              +SRAK++T +M+ +I+  +++CW P+++  +        L   +    + +S     LASLNS  NP IY
Sbjct:   88 KKKMSRMHLF--IKHLSLADLVVAFFQVLPQLCWEITFRFYGSDFLCRIVKHLQVMGMFASTYMMVMMTLDRYIAICHPLKTLQQPTKRSYIMITSTWMCSLVLSTPQYFIFSLSEIKNGSDVYDCWAHFIQPWGAKAYITWIT------VGIFLVPVV-----------ILMLCYGFICHSIWKNIKYKKRKT------------------------------TAGASNKNGLIGKNSVSSVTT-------------ISRAKLRTVKMTFVIVLAYIVCWSPFFIVQMWSVWDENFLWDDSDNTAVTLSAL---LASLNSCCNPWIY 350          
BLAST of GCR073 vs. Ensembl Medaka
Match: gnrh-r3 (gonadotropin-releasing hormone receptor 3 [Source:NCBI gene;Acc:100125529])

HSP 1 Score: 79.337 bits (194), Expect = 7.135e-16
Identity = 77/308 (25.00%), Postives = 133/308 (43.18%), Query Frame = 2
Query:  182 MIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVT----FYQCTTSDN-LNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYW---VYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
            +IM L  AD+LV    +   A WNI V W+ G   C+L+   +  ++Y   ++  ++SLDR  AI  P+  +    R  KI++   W  S +L++PQ+ +F        T+T    F QCTT  + +   Q  +Y +   V + L+P+ I++ CYT I+  I+ R      +N V+   H  +S       N  P                                          +A+++T +MS +I++ F++CW PY+   ++Y L   K    +  +L   ++I          N+  +PI Y
Sbjct:   77 LIMNLTVADLLVTFIVMPVDAAWNITVQWQAGDLACRLLMFMKLVAMYSCAFVTVVISLDRQSAILNPL-GISEAKRKSKIMLTVAWTTSVILSLPQMFIFHNV-----TITVPENFTQCTTHGSFVQRWQETLYNMFTFVCLFLLPLVIMIFCYTRILVEISSR---IARNNMVSRDIHLRRSH------NNIP------------------------------------------KARMRTLKMSIVIVTSFIICWTPYYLLGLWYWLFPEKMEETVSHSLTHMLFI------FGLFNACLDPITY 321          
BLAST of GCR073 vs. Ensembl Medaka
Match: v1ar1 (arg8-vasotocin receptor-like [Source:NCBI gene;Acc:101155395])

HSP 1 Score: 75.8702 bits (185), Expect = 9.867e-15
Identity = 42/114 (36.84%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF 484
            + R KLS   L+  +  L+ AD++V  F VL Q  W I   + G  FLC+++K  Q   ++ STY+M +++LDR IAIC P+  L    +   I+I   W  S +L+ PQ  +F
Sbjct:   69 RTRRKLSRMHLF--MKHLSLADLVVAFFQVLPQLCWEITFRFYGPDFLCRIVKHLQVLGMFASTYMMVMMTLDRYIAICHPLKTLQQPTQRAYIMIGSTWACSLVLSTPQYFIF 180          
BLAST of GCR073 vs. Ensembl Medaka
Match: v1ar1 (arg8-vasotocin receptor-like [Source:NCBI gene;Acc:101155395])

HSP 1 Score: 75.8702 bits (185), Expect = 9.867e-15
Identity = 42/114 (36.84%), Postives = 64/114 (56.14%), Query Frame = 2
Query:  143 QKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLF 484
            + R KLS   L+  +  L+ AD++V  F VL Q  W I   + G  FLC+++K  Q   ++ STY+M +++LDR IAIC P+  L    +   I+I   W  S +L+ PQ  +F
Sbjct:   69 RTRRKLSRMHLF--MKHLSLADLVVAFFQVLPQLCWEITFRFYGPDFLCRIVKHLQVLGMFASTYMMVMMTLDRYIAICHPLKTLQQPTQRAYIMIGSTWACSLVLSTPQYFIF 180          
BLAST of GCR073 vs. Planmine SMEST
Match: SMESG000074847.1 (SMESG000074847.1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 335/335 (100.00%), Postives = 335/335 (100.00%), Query Frame = 2
Query:    2 YNSSNNLTLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTL 1006
            YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTL
Sbjct:    2 YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTL 336          
BLAST of GCR073 vs. Planmine SMEST
Match: SMESG000074847.1 (SMESG000074847.1)

HSP 1 Score: 492.271 bits (1266), Expect = 5.155e-176
Identity = 272/272 (100.00%), Postives = 272/272 (100.00%), Query Frame = 2
Query:    2 YNSSNNLTLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRI 817
            YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRI
Sbjct:    2 YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRI 273          
BLAST of GCR073 vs. Planmine SMEST
Match: SMESG000046683.1 (SMESG000046683.1)

HSP 1 Score: 134.806 bits (338), Expect = 2.272e-36
Identity = 76/164 (46.34%), Postives = 113/164 (68.90%), Query Frame = 2
Query:    8 SSNNLTLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRG 499
            S  N+T+P +P  NGYNLFK++FF   F IS++GN +TIFF LK+ + SK+S   L++ ++QLA ADI V +FF+L  AI N   SW+ G ++CK +K+ QAFSIYLSTY++  +S+DR +AI  P+ H   W R   +II  +W+ +F+L++PQ+   D + G
Sbjct:    6 SVQNVTIP-MPQLNGYNLFKAIFFYTSFSISVVGNFNTIFFILKIYRHSKVSCIHLHKTLLQLALADISVAIFFILNLAILNTLGSWQAGRWVCKFVKVWQAFSIYLSTYVVVFISIDRVVAIRFPLLHSRCWKRYFNVIICSIWLITFVLSLPQIQAIDDWIG 168          
BLAST of GCR073 vs. Planmine SMEST
Match: SMESG000002693.1 (SMESG000002693.1)

HSP 1 Score: 135.191 bits (339), Expect = 1.515e-35
Identity = 112/365 (30.68%), Postives = 186/365 (50.96%), Query Frame = 2
Query:   14 NNLTLPKIPSFNGYNXXXXXXXXXXXXXXXXGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICL---WIYSFLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYY------VLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPIIY 1081
             N +   +P+F+ ++  K    L  F +S++GN  T+ F LK ++++  S++   ++I+ L  AD+ V + F+LT+ IWN+   W GG  LCKL+K G+  S   STY+++ + +DR   I      + S   + K+++ICL   W  S + +IPQ+ L     GPWK   FYQC   +  + ++  VYP V  +L  L+P+ +++ CY  I+ TI    K+Y+    ++ +          H TN+         S S     T   N+  +     ++ L   K+  +SRAK K+  +S+ II  +L    PYW+ Y      V  T+ N++L + +     W+S+       LNSAFNPIIY
Sbjct:    2 KNYSTDPMPNFDLHSKIKVTILLTFFIVSVVGNIVTLIFLLKRRRQTSQSFKGFNKLILHLCIADLSVTILFLLTETIWNMTTQWYGGEVLCKLIKFGRNLSFLSSTYLIATIGIDRVQVI------IRSRRLSDKMVVICLITVWSLSTIFSIPQMKLNKVLLGPWKK-EFYQCRNIEMKSFVETRVYPFVCIILAFLLPLAVILGCYGFIMITI---LKQYQMIGKLSFMLSPLLMQHHSHSTNK-------TLSTSEKAGLTEKENQFYQYLEPNKEFLFQSKRAFLSRAKFKSLMISSSIIITYLTSRTPYWMVYFLQHLGVFDTIVNSKLDELS-HWFFWLSI-------LNSAFNPIIY 341          
BLAST of GCR073 vs. Planmine SMEST
Match: SMESG000049782.1 (SMESG000049782.1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.489e-16
Identity = 90/330 (27.27%), Postives = 153/330 (46.36%), Query Frame = 2
Query:  128 FTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWK-TVTFYQCTTSDNLNILQMYVYPLVYC---VXXXXXXXXXXVTCYTVIIHTINVRSKEYEEHN-SVTILFHHPK-----SDDCEHLTNQFPFYDDAKHSGSNNDNETIVINRISENSNNFQKLLSH---KKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLASLNSAFNPII 1078
            F L    R +    +L  +I+ L +ADIL  +  +  + +W + + W   S+LCK  K   +FSI LST I+ ++S+DR + I  P++ L    R IKI+I  +++ S L+ I QV +FD  + P    + F QC        +Q +   +V+    V    +P+ I++ CY++I+  +   S+  + +N      F  P      S +C                 S  +N  I+ ++I   ++N     SH    K  L  RAK K+ +++  I+  F++CW PY++ Y  I   +  + +F        S F      LN+  NPII
Sbjct:   40 FVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFSISFSISLSTGIICVMSIDRTLVIMYPLNRLKMAKR-IKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSS--------SILSCKQSKENNSIILFSKIHSPTSNHS--FSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVY-FIRSYSGPIHRFDPRDPGIYSFF---FGHLNAIINPII 354          
The following BLAST results are available for this feature:
BLAST of GCR073 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPSR13.776e-2127.30neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:... [more]
NPSR14.577e-2127.30neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:... [more]
NPSR16.020e-2127.30neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:... [more]
AVPR1A2.056e-2024.27arginine vasopressin receptor 1A [Source:HGNC Symb... [more]
AVPR1B4.917e-1924.21arginine vasopressin receptor 1B [Source:HGNC Symb... [more]
back to top
BLAST of GCR073 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnrr-11.183e-1622.67GoNadotropin-Releasing hormone Receptor (GnRHR) re... [more]
gnrr-11.758e-1623.10GoNadotropin-Releasing hormone Receptor (GnRHR) re... [more]
ntr-27.597e-1321.71Nematocin receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
gnrr-51.070e-1226.95GoNadotropin-Releasing hormone Receptor (GnRHR) re... [more]
daf-381.193e-1223.48G-protein coupled receptor daf-38 [Source:UniProt... [more]
back to top
BLAST of GCR073 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CrzR1.966e-2428.57gene:FBgn0036278 transcript:FBtr0075989[more]
CrzR2.979e-2428.57gene:FBgn0036278 transcript:FBtr0330069[more]
AkhR9.259e-1931.43gene:FBgn0025595 transcript:FBtr0079310[more]
AkhR9.409e-1931.43gene:FBgn0025595 transcript:FBtr0332331[more]
AkhR9.409e-1931.43gene:FBgn0025595 transcript:FBtr0079309[more]
back to top
BLAST of GCR073 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnrhr16.245e-2125.48gonadotropin releasing hormone receptor 1 [Source:... [more]
oxtr3.899e-2027.58oxytocin receptor [Source:ZFIN;Acc:ZDB-GENE-110805... [more]
oxtr3.899e-2027.58oxytocin receptor [Source:ZFIN;Acc:ZDB-GENE-110805... [more]
avpr1ab4.033e-1926.51arginine vasopressin receptor 1Ab [Source:ZFIN;Acc... [more]
oxtrl6.785e-1925.45oxytocin receptor like [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of GCR073 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdcp12.906e-2027.19CUB domain containing protein 1 [Source:Xenbase;Ac... [more]
nrg35.415e-2026.94neuregulin 3 [Source:Xenbase;Acc:XB-GENE-984146][more]
AVPR1A6.641e-2025.38arginine vasopressin receptor 1A [Source:NCBI gene... [more]
AVPR1B1.846e-1924.70arginine vasopressin receptor 1B [Source:NCBI gene... [more]
evx13.974e-1926.13even-skipped homeobox 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of GCR073 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Avpr1a3.512e-2226.72arginine vasopressin receptor 1A [Source:MGI Symbo... [more]
Npsr12.676e-1925.15neuropeptide S receptor 1 [Source:MGI Symbol;Acc:M... [more]
Avpr1b2.102e-1624.67arginine vasopressin receptor 1B [Source:MGI Symbo... [more]
Gnrhr7.819e-1434.72gonadotropin releasing hormone receptor [Source:MG... [more]
Oxtr9.120e-1431.58oxytocin receptor [Source:MGI Symbol;Acc:MGI:10914... [more]
back to top
BLAST of GCR073 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2V2K5|GNRHR_OCTVU6.239e-2728.09Gonadotropin-releasing hormone receptor OS=Octopus... [more]
sp|Q75W84|ANR_EISFE2.083e-2226.24Annetocin receptor OS=Eisenia fetida OX=6396 GN=an... [more]
sp|P30560|V1AR_RAT3.555e-2227.01Vasopressin V1a receptor OS=Rattus norvegicus OX=1... [more]
sp|Q9WTV9|V1AR_MICOH7.827e-2226.44Vasopressin V1a receptor OS=Microtus ochrogaster O... [more]
sp|Q9WTV8|V1AR_MICMA1.137e-2126.44Vasopressin V1a receptor OS=Microtus montanus OX=8... [more]
back to top
BLAST of GCR073 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUK20.000e+099.74GCR073 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
X1YZA92.011e-3527.75G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
R7TQD23.476e-3527.47G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A291FE861.129e-3229.69Gonadotropin-releasing hormone receptor 1 OS=Platy... [more]
A0A3S6BUP06.154e-3230.64Putative gonadotropin releasing-hormone receptor O... [more]
back to top
BLAST of GCR073 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039545.12.819e-2024.52gonadotropin-releasing hormone II receptor-like [S... [more]
gnrhr11.344e-1924.38gonadotropin releasing hormone receptor 1 [Source:... [more]
oxtr4.431e-1635.24isotocin receptor [Source:NCBI gene;Acc:103033855][more]
oxtr4.431e-1635.24isotocin receptor [Source:NCBI gene;Acc:103033855][more]
gnrhr44.698e-1525.48gonadotropin-releasing hormone II receptor-like [S... [more]
back to top
BLAST of GCR073 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001380.16.752e-1924.17pep scaffold:Pmarinus_7.0:GL477135:197258:202768:-... [more]
ENSPMAT00000010165.11.814e-1529.59pep scaffold:Pmarinus_7.0:GL493405:1402:3508:1 gen... [more]
ENSPMAT00000008459.18.277e-1324.39pep scaffold:Pmarinus_7.0:GL478345:24256:33787:1 g... [more]
ENSPMAT00000011358.11.741e-1230.61pep scaffold:Pmarinus_7.0:GL483841:12771:13418:-1 ... [more]
ENSPMAT00000010661.16.301e-1229.63pep scaffold:Pmarinus_7.0:GL479584:296:6514:-1 gen... [more]
back to top
BLAST of GCR073 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR073 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398612.617e-723.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473592.927e-721.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483321.449e-631.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499111.702e-631.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364534.655e-629.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR073 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxtr1.666e-2027.88oxytocin receptor [Source:NCBI gene;Acc:100861587][more]
v1ar27.065e-2025.91arg8-vasotocin receptor-like [Source:NCBI gene;Acc... [more]
gnrh-r37.135e-1625.00gonadotropin-releasing hormone receptor 3 [Source:... [more]
v1ar19.867e-1536.84arg8-vasotocin receptor-like [Source:NCBI gene;Acc... [more]
v1ar19.867e-1536.84arg8-vasotocin receptor-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of GCR073 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074847.10.000e+0100.00SMESG000074847.1[more]
SMESG000074847.15.155e-176100.00SMESG000074847.1[more]
SMESG000046683.12.272e-3646.34SMESG000046683.1[more]
SMESG000002693.11.515e-3530.68SMESG000002693.1[more]
SMESG000049782.12.489e-1627.27SMESG000049782.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018934 ID=SMED30018934|Name=GCR073|organism=Schmidtea mediterranea sexual|type=transcript|length=1180bp
GTATAATTCTTCTAATAATTTAACTTTACCGAAAATTCCTTCATTTAACG
GATACAATTTATTCAAATCTGTGTTTTTTCTCGTTGTATTCTTTATTTCT
ATTCTGGGAAACACTCACACTATTTTCTTCACTCTCAAACTACAGAAGAG
ATCAAAACTAAGCTACAGATCTCTGTACAGAATGATAATGCAGTTGGCTT
TTGCCGATATTCTTGTATGCCTCTTTTTCGTACTGACACAAGCGATTTGG
AATATCTTTGTCAGTTGGAGAGGAGGAAGTTTCTTGTGTAAACTGATGAA
GATGGGCCAAGCATTTAGCATCTATTTAAGCACATATATAATGAGTCTCG
TGAGTCTCGATCGTGCCATCGCAATATGTAAACCAATTCACCATCTACAC
AGCTGGAATAGAAATATTAAAATAATTATCATATGCTTATGGATTTATTC
TTTTTTATTGGCTATTCCACAAGTGCTATTGTTCGATGCCTATCGAGGTC
CATGGAAAACAGTAACATTCTATCAATGTACAACATCCGATAATCTGAAT
ATACTCCAAATGTATGTTTACCCCCTTGTGTATTGTGTTTTAATACTGCT
CATTCCTATTGGTATTCTAGTAACATGCTATACTGTCATCATTCATACGA
TTAATGTTAGATCCAAGGAATACGAAGAACACAACAGCGTCACGATACTT
TTTCACCATCCAAAATCAGACGACTGCGAACATTTAACGAATCAGTTTCC
GTTTTACGACGACGCCAAACACTCAGGAAGCAACAACGACAACGAAACAA
TCGTCATCAACCGAATAAGTGAGAATTCGAACAATTTCCAAAAGCTTCTT
TCACACAAAAAACAGCAGTTAATGTCTCGGGCAAAAATCAAAACTTACAG
AATGTCAGCGATAATTATTTCTTGTTTCTTGCTTTGTTGGTTGCCATATT
GGGTTTATTACGTCTTGATCACCTTGAAGAATGCAAGATTAATAAAGTTC
ACTTTGGGTAAAAACATTTGGATTTCAGTGTTCATTCAAAGTCTAGCCAG
TTTGAATTCAGCATTCAATCCAATAATTTACGGATTTTTTAACAGAAATT
TCTTTCTATTTTTCATGAGAAAAAATTTTGGTGGACAGAAAAATCGACGA
AAAATGCAATTTCAATAAGACAGATCGGAA
back to top

protein sequence of SMED30018934-orf-1

>SMED30018934-orf-1 ID=SMED30018934-orf-1|Name=SMED30018934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
YNSSNNLTLPKIPSFNGYNLFKSVFFLVVFFISILGNTHTIFFTLKLQKR
SKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMK
MGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYS
FLLAIPQVLLFDAYRGPWKTVTFYQCTTSDNLNILQMYVYPLVYCVLILL
IPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFP
FYDDAKHSGSNNDNETIVINRISENSNNFQKLLSHKKQQLMSRAKIKTYR
MSAIIISCFLLCWLPYWVYYVLITLKNARLIKFTLGKNIWISVFIQSLAS
LNSAFNPIIYGFFNRNFFLFFMRKNFGGQKNRRKMQFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 58..79
score: 27.48
coord: 342..368
score: 32.78
coord: 103..125
score: 23.73
coord: 21..45
score: 19.47
coord: 191..214
score: 22.15
coord: 298..322
score: 29.38
coord: 138..159
score: 22.23
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 54..360
e-value: 2.7E-39
score: 135.1
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 3..236
e-value: 5.5E-39
score: 135.6
coord: 266..387
e-value: 7.0E-18
score: 66.2
NoneNo IPR availablePANTHERPTHR24241:SF161coord: 27..383
NoneNo IPR availablePANTHERPTHR24241NEUROPEPTIDE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 27..383
NoneNo IPR availableCDDcd149867tmA_Vasopressin-likecoord: 28..361
e-value: 2.23174E-44
score: 153.3
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 8..374
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 102..119
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 36..360
score: 35.638