SMED30018901

Overview
NameSMED30018901
Smed IDSMED30018901
Length (bp)507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018901 (SMED30018901) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018901 (SMED30018901) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018901

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30018901SMESG000033673.1 SmedASXL_017381SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30018901SMESG000033673.1 dd_1071dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30018901SMESG000033673.1 dd_Smed_v6_1071_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018901SMESG000033673.1 OX_Smed_1.0.09131ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018901SMESG000033673.1 OX_Smed_1.0.14492ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018901SMESG000033673.1 dd_Smed_v6_1071_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30018901SMESG000033673.1 dd_Smed_v6_1071_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30018901SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018901 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007402:13242..14969 -2493
v31.007402:6301..8207 -1994
Homology
BLAST of SMED30018901 vs. Planmine SMEST
Match: SMESG000033673.1 (SMESG000033673.1)

HSP 1 Score: 323.553 bits (828), Expect = 1.031e-102
Identity = 166/168 (98.81%), Postives = 167/168 (99.40%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEG KCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKC+NNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct: 1148 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGNKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCNNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 1315          

HSP 2 Score: 278.485 bits (711), Expect = 5.288e-87
Identity = 145/168 (86.31%), Postives = 152/168 (90.48%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKN CPLPKE+++RCI+G Q VM++TF  VGN C     RV + KCQ C K SYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct:  776 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVGLVKCQGCPKPSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 943          

HSP 3 Score: 275.404 bits (703), Expect = 5.777e-86
Identity = 144/168 (85.71%), Postives = 152/168 (90.48%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKN CPLPKE+++RCI+G Q VM++TF  VGN C     RV + KCQ C K SYKVEKC+NNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct: 1486 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKCQGCPKPSYKVEKCNNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 1653          

HSP 4 Score: 214.927 bits (546), Expect = 8.270e-65
Identity = 112/168 (66.67%), Postives = 126/168 (75.00%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVG                 C ++ Y++++C+ N K T LIR  ++  N  C+R +  +  LPC+CY N   N+TV  G  CQ
Sbjct: 1858 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVG-----------------CPRSVYRIDRCEKNAKETFLIRTFFQSANGVCLRKELKLKTLPCKCYDNVTRNITVIIGPSCQ 2008          

HSP 5 Score: 161.384 bits (407), Expect = 4.218e-46
Identity = 78/167 (46.71%), Postives = 114/167 (68.26%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI   Q + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  NT  N+ V  G+QCQ
Sbjct: 1673 KVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQCQ 1839          

HSP 6 Score: 159.458 bits (402), Expect = 1.946e-45
Identity = 77/167 (46.11%), Postives = 113/167 (67.66%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI   Q + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  N   N+ V  G+QCQ
Sbjct:  591 KVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQ 757          

HSP 7 Score: 156.377 bits (394), Expect = 1.892e-44
Identity = 76/167 (45.51%), Postives = 112/167 (67.07%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI     + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  N   N+ V  G+QCQ
Sbjct:  963 KVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKLAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQ 1129          

HSP 8 Score: 152.525 bits (384), Expect = 4.612e-43
Identity = 87/161 (54.04%), Postives = 108/161 (67.08%), Query Frame = -3
Query:    2 CQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCK--NPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQ--RCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 472
            C   C + L +   +CV+N + +  +       KC+ +    K+ NC     CP PK   + CI+G + +MK+++ LVG KC  +  R+    C   +C K SYKVEKC+NNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct:  411 CDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCIEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYKVEKCNNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 571          

HSP 9 Score: 101.293 bits (251), Expect = 3.841e-25
Identity = 62/167 (37.13%), Postives = 89/167 (53.29%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI   Q + ++TF  VG+KC    +R+++  CQ              +  N  LI                    L  +C  NT  N+ V  G+QCQ
Sbjct: 1335 KVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQ--------------DSFNILLI--------------------LSGRCTGNTTKNINVVVGKQCQ 1467          

HSP 10 Score: 79.7221 bits (195), Expect = 1.037e-17
Identity = 54/166 (32.53%), Postives = 89/166 (53.61%), Query Frame = -3
Query:   20 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGK-KCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRC-QKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQC--YRNTETNVTVT 505
            +K  FKLR I+C+  C+R    +V  C  NKRL++ +K +K     C  K+++S  VNC + CP P+ + T CI G + +++I++   G KC     ++   KCQ C +K+ Y++ +C    K + L+R ++R    +C R    +  + C C    N   NVT T
Sbjct: 2027 IKETFKLRSIKCEGACNR-TNQIVGPCFLNKRLVKVLKQIKSNNGSCHWKLLSSTFVNCSHKCPEPQIKTTACINGERFMVRISYQETGGKCEKREQKLQTLKCQTCFRKSVYELMECSKTSKTSELVRTSHR----NCTRKVEKLLDVDCLCEGLNNYGLNVTST 2187          
BLAST of SMED30018901 vs. Planmine SMEST
Match: SMESG000033673.1 (SMESG000033673.1)

HSP 1 Score: 323.168 bits (827), Expect = 1.353e-102
Identity = 166/168 (98.81%), Postives = 167/168 (99.40%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEG KCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKC+NNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct: 1148 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGNKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCNNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 1315          

HSP 2 Score: 278.1 bits (710), Expect = 6.612e-87
Identity = 145/168 (86.31%), Postives = 152/168 (90.48%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKN CPLPKE+++RCI+G Q VM++TF  VGN C     RV + KCQ C K SYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct:  776 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVGLVKCQGCPKPSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 943          

HSP 3 Score: 275.018 bits (702), Expect = 7.154e-86
Identity = 144/168 (85.71%), Postives = 152/168 (90.48%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKN CPLPKE+++RCI+G Q VM++TF  VGN C     RV + KCQ C K SYKVEKC+NNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct: 1520 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKCQGCPKPSYKVEKCNNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 1687          

HSP 4 Score: 257.684 bits (657), Expect = 7.946e-80
Identity = 129/168 (76.79%), Postives = 143/168 (85.12%), Query Frame = -3
Query:    2 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 505
            VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRC ++ Y++++C+ N K T LIR  ++  N  C+R +  +  LPC+CY N   N+TV  G  CQ
Sbjct: 1892 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCPRSVYRIDRCEKNAKETFLIRTFFQSANGVCLRKELKLKTLPCKCYDNVTRNITVIIGPSCQ 2059          

HSP 5 Score: 161.384 bits (407), Expect = 4.389e-46
Identity = 78/167 (46.71%), Postives = 114/167 (68.26%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI   Q + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  NT  N+ V  G+QCQ
Sbjct: 1707 KVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQCQ 1873          

HSP 6 Score: 160.999 bits (406), Expect = 4.929e-46
Identity = 78/167 (46.71%), Postives = 114/167 (68.26%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI   Q + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  NT  N+ V  G+QCQ
Sbjct: 1335 KVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQCQ 1501          

HSP 7 Score: 159.458 bits (402), Expect = 2.045e-45
Identity = 77/167 (46.11%), Postives = 113/167 (67.66%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI   Q + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  N   N+ V  G+QCQ
Sbjct:  591 KVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQ 757          

HSP 8 Score: 156.377 bits (394), Expect = 1.988e-44
Identity = 76/167 (45.51%), Postives = 112/167 (67.07%), Query Frame = -3
Query:    2 KVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 502
            KVAFKLR IRC++PC R+ K+ V KC SN+R +  +++V+E  +C+ K+V SK V CK  CP PKE+R+RCI     + ++TF  VG+KC    +R+++  CQ CQ ++Y++EKCD   K T L+R  Y++TN +CV+ +  V KL C+C  N   N+ V  G+QCQ
Sbjct:  963 KVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKLAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQ 1129          

HSP 9 Score: 152.525 bits (384), Expect = 5.135e-43
Identity = 87/161 (54.04%), Postives = 108/161 (67.08%), Query Frame = -3
Query:    2 CQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCK--NPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQ--RCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 472
            C   C + L +   +CV+N + +  +       KC+ +    K+ NC     CP PK   + CI+G + +MK+++ LVG KC  +  R+    C   +C K SYKVEKC+NNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ
Sbjct:  411 CDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCIEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYKVEKCNNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQ 571          

HSP 10 Score: 79.7221 bits (195), Expect = 1.038e-17
Identity = 54/166 (32.53%), Postives = 89/166 (53.61%), Query Frame = -3
Query:   20 VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGK-KCVLKVVNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQRC-QKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQC--YRNTETNVTVT 505
            +K  FKLR I+C+  C+R    +V  C  NKRL++ +K +K     C  K+++S  VNC + CP P+ + T CI G + +++I++   G KC     ++   KCQ C +K+ Y++ +C    K + L+R ++R    +C R    +  + C C    N   NVT T
Sbjct: 2078 IKETFKLRSIKCEGACNR-TNQIVGPCFLNKRLVKVLKQIKSNNGSCHWKLLSSTFVNCSHKCPEPQIKTTACINGERFMVRISYQETGGKCEKREQKLQTLKCQTCFRKSVYELMECSKTSKTSELVRTSHR----NCTRKVEKLLDVDCLCEGLNNYGLNVTST 2238          
The following BLAST results are available for this feature:
BLAST of SMED30018901 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018901 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000033673.11.031e-10298.81SMESG000033673.1[more]
SMESG000033673.11.353e-10298.81SMESG000033673.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018901 ID=SMED30018901|Name=SMED30018901|organism=Schmidtea mediterranea sexual|type=transcript|length=507bp
TTTGACATTGTCGACCGAATGTCACTGTTACATTCGTTTCAGTATTTCGA
TAACATTGGCATGGGAGTTTTGTGACTGTGGTCTGCGTCCTGACGCACGA
GGAATTAGTCTGTCGGTACGCAACACGAATCAGTGAAGTGTTCTTTTGAT
TGTTATCGCACTTTTCAACTTTGTATGAAGTCTTTTGACATCTCTGACAT
TTTGTAATGTTGACTCGAACGAATAATGCATTACATTTATTACCAACTAA
ATTAAAAGTAATTTTCATCACTCCTTGAATTCCTTTTATACACCTGGTAC
GCCTTTCTTTCGGTAATGGACAAGGATTCTTACAATTCACTGTCTTGCTG
TTGACGACCTTCAATACGCATTTCTTTCCTTCTTTCACGGATTTCATGCG
TTGAATCAATCTCTTATTCGATACGCATTTATTGACGACGAGCTTCAGTT
TCCTACTGCATGGTCTTTGACATCTGATTCTTCTCAACTTGAAAGCGACT
TTTACAC
back to top

protein sequence of SMED30018901-orf-1

>SMED30018901-orf-1 ID=SMED30018901-orf-1|Name=SMED30018901-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
VKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKV
VNSKTVNCKNPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNI
TKCQRCQKTSYKVEKCDNNQKNTSLIRVAYRQTNSSCVRTQTTVTKLPCQ
CYRNTETNVTVTFGRQCQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 104..104