Glycine N-acyltransferase 3

Overview
NameGlycine N-acyltransferase 3
Smed IDSMED30018929
Length (bp)1004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine N-acyltransferase 3 (SMED30018929) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine N-acyltransferase 3 (SMED30018929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine N-acyltransferase 3 (SMED30018929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine N-acyltransferase 3 (SMED30018929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30018929h1SMcG0017875 Contig39288uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018929h1SMcG0017875 Contig39288newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30018929h1SMcG0017875 dd_Smed_v4_5477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018929h1SMcG0017875 dd_Smed_v4_5477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018929h1SMcG0017875 dd_Smed_v6_5477_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018929h1SMcG0017875 OX_Smed_1.0.01956ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
gutSMED30018929h1SMcG0017875 SMED30018929smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30018929h1SMcG0017875 SMED30018929smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30018929h1SMcG0017875 dd_Smed_v6_5477_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30018929h1SMcG0017875 dd_Smed_v4_5477_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Fly
Match: CG5783 (gene:FBgn0032670 transcript:FBtr0081049)

HSP 1 Score: 53.9138 bits (128), Expect = 5.985e-8
Identity = 42/142 (29.58%), Postives = 63/142 (44.37%), Query Frame = 3
Query:  480 FPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQ-LVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYYM 902
            F  K  D L  K +P  GF  K L   DA LVN  +   +H  +  ++ + I+   S+G Y  + Q LV   I ++ G  G L V D  K    G  + +E    L      ++     SNK S  +F+ LGF+     Y++
Sbjct:  132 FFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWP-NHHEGSLFFVERQIRLCVSVGLYQEDTQELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMFSKLGFQVIDQCYWL 272          
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Fly
Match: CG12560 (gene:FBgn0031974 transcript:FBtr0300761)

HSP 1 Score: 49.6766 bits (117), Expect = 1.539e-6
Identity = 31/123 (25.20%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  531 GFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYY 899
            G   + L   DAE++N+ + + N P +  ++R  I+   ++G Y+   +LV   + +  G+ G L V++  K L LG  +V+   K +      ++      N  S ++F  LGF    ++Y+
Sbjct:  155 GLSLQHLTIEDAEIINENWPH-NKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 276          
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Fly
Match: CG12560 (gene:FBgn0031974 transcript:FBtr0343383)

HSP 1 Score: 48.9062 bits (115), Expect = 2.772e-6
Identity = 29/113 (25.66%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  561 DAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYY 899
            DAE++N+ + + N P +  ++R  I+   ++G Y+   +LV   + +  G+ G L V++  K L LG  +V+   K +      ++      N  S ++F  LGF    ++Y+
Sbjct:  159 DAEIINENWPH-NKPGSIDFVRSLIKYNINLGAYDDKGKLVAWCLRLPIGSLGLLQVLESHKRLGLGSLLVKSMAKKISAAGDQVLAPVVTKNTPSRSMFEKLGFRAIDNTYW 270          
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkey-76k16.6 (si:dkey-76k16.6 [Source:ZFIN;Acc:ZDB-GENE-090312-171])

HSP 1 Score: 60.4622 bits (145), Expect = 6.746e-10
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 3
Query:  549 LRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            L E   ELVN  +K+    D+   I+  I + PS    +S+DQ V   +T  S   G L+ + E +G    K +V   +K LH    P+   TE  N++SY LFT+LGF
Sbjct:  187 LNESHLELVNSNWKFGCE-DSKVMIKNMIANFPSCCVLDSDDQPVAWLLTYVSCALGILYTLPEHRGKGYAKALVTVMSKKLHSQGCPVYCFTEEENQLSYRLFTSLGF 294          
BLAST of Glycine N-acyltransferase 3 vs. TrEMBL
Match: A0A3Q1FZ93 (Si:dkey-76k16.6 OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.056e-9
Identity = 56/231 (24.24%), Postives = 101/231 (43.72%), Query Frame = 3
Query:  198 PQQVYVDRFPECNFILSKYTNKACGKNIEVYVANSEDKSIISDACDAALEMIACENMSYGQIQSSPYF---LYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIE--GFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            P Q++VD++P+ + +  K   K       +    + D++++ +    +             I  + YF   +  S M+ +KK  +   +++    ++  ++   + I K  PI+  G     L E    LV+Q +K+  H      IR+ I + PS    +++ Q V   +T +S   G L+ + E +G    K ++    K  H L  P+    E  N  SY LFTNLGF
Sbjct:   39 PVQIFVDKWPQFSVVFCKPFCKQENDPFRIIFVFATDEAVLEETLRKS-----------SLIDWTRYFGLGMNNSHMEILKK--MASEKNVPCRKISVCHRMRLEDISKLPPIDSSGISLSSLDESHIGLVSQTWKFVEHEGAVGMIRRMISNFPSFCVLDADGQPVSWILTYDSCAMGMLYTLPEHRGKGYAKVLISSMAKRHHALGHPVYCFIEEENTTSYRLFTNLGF 256          
BLAST of Glycine N-acyltransferase 3 vs. TrEMBL
Match: A0A3Q1EB78 (Si:dkey-76k16.6 OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.818e-9
Identity = 41/125 (32.80%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  507 IEKTKPIE--GFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            I K  PI+  G     L E    LV+Q +K+  H      IR+ I + PS    +++ Q V   +T +S   G L+ + E +G    K ++    K  H L  P+    E  N  SY LFTNLGF
Sbjct:  162 ISKLPPIDSSGISLSSLDESHIGLVSQTWKFVEHEGAVGMIRRMISNFPSFCVLDADGQPVSWILTYDSCAMGMLYTLPEHRGKGYAKVLISSMAKRHHALGHPVYCFIEEENTTSYRLFTNLGF 286          
BLAST of Glycine N-acyltransferase 3 vs. TrEMBL
Match: A0A3P8R647 (Si:dkey-76k16.6 OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.422e-8
Identity = 65/238 (27.31%), Postives = 95/238 (39.92%), Query Frame = 3
Query:  198 PQQVYVDRFPECNFILSKYTNKACGKNIEVYVANSEDKS-IISDACDAALEMIACENM--SYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKL-------IEKTKPIE--GFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            P +V VDR+P+   I+ K               + E KS +  DA   A +    E +      I  S YF    +  SV   E++      A+    P K + K        + +  P++  G     L E    LV+Q +K+         IR  I + PS    ++  + V   +T  SG  G L+ + E +G    K +V    K  H L  P+    E  N VSY LFTNLGF
Sbjct:   41 PVRVLVDRWPQFRVIMCK--------------PHGEQKSDLFKDALLFATDAAVLEEILSKSSVIDWSKYF---CVGTSVSHTEIF---KAVASAKGVPCKRVAKCYLMTLEDVSRLPPVDSSGISVSSLDESHIGLVSQTWKFGKVDVAVGLIRNMIANFPSCCVLDAEGKPVSWILTYASGAIGMLYTLPEHRGKGYAKILVSSLAKRNHALGYPVYSFIEEENAVSYRLFTNLGF 258          
BLAST of Glycine N-acyltransferase 3 vs. TrEMBL
Match: A0A3P9BP68 (N-acetyltransferase domain-containing protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.005e-8
Identity = 65/238 (27.31%), Postives = 94/238 (39.50%), Query Frame = 3
Query:  198 PQQVYVDRFPECNFILSKYTNKACGKNIEVYVANSEDKS-IISDACDAALEMIACENM--SYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKL-------IEKTKPIE--GFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            P +V VDR+P+   I+ K               + E KS +  DA   A +    E +      I  S YF    +  SV   E++      A+    P K + K        + +  P++  G     L E    LVNQ +K+         IR  I + PS    ++  + V   +T  SG  G L+ + E +G    K +V    K  H L  P+       N VSY LFTNLGF
Sbjct:   19 PVRVLVDRWPQFRVIMCK--------------PHGEQKSDLFKDALLFATDAAVLEEILSKSSVIDWSKYF---CVGTSVSHTEIF---KAVASAKGVPCKRVAKCYLMTLEDVSRLPPVDSSGISVSSLDESHIGLVNQTWKFGKVDVAVGLIRNMIANFPSCCVLDAEGKPVSWILTYASGAIGMLYTLPEHRGKGYAKILVSSLAKRNHALGYPVYSFIGEENAVSYRLFTNLGF 236          
BLAST of Glycine N-acyltransferase 3 vs. TrEMBL
Match: A0A060VV61 (N-acetyltransferase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077769001 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 9.816e-8
Identity = 62/234 (26.50%), Postives = 101/234 (43.16%), Query Frame = 3
Query:  198 PQQVYVDRFPECNFILSKYTNKACGKNIEVYVANSEDKSIISDACDAALEMIACENMSYGQIQSSPYFL-------YPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNS-NDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            P QV+VDR+PE N IL K   +  G   +     ++D        +A+   I  EN     I     FL       Y  ++ +V          +   C     ++  +L      IE      L E   +LVN+ +K+ N  ++++ IR  I+  PS    ++ + Q +   +T  S   G L+ + E +G  L K +V   ++ L+    P+    E  N +SYNL+TNLGF
Sbjct:   34 PIQVFVDRWPEFNVILCKPPYEKEGDLFKDTCVFTKD--------EASFRNILGEN----NIIDWTKFLCLGTSLCYEEMVMAVASERKVPVNKVSV-CHMMMLQDPSRLPPVESAIESMISS-LDESHTDLVNKTWKFGNTENSFQMIRNMIRHYPSCCVLDAESQQPIAWVLTYPSCAMGMLYTLQEHRGQGLAKALVSSMSRRLYSQGFPVYCFVEEENILSYNLYTNLGF 253          
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Cavefish
Match: si:dkey-76k16.6 (glycine N-acyltransferase-like protein 3 [Source:NCBI gene;Acc:103024918])

HSP 1 Score: 50.447 bits (119), Expect = 9.104e-7
Identity = 63/279 (22.58%), Postives = 117/279 (41.94%), Query Frame = 3
Query:   57 LKLLNSQEKLKILKRLKSLVDKFQQSNNNEMWWHSTRMEYSLKNELVPQQVYVDRFPECNFILSKYTNKACG---KNIEVYV---ANSEDKSIISDACDAALEMIACENMSYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            +KLL+S+E  ++ K L+  + K QQ       +   R+E    +      V+VDR+PE   +L +   +      K I ++    A+ ++K + +D  D       C +   G  ++       +  K V + +L +       C     +N  KL      ++      L+E   +LVN+ +K+ +   + + IR  ++  PS     S+ Q V   +T      G L+ + E +G    + ++    + L     P+    E  N +SY LF +LGF
Sbjct:    1 MKLLSSEELREVEKTLRGYLPKSQQVYG--FVFLINRVEADRID------VFVDRWPEFRVLLVRPVKQEENDFYKGISIFTTDEASLKNKLLQTDILDWT--QYNCLSFDIGHAETVKAV---AAQKGVPETQLSM-------CHMMILQNPSKLQTNRLSVQ---LSSLQEAHVDLVNRTWKFNSGKYSERLIRNMVRSYPSCCVLGSDGQPVAWILTYSYCAMGMLYTLPEHRGRGYARALISAMAQKLLSEGYPVYCYIEEENTLSYRLFQSLGF 256          
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Medaka
Match: si:dkey-76k16.6 (si:dkey-76k16.6 [Source:ZFIN;Acc:ZDB-GENE-090312-171])

HSP 1 Score: 59.3066 bits (142), Expect = 6.769e-10
Identity = 33/103 (32.04%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  567 ELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            +LVNQ +K+  HP T   IR  I   PS    +   + V   +T      G L+ + E +G    K ++    K L     P+    E  N VSY LFT++GF
Sbjct:  117 DLVNQTWKFGKHPGTLGMIRDMIAHFPSRCVLDPEGRPVSWILTYACCAMGMLYTLPEHRGRGYAKALIGSMAKTLKAQGYPVFCFVEEENAVSYQLFTSMGF 219          
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Medaka
Match: si:dkey-76k16.6 (si:dkey-76k16.6 [Source:ZFIN;Acc:ZDB-GENE-090312-171])

HSP 1 Score: 58.9214 bits (141), Expect = 8.021e-10
Identity = 33/103 (32.04%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  567 ELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGF 875
            +LVNQ +K+  HP T   IR  I   PS    +   + V   +T      G L+ + E +G    K ++    K L     P+    E  N VSY LFT++GF
Sbjct:  112 DLVNQTWKFGKHPGTLGMIRDMIAHFPSRCVLDPEGRPVSWILTYACCAMGMLYTLPEHRGRGYAKALIGSMAKTLKAQGYPVFCFVEEENAVSYQLFTSMGF 214          
BLAST of Glycine N-acyltransferase 3 vs. Planmine SMEST
Match: SMESG000063826.1 (SMESG000063826.1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 294/295 (99.66%), Postives = 294/295 (99.66%), Query Frame = 3
Query:   54 MLKLLNSQEKLKILKRLKSLVDKFQQSNNNEMWWHSTRMEYSLKNELVPQQVYVDRFPECNFILSKYTNKACGKNIEVYVANSEDKSIISDACDAALEMIACENMSYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYYMLLSKSPEIKDAT 938
            MLKLLNSQEKLKILKRLKSLVDKFQQSNNNEMWWHSTRMEYSLKNELVPQQVYVDRFPECNFILSKYTNKACGKNIEVYVAN EDKSIISDACDAALEMIACENMSYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYYMLLSKSPEIKDAT
Sbjct:    1 MLKLLNSQEKLKILKRLKSLVDKFQQSNNNEMWWHSTRMEYSLKNELVPQQVYVDRFPECNFILSKYTNKACGKNIEVYVANFEDKSIISDACDAALEMIACENMSYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYYMLLSKSPEIKDAT 295          
BLAST of Glycine N-acyltransferase 3 vs. Planmine SMEST
Match: SMESG000044281.1 (SMESG000044281.1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.198e-19
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 3
Query:  156 HSTRMEYSLKNELVPQQVYVDRFPECNFILSKYTNKACG--KNIEVYVAN--SEDKSIISDACDAALEMIACENMSYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYN-SNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYYMLLSKSPEI 926
             + R+  SL   ++ ++++V+     N IL  +T +     +N EV++ +  S D+    +    A      E       ++ P +L  +  K    + + +   I     +F ++N  K I++ + I+GF    +   + E + + +KY    D Y WIR SI++ PSMG ++ S ++++GQFI M +G  G L + +E +G  L K +V  T K + + N  + ++ E  N VS  LF NLGFE    S Y++  K   I
Sbjct:   38 ETGRLFQSLSCLIIKKRIFVNDMNNVNVILLNFTTQKIRTVQNFEVWINDCMSTDEMESINYQILAFSQFLVEKNYIVFFRNLPIYLADNFDKIKTDFNVNIPFRIKTEIYSFDFEN--KQIQEHQ-IQGFQLNHIPIKNLETIIKNWKYGVVQD-YDWIRNSIENFPSMGIWDASRNKMIGQFIYMITGTHGSLTIDNEYRGRGLAKMLVLGTLKEIRQRNMEIFIDIEEGNVVSKCLFENLGFEKVTESIYLVFDKLGNI 295          
BLAST of Glycine N-acyltransferase 3 vs. Planmine SMEST
Match: SMESG000035878.1 (SMESG000035878.1)

HSP 1 Score: 79.7221 bits (195), Expect = 8.016e-17
Identity = 70/281 (24.91%), Postives = 134/281 (47.69%), Query Frame = 3
Query:   78 EKLKILKRLKSLVDKFQQSNNNEMWWHSTRMEYSLKNELVPQQVYVDRFPECNFILSKYTNKACGKN-IEVYVANSEDKSIISDACDAALEMIACENMSYGQIQS---SPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDKLIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSMGCYN-SNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKLNKPMILETEFSNKVSYNLFTNLGFETRAHSYYML 905
            +K  IL  LKS   ++ ++ N + +WH+ R    LK  +V + ++V        IL+ +  K   K  IE ++ +      +  A +  L +I     + G I +    P  ++  L+    +++L   + I  NC      N          IEGF  + + + + + V + +K+   P+   WI+ SI++ PSMG ++   +++VGQFI + +G FG L + +  +G KL + +++   + + +     ++E E  N  S NLF    F   +HS+Y++
Sbjct:   11 KKSPILNVLKSKKAQYLENQNLDRYWHTVRAYQGLKYLVVKKNIFVYDIQNVKVILATFEMKEHHKVYIEFWMNDEWSMKELECAFEEILNIIKVFT-NQGMIVTFLCLPTNIFEYLLSKSDEHQL---KPIFRNCCNTYLNNNRGGDNIPNLIEGFQLRKIPKENIDEVIKNWKHG-RPEQRDWIKNSIENWPSMGVWDVETNEMVGQFIFLFTGTFGALTIKEAYRGKKLAEMLIKGFRECVKECKMEFLIEVEEENVASQNLFIKQNFVEVSHSHYLV 286          
The following BLAST results are available for this feature:
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG57835.985e-829.58gene:FBgn0032670 transcript:FBtr0081049[more]
CG125601.539e-625.20gene:FBgn0031974 transcript:FBtr0300761[more]
CG125602.772e-625.66gene:FBgn0031974 transcript:FBtr0343383[more]
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-76k16.66.746e-1035.78si:dkey-76k16.6 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q1FZ932.056e-924.24Si:dkey-76k16.6 OS=Acanthochromis polyacanthus OX=... [more]
A0A3Q1EB782.818e-932.80Si:dkey-76k16.6 OS=Acanthochromis polyacanthus OX=... [more]
A0A3P8R6475.422e-827.31Si:dkey-76k16.6 OS=Astatotilapia calliptera OX=815... [more]
A0A3P9BP687.005e-827.31N-acetyltransferase domain-containing protein OS=M... [more]
A0A060VV619.816e-826.50N-acetyltransferase domain-containing protein OS=O... [more]
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-76k16.69.104e-722.58glycine N-acyltransferase-like protein 3 [Source:N... [more]
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine N-acyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-76k16.66.769e-1032.04si:dkey-76k16.6 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
si:dkey-76k16.68.021e-1032.04si:dkey-76k16.6 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
back to top
BLAST of Glycine N-acyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000063826.10.000e+099.66SMESG000063826.1[more]
SMESG000044281.12.198e-1927.48SMESG000044281.1[more]
SMESG000035878.18.016e-1724.91SMESG000035878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018929 ID=SMED30018929|Name=Glycine N-acyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1004bp
CCGATCTGTTGGTTTCGTTGATTTAGTTGTGTAGTTTTGATTAGTTTTTC
AAGATGTTAAAATTATTGAATAGTCAAGAAAAACTAAAAATTCTCAAACG
CCTAAAATCTCTTGTTGATAAATTTCAGCAAAGTAACAACAATGAGATGT
GGTGGCATTCGACAAGAATGGAGTACAGTCTGAAGAATGAATTGGTTCCT
CAACAAGTCTATGTAGATCGATTTCCTGAATGCAATTTTATTCTTTCTAA
GTACACAAATAAAGCATGCGGAAAAAATATAGAAGTTTATGTAGCCAATT
CTGAAGACAAAAGCATTATAAGTGATGCCTGTGATGCAGCACTAGAAATG
ATTGCCTGTGAAAATATGTCATACGGTCAAATCCAATCAAGTCCATATTT
TTTGTATCCTTCTTTGATGAAGTCAGTAAAAAAGTATGAACTTTATCTTT
TTGAAGATATTGGTGCCAATTGCATGACATTTCCTTACAAAAATATAGAT
AAATTGATAGAAAAGACCAAACCAATTGAAGGATTTTACTGCAAACCTTT
AAGAGAATGTGACGCAGAATTAGTAAATCAACGTTTCAAATATGCCAATC
ATCCTGACACGTATAAATGGATTAGAAAGTCAATTCAGGACTTGCCAAGC
ATGGGATGTTACAATAGTAATGATCAATTAGTTGGACAATTTATAACTAT
GGAATCGGGAAATTTTGGGGGTTTATTTGTAATTGATGAATGCAAGGGAC
TGAAACTGGGCAAATGGATTGTTCAAGAAACTACAAAACTTTTACACAAA
TTAAATAAACCAATGATTTTGGAAACTGAGTTTAGCAATAAGGTTTCATA
CAACCTTTTCACCAATCTCGGGTTTGAAACAAGAGCTCATTCTTACTACA
TGTTGCTAAGTAAAAGTCCTGAAATTAAAGATGCAACGTGAGGTTAATAT
TTTAATCCGCAATCTAACTCATTTTAATAATAAATATTGTTATTAGAGAT
CGGA
back to top

protein sequence of SMED30018929-orf-1

>SMED30018929-orf-1 ID=SMED30018929-orf-1|Name=SMED30018929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
MLKLLNSQEKLKILKRLKSLVDKFQQSNNNEMWWHSTRMEYSLKNELVPQ
QVYVDRFPECNFILSKYTNKACGKNIEVYVANSEDKSIISDACDAALEMI
ACENMSYGQIQSSPYFLYPSLMKSVKKYELYLFEDIGANCMTFPYKNIDK
LIEKTKPIEGFYCKPLRECDAELVNQRFKYANHPDTYKWIRKSIQDLPSM
GCYNSNDQLVGQFITMESGNFGGLFVIDECKGLKLGKWIVQETTKLLHKL
NKPMILETEFSNKVSYNLFTNLGFETRAHSYYMLLSKSPEIKDAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004869cysteine-type endopeptidase inhibitor activity
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0008080N-acetyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0047961glycine N-acyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR010313Glycine_N-acyltransferase
IPR016181Acyl_CoA_acyltransferase
IPR013653FR47
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013653FR47-likePFAMPF08445FR47coord: 201..282
e-value: 1.1E-7
score: 31.7
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 150..274
e-value: 1.2E-19
score: 72.6
IPR010313Glycine N-acyltransferasePANTHERPTHR15298L-COA N-ACYLTRANSFERASE-RELATEDcoord: 16..284
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 134..276