Intraflagellar transport protein 56

Overview
NameIntraflagellar transport protein 56
Smed IDSMED30018900
Length (bp)1921
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intraflagellar transport protein 56 (SMED30018900) t-SNE clustered cells

Violin plots show distribution of expression levels for Intraflagellar transport protein 56 (SMED30018900) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intraflagellar transport protein 56 (SMED30018900) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intraflagellar transport protein 56 (SMED30018900) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018900

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018900SMESG000031670.1 SmedASXL_006468SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018900SMESG000031670.1 dd_Smed_v4_12618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018900SMESG000031670.1 dd_Smed_v4_12618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018900SMESG000031670.1 dd_Smed_v4_12618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018900SMESG000031670.1 dd_Smed_v4_12618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018900SMESG000031670.1 dd_Smed_v4_12618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018900SMESG000031670.1 dd_Smed_v6_12618_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018900SMESG000031670.1 OX_Smed_1.0.16191ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018900SMESG000031670.1 dd_Smed_v4_12618_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intraflagellar transport protein 56 vs. Ensembl Human
Match: TTC26 (tetratricopeptide repeat domain 26 [Source:HGNC Symbol;Acc:HGNC:21882])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 346/484 (71.49%), Postives = 416/484 (85.95%), Query Frame = 2
Query:  113 MLLSRSKPANSLT---TNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HKFNDE++LM++HQNLQD+ EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNG+AAE+ELK+L D +S SF FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:    1 MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 484          

HSP 2 Score: 114.775 bits (286), Expect = 3.162e-26
Identity = 46/73 (63.01%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A +E K+ LRE++ LLR++ N Q+EY+I+I++KWAKEN +++
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI 554          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Human
Match: TTC26 (tetratricopeptide repeat domain 26 [Source:HGNC Symbol;Acc:HGNC:21882])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 338/473 (71.46%), Postives = 406/473 (85.84%), Query Frame = 2
Query:  113 MLLSRSKPANSLT---TNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYK 1522
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HKFNDE++LM++HQNLQD+ EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNG+AAE+ELK+L D +S SF FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YK
Sbjct:    1 MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYK 473          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Human
Match: TTC26 (tetratricopeptide repeat domain 26 [Source:HGNC Symbol;Acc:HGNC:21882])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 329/483 (68.12%), Postives = 394/483 (81.57%), Query Frame = 2
Query:  113 MLLSRSKPANSLT---TNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE                               EY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HKFNDE++LM++HQNLQD+ EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNG+AAE+ELK+L D +S SF FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA
Sbjct:    1 MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLE-------------------------------EYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKA 452          

HSP 2 Score: 115.161 bits (287), Expect = 2.071e-26
Identity = 46/73 (63.01%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A +E K+ LRE++ LLR++ N Q+EY+I+I++KWAKEN +++
Sbjct:  451 KAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI 523          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Human
Match: TTC26 (tetratricopeptide repeat domain 26 [Source:HGNC Symbol;Acc:HGNC:21882])

HSP 1 Score: 404.445 bits (1038), Expect = 7.307e-140
Identity = 207/334 (61.98%), Postives = 251/334 (75.15%), Query Frame = 2
Query:  623 YKRILLENREFLALNVYVALCYYKL-DYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAES----------------------ELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            +KR + E  E    N+++  C + L DY    +E      ++  +S V +NL AC +F L   K AE+                      ELK+L D +S SF FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+  D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:   48 FKRHVGEEEE--DTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNL-ACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLR-QDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 377          

HSP 2 Score: 114.775 bits (286), Expect = 7.307e-140
Identity = 46/73 (63.01%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A +E K+ LRE++ LLR++ N Q+EY+I+I++KWAKEN +++
Sbjct:  375 KAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI 447          

HSP 3 Score: 151.369 bits (381), Expect = 4.435e-39
Identity = 72/133 (54.14%), Postives = 94/133 (70.68%), Query Frame = 2
Query:  113 MLLSRSKPANSLT---TNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHK 502
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HK
Sbjct:    1 MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHK 133          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Human
Match: TTC26 (tetratricopeptide repeat domain 26 [Source:HGNC Symbol;Acc:HGNC:21882])

HSP 1 Score: 380.178 bits (975), Expect = 1.643e-132
Identity = 194/319 (60.82%), Postives = 239/319 (74.92%), Query Frame = 2
Query:  623 YKRILLENREFLALNVYVALCYYKL-DYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNL-------TVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            +KR + E  E    N+++  C + L DY    +E      ++  +S V +NL AC +F L   K AE+            F  +K  +++ L        VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:   48 FKRHVGEEEE--DTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNL-ACTYFFLGMYKQAEA----------AGFKASKSRLQNRLLFHLAHKVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 353          

HSP 2 Score: 114.39 bits (285), Expect = 1.643e-132
Identity = 46/73 (63.01%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A +E K+ LRE++ LLR++ N Q+EY+I+I++KWAKEN +++
Sbjct:  351 KAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI 423          

HSP 3 Score: 156.377 bits (394), Expect = 4.653e-41
Identity = 87/179 (48.60%), Postives = 117/179 (65.36%), Query Frame = 2
Query:  113 MLLSRSKPANSLT---TNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHK--FNDERRLMTYHQNLQDII-EDQLSLASIHYLR-NHYQEAIDVYK 628
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HK  F      +     L D+I E +L+L  I+YLR +  QEA ++ K
Sbjct:    1 MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKVVFRGGEGALQVLPPLVDVIPEARLNLV-IYYLRQDDVQEAYNLIK 178          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Celegans
Match: dyf-13 (Intraflagellar transport protein 56 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95QT8])

HSP 1 Score: 353.599 bits (906), Expect = 4.135e-114
Identity = 191/481 (39.71%), Postives = 294/481 (61.12%), Query Frame = 2
Query:  170 KYKELPKLEDFLIKRDYTGSITLLEY---SKNADSSPENA-ELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTL-YDISSPSFTFAKDL---------------IKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            K +++P+L+DFL  +DY G+I+LL +   + N D   E++ +LW+A+C + L +Y++A   Y  +   +    ++ VY+ CC+F+L  Y E+   A+K PK+ L  RL  ++S + NDE+R++T+H +L D +ED+LSLA ++Y R HYQ+AI+VY  +L  +   + LNV +ALCY K+DY  V+  +++ YL+ FP+S  A NL     ++    K    E   L  +I     T   D+                KHNL +F+N + ALQ LPSL+  +PEAR+NL++Y+L  N++  A  L KD DP TP E+++K +     GQ+ NSRE+LK+A+ +FQ+VG S    DTI GRQ  A+  FL  +FDDV+ YL SI++YF N+D F  N AQA     NY  AE++F+ V   + +   +Y S LA+C++ NKK + AW++ LK    ++  SLL+++A D Y   EFYYA+KA
Sbjct:   19 KAQKMPELDDFLSNQDYEGAISLLNHKLKAGNLDREEEDSLQLWLAHCYYRLRNYEEAANVYTFLMNKDDAPAELGVYLACCKFYLKQYIEAKSIAEKCPKTPLCIRLMMNVSLRLNDEKRILTFHSSLGDTLEDRLSLAGVNYSRMHYQDAIEVYTSVLQTSPNLIGLNVNMALCYAKMDYPHVAYNLIKNYLRNFPNSPFAKNLLLSVLYRTITSKTTVDEKSELARNIDQEGLTMVSDMEALLKQKLYPEIEYICKHNLVLFKNCETALQVLPSLMKHIPEARVNLILYHLNKNNVKDAISLCKDFDPVTPYEFLVKALTFLRHGQETNSREHLKIAENFFQMVGESGLVQDTIAGRQSSAAYLFLSFKFDDVITYLKSIEAYFTNNDDFLLNLAQAYLMYKNYVAAEKLFIRVSGPE-RDKILYKSMLARCYVRNKKPQSAWDMMLKTNNPSDRMSLLKVIAQDCYIANEFYYASKA 498          

HSP 2 Score: 57.3806 bits (137), Expect = 2.176e-8
Identity = 27/77 (35.06%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESK----DKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+F  +E  DP  E W GKRG+C GLF+  LAN ++      ++RE+V L+    +   E+++K++R WA+ + + +
Sbjct:  497 KAFHEIEISDPTTENWSGKRGACAGLFRQ-LANHKTDPILISQMREVVHLVAMKPHSNCEFLLKVVRNWAETHNVNI 572          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Celegans
Match: dyf-13 (Intraflagellar transport protein 56 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95QT8])

HSP 1 Score: 351.288 bits (900), Expect = 1.835e-113
Identity = 190/477 (39.83%), Postives = 291/477 (61.01%), Query Frame = 2
Query:  182 LPKLEDFLIKRDYTGSITLLEY---SKNADSSPENA-ELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTL-YDISSPSFTFAKDL---------------IKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            +P+L+DFL  +DY G+I+LL +   + N D   E++ +LW+A+C + L +Y++A   Y  +   +    ++ VY+ CC+F+L  Y E+   A+K PK+ L  RL  ++S + NDE+R++T+H +L D +ED+LSLA ++Y R HYQ+AI+VY  +L  +   + LNV +ALCY K+DY  V+  +++ YL+ FP+S  A NL     ++    K    E   L  +I     T   D+                KHNL +F+N + ALQ LPSL+  +PEAR+NL++Y+L  N++  A  L KD DP TP E+++K +     GQ+ NSRE+LK+A+ +FQ+VG S    DTI GRQ  A+  FL  +FDDV+ YL SI++YF N+D F  N AQA     NY  AE++F+ V   + +   +Y S LA+C++ NKK + AW++ LK    ++  SLL+++A D Y   EFYYA+KA
Sbjct:    1 MPELDDFLSNQDYEGAISLLNHKLKAGNLDREEEDSLQLWLAHCYYRLRNYEEAANVYTFLMNKDDAPAELGVYLACCKFYLKQYIEAKSIAEKCPKTPLCIRLMMNVSLRLNDEKRILTFHSSLGDTLEDRLSLAGVNYSRMHYQDAIEVYTSVLQTSPNLIGLNVNMALCYAKMDYPHVAYNLIKNYLRNFPNSPFAKNLLLSVLYRTITSKTTVDEKSELARNIDQEGLTMVSDMEALLKQKLYPEIEYICKHNLVLFKNCETALQVLPSLMKHIPEARVNLILYHLNKNNVKDAISLCKDFDPVTPYEFLVKALTFLRHGQETNSREHLKIAENFFQMVGESGLVQDTIAGRQSSAAYLFLSFKFDDVITYLKSIEAYFTNNDDFLLNLAQAYLMYKNYVAAEKLFIRVSGPE-RDKILYKSMLARCYVRNKKPQSAWDMMLKTNNPSDRMSLLKVIAQDCYIANEFYYASKA 476          

HSP 2 Score: 57.3806 bits (137), Expect = 2.235e-8
Identity = 27/77 (35.06%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESK----DKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+F  +E  DP  E W GKRG+C GLF+  LAN ++      ++RE+V L+    +   E+++K++R WA+ + + +
Sbjct:  475 KAFHEIEISDPTTENWSGKRGACAGLFRQ-LANHKTDPILISQMREVVHLVAMKPHSNCEFLLKVVRNWAETHNVNI 550          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Fly
Match: Ttc26 (gene:FBgn0038358 transcript:FBtr0083170)

HSP 1 Score: 507.294 bits (1305), Expect = 9.410e-174
Identity = 257/504 (50.99%), Postives = 344/504 (68.25%), Query Frame = 2
Query:  113 MLLSRSKPANSLTTNLD------------SHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENA--------ELWIAYCAFHLGDYKKALEEYLNITKFNKFNPD--VWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDI--IEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            M+LSR K  ++ + N              + K      LEDF+I+RDYTG+   LE++ + +   E A        + WIA+C FHLGDY++AL +Y  I + +   PD  + + +  C F+LG+YEE+      A  + L+ RL FHL+HK  +E       + LQD   +E QLSLAS+HY+R HYQEAIDVYKR+L++N+E+ A+NVY+ALC+YKLDYYD+SQEVL +YL Q  DST+AINLKACN F+L+NG+ AE E+K + D    + TF  DL++HNL VFRNG+GAL+ LP L++ +PEARLNL IYYLK  D+ +A+ LMK++ PT+P EYILKGVV+AALGQ   S+E++K AQQ   LVG SA+ECDTIPGRQ MAS FFL  QF++VLVY+NSI+SYF NDD FN+N+AQAK A G YKEAEE+ + +    IK  + Y   LAKC I       AW +++  +T+ E+F LLQL+AN+ YK  EF+ AAKA
Sbjct:    1 MILSRGKTDSASSRNASGGPGSGLGVGRQARKTPAPASLEDFIIRRDYTGARAFLEFANDDEDEEEGAHGSKQSQVDQWIAFCNFHLGDYQQALAQYKAIQQGSS-TPDGKLDLNLAVCMFYLGLYEEAQQLMANAADNPLKQRLLFHLAHKLGNEEEWSQLQEELQDSSSLEQQLSLASMHYMRAHYQEAIDVYKRVLVDNKEYQAINVYLALCFYKLDYYDMSQEVLDVYLSQHGDSTIAINLKACNRFRLFNGRVAEQEIKNIAD----NGTFGADLLRHNLVVFRNGEGALRVLPGLLNIIPEARLNLAIYYLKQGDVQEAHALMKELQPTSPHEYILKGVVHAALGQQLGSKEHIKTAQQNLHLVGSSATECDTIPGRQSMASAFFLYEQFEEVLVYMNSIRSYFVNDDVFNYNFAQAKCATGYYKEAEELLMQISDMDIKNQHTYCMILAKCHIHCGHPELAWNVFITRDTNAEAFILLQLIANECYKCAEFWVAAKA 499          

HSP 2 Score: 68.1662 bits (165), Expect = 1.284e-11
Identity = 33/67 (49.25%), Postives = 47/67 (70.15%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIG-LFQLILANKESK--DKLREIVLLLRNSNNPQIEYIIKIIRK 1737
            K+FD+LE+LDP+PE WEGKRG+C G LF L    +  +    + E++ +LR+S+N Q E +IK IRK
Sbjct:  498 KAFDMLEKLDPSPENWEGKRGACAGVLFALCTKAQRGRPGGGISEVIGILRDSSNSQAEAMIKTIRK 564          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Zebrafish
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:494074])

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 341/486 (70.16%), Postives = 421/486 (86.63%), Query Frame = 2
Query:  113 MLLSRSKPANSLTTNLDSHKYKE------LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            MLLSR KPA     +  S++ K       +P+LED+L +RDY G++TLLE+ +N+  S E+A+LW  +CAFH+GD+K+A+EEY  +T       DVWVY+GC  FFLG+Y+E++ +A K  K++LQNRL FHL+HKFNDE++LM +HQNL+D+ EDQLSLASIHY+R+HYQEAID+YKRILL+NREFLALNVYVALCYYKLDYYDVSQEVL +YLQ  PDST+A+NLKACNHF+LYNGKAAE+ELK L DISS SF FAK+LI+HNL VFR G+GALQ LP LID + EARLNLVIYYL+ +DI +AY L+KD++PTTPQEYILKGVVNAALGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YLNS+KSYFYNDD+F+FNYAQAKAA+GNY+EAEE+F+L+Q+EKIK+DYV+ SWLA+C+IMN+K R AWELYL+METS++ FSLLQL+AND YKMG+FYYAAKA
Sbjct:    1 MLLSRMKPAVGGEASTSSNEKKRKNKSKKIPRLEDYLNQRDYLGALTLLEFQRNSGVSVEHADLWTGFCAFHVGDHKRAMEEYKALTLRPDCPVDVWVYLGCALFFLGLYKEAEEAALKGSKTQLQNRLLFHLAHKFNDEKKLMGFHQNLEDVTEDQLSLASIHYMRSHYQEAIDIYKRILLQNREFLALNVYVALCYYKLDYYDVSQEVLAVYLQSIPDSTIALNLKACNHFRLYNGKAAETELKNLIDISSSSFQFAKELIQHNLVVFRGGEGALQVLPPLIDVISEARLNLVIYYLRQDDIQEAYKLIKDLEPTTPQEYILKGVVNAALGQEIGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLNSVKSYFYNDDTFSFNYAQAKAALGNYREAEELFLLIQNEKIKSDYVFQSWLARCYIMNQKPRQAWELYLRMETSSDPFSLLQLIANDCYKMGQFYYAAKA 486          

HSP 2 Score: 115.931 bits (289), Expect = 9.002e-27
Identity = 47/73 (64.38%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FD LERLDPNPEYWEGKRG+C+G+FQLILA +ES++ L+E++ +LR++ NPQ+EYII+I++KWAK+N + L
Sbjct:  485 KAFDALERLDPNPEYWEGKRGACVGIFQLILAGRESREILKEVLPMLRSTGNPQVEYIIRIMKKWAKDNRVAL 557          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Xenopus
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:Xenbase;Acc:XB-GENE-1014888])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 352/483 (72.88%), Postives = 421/483 (87.16%), Query Frame = 2
Query:  113 MLLSRSKPA-NSLTTNLDSHKYKE--LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            M+LSR+KPA  +    +D  K K   +P+L++ L +RD+TG+ITLLE+ +    S E+ ELWI YC+FHLGDYK++LE +  +++    NPDVWV + C  FFLGMY+E+D +A KAPKSRLQNRL FHL+HKFNDE+RLM +HQNLQD+IEDQLSLASIHY+R+HYQEAID+YKRILLENR+FLALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK L D +S    FAK+LIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +A++L+KD++P+TPQEYILKGVVNA+LGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLLRQFDDVL+YLNSIKSYFYNDD+FNFNYAQAKAA+GNYKEAEE+F+L+Q+EKIK DY YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG FYYAAKA
Sbjct:    1 MMLSRAKPAVGNEVQQIDKKKKKGKKVPRLDELLAQRDFTGAITLLEFKRQVGESEEDTELWIGYCSFHLGDYKRSLEVFKALSQQEGCNPDVWVNLACTSFFLGMYKEADEAANKAPKSRLQNRLLFHLAHKFNDEKRLMVFHQNLQDVIEDQLSLASIHYMRSHYQEAIDIYKRILLENRDFLALNVYVALCYYKLDYYDVSQEVLAVYLQQVPDSTIALNLKACNHFRLYNGKAAEAELKGLMDSTSSPIEFAKELIKHNLVVFRAGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAFNLIKDLEPSTPQEYILKGVVNASLGQELGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLIYLNSIKSYFYNDDTFNFNYAQAKAAVGNYKEAEEVFLLIQNEKIKNDYTYLSWLARCYIMNKKPRMAWELYLKMETSGESFSLLQLIANDCYKMGHFYYAAKA 483          

HSP 2 Score: 110.153 bits (274), Expect = 9.991e-25
Identity = 45/71 (63.38%), Postives = 63/71 (88.73%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FD+LERLDP+PEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KW KEN +
Sbjct:  482 KAFDILERLDPSPEYWEGKRGACVGIFQMILAGREPKETLREVLNLLRSTGNTQVEYIIRILKKWGKENRV 552          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Xenopus
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:Xenbase;Acc:XB-GENE-1014888])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 342/482 (70.95%), Postives = 402/482 (83.40%), Query Frame = 2
Query:  116 LLSRSKPA-NSLTTNLDSHKYKE--LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            +LSR+KPA  +    +D  K K   +P+L++ L +RD+TG+ITLLE+ +    S E+ ELWI YC+FHLGDYK++LE +  +++    NPDVWV + C  FFLGMY+E+D +A KAPKSRLQNRL FHL+HKFNDE+RLM +HQNLQD+IEDQLSLASIHY+R+HYQEAID+YKRILLENR+FLALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK L D +S    FAK+LIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+                    EYILKGVVNA+LGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLLRQFDDVL+YLNSIKSYFYNDD+FNFNYAQAKAA+GNYKEAEE+F+L+Q+EKIK DY YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG FYYAAKA
Sbjct:    1 MLSRAKPAVGNEVQQIDKKKKKGKKVPRLDELLAQRDFTGAITLLEFKRQVGESEEDTELWIGYCSFHLGDYKRSLEVFKALSQQEGCNPDVWVNLACTSFFLGMYKEADEAANKAPKSRLQNRLLFHLAHKFNDEKRLMVFHQNLQDVIEDQLSLASIHYMRSHYQEAIDIYKRILLENRDFLALNVYVALCYYKLDYYDVSQEVLAVYLQQVPDSTIALNLKACNHFRLYNGKAAEAELKGLMDSTSSPIEFAKELIKHNLVVFRAGEGALQVLPPLVDVIPEARLNLVIYYLRQG------------KGCFVLEYILKGVVNASLGQELGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLIYLNSIKSYFYNDDTFNFNYAQAKAAVGNYKEAEEVFLLIQNEKIKNDYTYLSWLARCYIMNKKPRMAWELYLKMETSGESFSLLQLIANDCYKMGHFYYAAKA 470          

HSP 2 Score: 110.153 bits (274), Expect = 1.023e-24
Identity = 45/71 (63.38%), Postives = 63/71 (88.73%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FD+LERLDP+PEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KW KEN +
Sbjct:  469 KAFDILERLDPSPEYWEGKRGACVGIFQMILAGREPKETLREVLNLLRSTGNTQVEYIIRILKKWGKENRV 539          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Xenopus
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:Xenbase;Acc:XB-GENE-1014888])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 326/483 (67.49%), Postives = 393/483 (81.37%), Query Frame = 2
Query:  113 MLLSRSKPA-NSLTTNLDSHKYKE--LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            M+LSR+KPA  +    +D  K K   +P+L++ L +RD+TG+ITLLE+ +    S E+ ELWI YC+FHLGDYK++LE +  +++    NPDVWV + C  FFLGMY+E+D +A KAPKSRLQNRL FHL+HKFNDE+RLM +HQNLQD+IEDQLSLASIHY+R+HYQEAID+YKRILLENR+FLALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK L D +S    FAK+LIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +A++L+KD++P+TPQEYILKGVVNA+LGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLLRQFDDVL+YLNSIK                            +F+L+Q+EKIK DY YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG FYYAAKA
Sbjct:    1 MMLSRAKPAVGNEVQQIDKKKKKGKKVPRLDELLAQRDFTGAITLLEFKRQVGESEEDTELWIGYCSFHLGDYKRSLEVFKALSQQEGCNPDVWVNLACTSFFLGMYKEADEAANKAPKSRLQNRLLFHLAHKFNDEKRLMVFHQNLQDVIEDQLSLASIHYMRSHYQEAIDIYKRILLENRDFLALNVYVALCYYKLDYYDVSQEVLAVYLQQVPDSTIALNLKACNHFRLYNGKAAEAELKGLMDSTSSPIEFAKELIKHNLVVFRAGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAFNLIKDLEPSTPQEYILKGVVNASLGQELGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLIYLNSIK----------------------------VFLLIQNEKIKNDYTYLSWLARCYIMNKKPRMAWELYLKMETSGESFSLLQLIANDCYKMGHFYYAAKA 455          

HSP 2 Score: 110.153 bits (274), Expect = 9.296e-25
Identity = 45/71 (63.38%), Postives = 63/71 (88.73%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FD+LERLDP+PEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KW KEN +
Sbjct:  454 KAFDILERLDPSPEYWEGKRGACVGIFQMILAGREPKETLREVLNLLRSTGNTQVEYIIRILKKWGKENRV 524          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Xenopus
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:Xenbase;Acc:XB-GENE-1014888])

HSP 1 Score: 411.379 bits (1056), Expect = 2.370e-140
Identity = 210/332 (63.25%), Postives = 252/332 (75.90%), Query Frame = 2
Query:  623 YKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAE----------------------SELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            +KR + E+ E   L  ++  C + L  Y  S E L    Q+  +  V +NL AC  F L   K A+                      +ELK L D +S    FAK+LIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +A++L+KD++P+TPQEYILKGVVNA+LGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLLRQFDDVL+YLNSIKSYFYNDD+FNFNYAQAKAA+GNYKEAEE+F+L+Q+EKIK DY YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG FYYAAKA
Sbjct:   47 FKRQVGESEEDTEL--WIGYCSFHLGDYKRSLEALS--QQEGCNPDVWVNL-ACTSFFLGMYKEADEAANKAPKSRLQNRLLFHLAHKAELKGLMDSTSSPIEFAKELIKHNLVVFRAGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAFNLIKDLEPSTPQEYILKGVVNASLGQELGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLIYLNSIKSYFYNDDTFNFNYAQAKAAVGNYKEAEEVFLLIQNEKIKNDYTYLSWLARCYIMNKKPRMAWELYLKMETSGESFSLLQLIANDCYKMGHFYYAAKA 373          

HSP 2 Score: 109.768 bits (273), Expect = 2.370e-140
Identity = 45/71 (63.38%), Postives = 63/71 (88.73%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FD+LERLDP+PEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KW KEN +
Sbjct:  372 KAFDILERLDPSPEYWEGKRGACVGIFQMILAGREPKETLREVLNLLRSTGNTQVEYIIRILKKWGKENRV 442          

HSP 3 Score: 143.665 bits (361), Expect = 1.641e-36
Identity = 70/132 (53.03%), Postives = 95/132 (71.97%), Query Frame = 2
Query:  116 LLSRSKPA-NSLTTNLDSHKYKE--LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHK 502
            +LSR+KPA  +    +D  K K   +P+L++ L +RD+TG+ITLLE+ +    S E+ ELWI YC+FHLGDYK++LE    +++    NPDVWV + C  FFLGMY+E+D +A KAPKSRLQNRL FHL+HK
Sbjct:    1 MLSRAKPAVGNEVQQIDKKKKKGKKVPRLDELLAQRDFTGAITLLEFKRQVGESEEDTELWIGYCSFHLGDYKRSLEA---LSQQEGCNPDVWVNLACTSFFLGMYKEADEAANKAPKSRLQNRLLFHLAHK 129          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Mouse
Match: Ttc26 (tetratricopeptide repeat domain 26 [Source:MGI Symbol;Acc:MGI:2444853])

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 349/484 (72.11%), Postives = 418/484 (86.36%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR+KPA    S  T+    K +++PKLED L +RD+TG+ITLLE+ ++     ++  LWI YCAFHLGDYK+ALEEY N TK    NP+VWV + C  FFLGMY++++ +  KAPKSRLQNRL FHL+HKFNDE++LM +HQNLQDI EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK+L D +S  F FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE+F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:    1 MMLSRAKPAVGGESPHTDKRKKKGRKIPKLEDLLSQRDFTGAITLLEFKRHVGEQEDDTNLWIGYCAFHLGDYKRALEEYENATKEENCNPEVWVNLACTYFFLGMYKQAEAAGFKAPKSRLQNRLLFHLAHKFNDEKKLMNFHQNLQDIKEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGKAAEAELKSLMDNASSPFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEVFLLIQSEKLKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 484          

HSP 2 Score: 115.161 bits (287), Expect = 1.845e-26
Identity = 48/73 (65.75%), Postives = 65/73 (89.04%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KWAKEN + +
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGIFQMILAGREPKETLREVLHLLRSTGNTQVEYIIRIMKKWAKENRVPI 554          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Mouse
Match: Ttc26 (tetratricopeptide repeat domain 26 [Source:MGI Symbol;Acc:MGI:2444853])

HSP 1 Score: 286.96 bits (733), Expect = 4.884e-93
Identity = 140/222 (63.06%), Postives = 171/222 (77.03%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAI 769
            M+LSR+KPA    S  T+    K +++PKLED L +RD+TG+ITLLE+ ++     ++  LWI YCAFHLGDYK+ALEEY N TK    NP+VWV + C  FFLGMY++++ +  KAPKSRLQNRL FHL+HK            NLQDI EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+
Sbjct:    1 MMLSRAKPAVGGESPHTDKRKKKGRKIPKLEDLLSQRDFTGAITLLEFKRHVGEQEDDTNLWIGYCAFHLGDYKRALEEYENATKEENCNPEVWVNLACTYFFLGMYKQAEAAGFKAPKSRLQNRLLFHLAHK------------NLQDIKEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIAL 210          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Mouse
Match: Ttc26 (tetratricopeptide repeat domain 26 [Source:MGI Symbol;Acc:MGI:2444853])

HSP 1 Score: 130.183 bits (326), Expect = 4.089e-34
Identity = 61/123 (49.59%), Postives = 84/123 (68.29%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQ 472
            M+LSR+KPA    S  T+    K +++PKLED L +RD+TG+ITLLE+ ++     ++  LWI YCAFHLGDYK+ALEEY N TK    NP+VWV + C  FFLGMY++++ +  K  K+  Q
Sbjct:    1 MMLSRAKPAVGGESPHTDKRKKKGRKIPKLEDLLSQRDFTGAITLLEFKRHVGEQEDDTNLWIGYCAFHLGDYKRALEEYENATKEENCNPEVWVNLACTYFFLGMYKQAEAAGFKGGKNSYQ 123          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Mouse
Match: Ttc26 (tetratricopeptide repeat domain 26 [Source:MGI Symbol;Acc:MGI:2444853])

HSP 1 Score: 88.5817 bits (218), Expect = 8.522e-21
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALE 337
            M+LSR+KPA    S  T+    K +++PKLED L +RD+TG+ITLLE+ ++     ++  LWI YCAFHLGDYK+ALE
Sbjct:    1 MMLSRAKPAVGGESPHTDKRKKKGRKIPKLEDLLSQRDFTGAITLLEFKRHVGEQEDDTNLWIGYCAFHLGDYKRALE 78          
BLAST of Intraflagellar transport protein 56 vs. UniProt/SwissProt
Match: sp|A4III8|IFT56_XENTR (Intraflagellar transport protein 56 OS=Xenopus tropicalis OX=8364 GN=ttc26 PE=2 SV=1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 352/483 (72.88%), Postives = 421/483 (87.16%), Query Frame = 2
Query:  113 MLLSRSKPA-NSLTTNLDSHKYKE--LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            M+LSR+KPA  +    +D  K K   +P+L++ L +RD+TG+ITLLE+ +    S E+ ELWI YC+FHLGDYK++LE +  +++    NPDVWV + C  FFLGMY+E+D +A KAPKSRLQNRL FHL+HKFNDE+RLM +HQNLQD+IEDQLSLASIHY+R+HYQEAID+YKRILLENR+FLALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK L D +S    FAK+LIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +A++L+KD++P+TPQEYILKGVVNA+LGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLLRQFDDVL+YLNSIKSYFYNDD+FNFNYAQAKAA+GNYKEAEE+F+L+Q+EKIK DY YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG FYYAAKA
Sbjct:    1 MMLSRAKPAVGNEVQQIDKKKKKGKKVPRLDELLAQRDFTGAITLLEFKRQVGESEEDTELWIGYCSFHLGDYKRSLEVFKALSQQEGCNPDVWVNLACTSFFLGMYKEADEAANKAPKSRLQNRLLFHLAHKFNDEKRLMVFHQNLQDVIEDQLSLASIHYMRSHYQEAIDIYKRILLENRDFLALNVYVALCYYKLDYYDVSQEVLAVYLQQVPDSTIALNLKACNHFRLYNGKAAEAELKGLMDSTSSPIEFAKELIKHNLVVFRAGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAFNLIKDLEPSTPQEYILKGVVNASLGQELGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLIYLNSIKSYFYNDDTFNFNYAQAKAAVGNYKEAEEVFLLIQNEKIKNDYTYLSWLARCYIMNKKPRMAWELYLKMETSGESFSLLQLIANDCYKMGHFYYAAKA 483          

HSP 2 Score: 110.153 bits (274), Expect = 5.293e-24
Identity = 45/71 (63.38%), Postives = 63/71 (88.73%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FD+LERLDP+PEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KW KEN +
Sbjct:  482 KAFDILERLDPSPEYWEGKRGACVGIFQMILAGREPKETLREVLNLLRSTGNTQVEYIIRILKKWGKENRV 552          
BLAST of Intraflagellar transport protein 56 vs. UniProt/SwissProt
Match: sp|Q8BS45|IFT56_MOUSE (Intraflagellar transport protein 56 OS=Mus musculus OX=10090 GN=Ttc26 PE=1 SV=1)

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 349/484 (72.11%), Postives = 418/484 (86.36%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR+KPA    S  T+    K +++PKLED L +RD+TG+ITLLE+ ++     ++  LWI YCAFHLGDYK+ALEEY N TK    NP+VWV + C  FFLGMY++++ +  KAPKSRLQNRL FHL+HKFNDE++LM +HQNLQDI EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK+L D +S  F FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE+F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:    1 MMLSRAKPAVGGESPHTDKRKKKGRKIPKLEDLLSQRDFTGAITLLEFKRHVGEQEDDTNLWIGYCAFHLGDYKRALEEYENATKEENCNPEVWVNLACTYFFLGMYKQAEAAGFKAPKSRLQNRLLFHLAHKFNDEKKLMNFHQNLQDIKEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGKAAEAELKSLMDNASSPFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEVFLLIQSEKLKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 484          

HSP 2 Score: 115.161 bits (287), Expect = 1.291e-25
Identity = 48/73 (65.75%), Postives = 65/73 (89.04%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KWAKEN + +
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGIFQMILAGREPKETLREVLHLLRSTGNTQVEYIIRIMKKWAKENRVPI 554          
BLAST of Intraflagellar transport protein 56 vs. UniProt/SwissProt
Match: sp|Q5U2N8|IFT56_RAT (Intraflagellar transport protein 56 OS=Rattus norvegicus OX=10116 GN=Ttc26 PE=2 SV=1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 349/484 (72.11%), Postives = 417/484 (86.16%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR+KPA    S  T+    K +++PKLED L +RD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N  K    NP+VWV + C  FFLGMY++++ +  KAPKSRLQNRL FHL+HKFNDE++LM +HQNLQDI EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNGKAAE+ELK+L D +S  F FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE+F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:    1 MMLSRAKPAVGGESPHTDKRKKKGRKIPKLEDLLSQRDFTGAITLLEFKRHVGEQEEDTNLWIGYCAFHLGDYKRALEEYENAAKEENCNPEVWVNLACTYFFLGMYKQAEAAGFKAPKSRLQNRLLFHLAHKFNDEKKLMNFHQNLQDIKEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGKAAEAELKSLMDNASSPFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEVFLLIQSEKLKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 484          

HSP 2 Score: 115.161 bits (287), Expect = 1.245e-25
Identity = 48/73 (65.75%), Postives = 65/73 (89.04%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+ILA +E K+ LRE++ LLR++ N Q+EYII+I++KWAKEN + +
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGIFQMILAGREPKETLREVLHLLRSTGNTQVEYIIRIMKKWAKENRVPI 554          
BLAST of Intraflagellar transport protein 56 vs. UniProt/SwissProt
Match: sp|A0AVF1|IFT56_HUMAN (Intraflagellar transport protein 56 OS=Homo sapiens OX=9606 GN=TTC26 PE=2 SV=1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 346/484 (71.49%), Postives = 416/484 (85.95%), Query Frame = 2
Query:  113 MLLSRSKPANSLT---TNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HKFNDE++LM++HQNLQD+ EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNG+AAE+ELK+L D +S SF FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:    1 MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 484          

HSP 2 Score: 114.775 bits (286), Expect = 1.519e-25
Identity = 46/73 (63.01%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A +E K+ LRE++ LLR++ N Q+EY+I+I++KWAKEN +++
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRVSI 554          
BLAST of Intraflagellar transport protein 56 vs. UniProt/SwissProt
Match: sp|Q4R7Z9|IFT56_MACFA (Intraflagellar transport protein 56 OS=Macaca fascicularis OX=9541 GN=TTC26 PE=2 SV=1)

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 346/484 (71.49%), Postives = 416/484 (85.95%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR+KPA       T+    K +++PKLE+ L KRD+TG+ITLLE+ ++     E+  LWI YCAFHLGDYK+ALEEY N TK    N +VWV + C  FFLGMY++++ +  KA KSRLQNRL FHL+HKFNDE++LM++HQNLQD+ EDQLSLASIHY+R+HYQEAID+YKRILL+NRE+LALNVYVALCYYKLDYYDVSQEVL +YLQQ PDST+A+NLKACNHF+LYNG+AAE+ELK+L D +S SF FAK+LI+HNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR+++K+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QFDDVL+YLNS KSYFYNDD FNFNYAQAKAA GN  E EE F+L+QSEK+K DY+YLSWLA+C+IMNKK R AWELYLKMETS ESFSLLQL+AND YKMG+FYY+AKA 
Sbjct:    1 MMLSRAKPAVGRGVQPTDKKKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAF 484          

HSP 2 Score: 113.62 bits (283), Expect = 4.214e-25
Identity = 46/71 (64.79%), Postives = 64/71 (90.14%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A +E K+ LRE++ LLR++ N Q+EY+I+I++KWAKEN +
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGIFQMIVAGREPKETLREVLHLLRSTGNTQVEYMIRIMKKWAKENRV 552          
BLAST of Intraflagellar transport protein 56 vs. TrEMBL
Match: A0A3M6TES6 (TPR_REGION domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00018504 PE=4 SV=1)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 370/487 (75.98%), Postives = 428/487 (87.89%), Query Frame = 2
Query:  113 MLLSRSKPA------NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR KPA      N++++  +S K ++LPKLEDFL  RDYTG+ITL E+++N+    E   LWIAY AFHLGDYKKA+EEYL +TK    +PDVWV + CC FFLGMY+E D  A K PKSRLQNRL FHLSHKFNDE+RLMT+HQ LQDIIEDQLSLASIHYLR+HYQEAID+YKRILL+NR++LALNVYVALCYYKLDYYDVSQEVL +YLQ +PDS +A+NLKACNHF+LYNGKAAE ELKTL + +SPSF+FA DLIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+++AY+L+KD++PTTPQEYILKGVVNAALGQ+Q SRE+LK+AQQYFQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YLNSIKSYFYNDD+FNFNY QAKAA+GNYKEAEEIF+LVQSEKIK DY YLSWLA+C+IMN KAR AWELYLKMETS ESFSLLQL+AND YKMG+FYYAAKA 
Sbjct:    1 MMLSRKKPAVGPGSGNTVSSAKESKKKRKLPKLEDFLQMRDYTGAITLAEFNRNSGKGSEETNLWIAYTAFHLGDYKKAMEEYLALTKSEACHPDVWVNLACCYFFLGMYKEGDEMALKGPKSRLQNRLLFHLSHKFNDEKRLMTHHQALQDIIEDQLSLASIHYLRSHYQEAIDIYKRILLDNRDYLALNVYVALCYYKLDYYDVSQEVLAVYLQHYPDSAIAVNLKACNHFRLYNGKAAEGELKTLQETASPSFSFANDLIKHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVVEAYNLIKDLEPTTPQEYILKGVVNAALGQEQGSREHLKIAQQYFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLNSIKSYFYNDDTFNFNYGQAKAAVGNYKEAEEIFLLVQSEKIKNDYTYLSWLARCYIMNHKARPAWELYLKMETSGESFSLLQLIANDCYKMGQFYYAAKAF 487          

HSP 2 Score: 112.849 bits (281), Expect = 2.340e-22
Identity = 47/71 (66.20%), Postives = 62/71 (87.32%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ I+A  E ++ LR+I+ +LRN+ NPQ+EYII+ ++KWAKEN I
Sbjct:  485 KAFDVLERLDPNPEYWEGKRGACVGIFQQIIAGHEPRETLRDILQILRNTGNPQVEYIIRTMKKWAKENRI 555          
BLAST of Intraflagellar transport protein 56 vs. TrEMBL
Match: A0A2B4RLZ5 (Tetratricopeptide repeat protein 26 OS=Stylophora pistillata OX=50429 GN=Ttc26 PE=4 SV=1)

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 369/487 (75.77%), Postives = 428/487 (87.89%), Query Frame = 2
Query:  113 MLLSRSKPA------NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR KPA      N++++  DS K ++LPKLEDFL  RDYTG+ITL E+++N+    E   LWIAY AFHLGDYKKA+EEYL +TK    +PDVWV + CC FFLGMY+E D  A K PKSRLQNRL FHLSHKFNDE+RLMT+HQ LQDIIEDQLSLASIHYLR+HYQEAID+YKRILL+NR++LALNVYVALCYYKLDYYDVSQEVL +YLQ +PDS  A+NLKACNHF+LYNGKAAE ELKTL + +SPSF+FA DLIKHNL VFR G+GALQ LP L+D +PEARLNLVIYYL+ +D+++AY+L+KD++PTTPQEYILKGVVNAALGQ+Q SRE+LK+AQQYFQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YLNSIKSYFYNDD+FNFNYAQAKAA+GN+KEAEEIF+L+QSEKIK DY YLSWLA+C+IMN KAR AWELYLKMETS ESFSLLQL+AN+ YKMG+FYYAAKA 
Sbjct:    1 MMLSRKKPAVGPGSGNTVSSAKDSKKKRKLPKLEDFLQMRDYTGAITLAEFNRNSGKGSEETNLWIAYTAFHLGDYKKAMEEYLALTKSEACHPDVWVNLACCYFFLGMYKEGDEMALKGPKSRLQNRLLFHLSHKFNDEKRLMTHHQALQDIIEDQLSLASIHYLRSHYQEAIDIYKRILLDNRDYLALNVYVALCYYKLDYYDVSQEVLAVYLQHYPDSATAVNLKACNHFRLYNGKAAEGELKTLQETASPSFSFAIDLIKHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVVEAYNLIKDLEPTTPQEYILKGVVNAALGQEQGSREHLKIAQQYFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLNSIKSYFYNDDTFNFNYAQAKAAVGNFKEAEEIFLLIQSEKIKNDYTYLSWLARCYIMNHKARPAWELYLKMETSGESFSLLQLIANECYKMGQFYYAAKAF 487          

HSP 2 Score: 112.849 bits (281), Expect = 2.026e-22
Identity = 46/69 (66.67%), Postives = 61/69 (88.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKEN 1752
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ I+A  E K+ LR+++ +LRN+ NPQ+EYII+ ++KWAKEN
Sbjct:  485 KAFDVLERLDPNPEYWEGKRGACVGIFQQIIAGHEPKETLRDVLQILRNTGNPQVEYIIRTMKKWAKEN 553          
BLAST of Intraflagellar transport protein 56 vs. TrEMBL
Match: K1QQF9 (Tetratricopeptide repeat protein 26 OS=Crassostrea gigas OX=29159 GN=CGI_10018228 PE=4 SV=1)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 360/500 (72.00%), Postives = 429/500 (85.80%), Query Frame = 2
Query:  116 LLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAE------------SELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIK-----SYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            +LSR+KPA    S T   ++ K K++PK+EDFL  RDYTG+ITLLE+++N+    +  +LWIAYCAFHLGDYK+++EE+  +T+ +  +PDVW  + CC FFLGMY E+D +  K PKS+LQNRL FHLSHKF DE+RLM +HQ+LQD+IEDQLSLASIHYLR+HYQEAID+YKRILL+NR+FLALNVYVALCYYKLDYYDVSQEVL +YLQQ+PDS +A+NLKACNHF+LYNGKAAE            SELK+L ++SSPSF FA+DLIKHNL VFR G+GALQ LP LID LPEARLNLVIYYLK +DI +AY+L+KD++PTTPQEYILKGVVNAALGQ+Q SRE+LK+AQQYFQLVGGSASECDTIPGRQCM+SCFFLL+QF+DVL+YLNSIK     SYFYNDDSFNFNYAQAKAA+GN+KE+EE+F+L+QSEKIK DY YLSWLA+ +IMN+K+R AWELYLKMETS ESFSLLQL+AND YKMG+FYYAAKA 
Sbjct: 2100 MLSRAKPAIGPGSTTPAKENKKKKQVPKVEDFLNMRDYTGAITLLEFNRNSGKGNDETDLWIAYCAFHLGDYKRSMEEFERMTRRDGCHPDVWTNLACCYFFLGMYPEADTACAKGPKSKLQNRLLFHLSHKFGDEKRLMGHHQSLQDVIEDQLSLASIHYLRSHYQEAIDIYKRILLDNRDFLALNVYVALCYYKLDYYDVSQEVLAVYLQQYPDSAIALNLKACNHFRLYNGKAAEVNKKEKQKNGTISELKSLQEMSSPSFVFARDLIKHNLVVFRGGEGALQVLPPLIDVLPEARLNLVIYYLKQDDIAEAYNLIKDLEPTTPQEYILKGVVNAALGQEQGSREHLKIAQQYFQLVGGSASECDTIPGRQCMSSCFFLLKQFEDVLIYLNSIKASINISYFYNDDSFNFNYAQAKAAVGNFKESEEVFLLIQSEKIKNDYTYLSWLARVYIMNRKSRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYAAKAF 2599          

HSP 2 Score: 118.242 bits (295), Expect = 1.545e-23
Identity = 47/73 (64.38%), Postives = 65/73 (89.04%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A  E +D LR+++ +LRN++NPQ+EYII+ ++KWAKEN + L
Sbjct: 2597 KAFDVLERLDPNPEYWEGKRGACVGVFQMIIAGHEPRDTLRDVINMLRNTSNPQVEYIIRSMKKWAKENLVPL 2669          
BLAST of Intraflagellar transport protein 56 vs. TrEMBL
Match: A0A2G8KFI4 (Putative intraflagellar transport protein OS=Stichopus japonicus OX=307972 GN=BSL78_16361 PE=4 SV=1)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 357/484 (73.76%), Postives = 425/484 (87.81%), Query Frame = 2
Query:  113 MLLSRSKPA---NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            M+LSR KPA    S T   ++ K K++PKLEDFL  RDYTG+I L E+++N+    E  ++W+AYCAFHLGD+K+A+EEY  +TK + FNP+VW+ + CC FFLGMY+E+D SA+KAPK+ LQNRL FHLS KFNDE+RLM+YHQNLQD+I DQLSLASIHYLR+HYQEAID+YKRILL+NR++LALNVYVALCYYKLDYYDVSQEVL +YLQ FPDS +A+NLKACNHF+LYNGKAAE+ELK L D++SPSFTFA+DLIKHNL VF+ G+GALQ LP LID +PEARLNLVIYYLK +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+Q SRE+LK+AQQYFQLVGGSASECDTIPGRQCMASCFF+L+QF+DVL+YLNSIKSYFYNDDSFNFNYAQAKA  GN+KEAEEI +L+Q EK+K DY YLS +A+C IMN+K R AWE+YLKMETS ESFSLLQL+AND YKMG+FYYAAKA 
Sbjct:    1 MMLSRQKPATGPGSSTPAQEAKKKKQMPKLEDFLDSRDYTGAIVLSEFTRNSGKGSEETDMWVAYCAFHLGDHKQAMEEYEKMTKRDNFNPEVWLNLACCYFFLGMYKEADESARKAPKTDLQNRLLFHLSQKFNDEKRLMSYHQNLQDMIPDQLSLASIHYLRSHYQEAIDIYKRILLDNRDYLALNVYVALCYYKLDYYDVSQEVLAVYLQHFPDSAIALNLKACNHFRLYNGKAAEAELKNLQDLASPSFTFAQDLIKHNLVVFKGGEGALQVLPPLIDVIPEARLNLVIYYLKQDDVNEAYNLIKDLEPTTPQEYILKGVVNAALGQEQGSREHLKIAQQYFQLVGGSASECDTIPGRQCMASCFFILKQFEDVLIYLNSIKSYFYNDDSFNFNYAQAKATAGNFKEAEEILLLIQREKLKVDYTYLSLMARCLIMNRKPRLAWEVYLKMETSGESFSLLQLIANDCYKMGQFYYAAKAF 484          

HSP 2 Score: 112.079 bits (279), Expect = 3.533e-22
Identity = 45/69 (65.22%), Postives = 62/69 (89.86%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKEN 1752
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ I+A  E ++ LR+I+ +LRN+ NPQ+EYII++++KWAK+N
Sbjct:  482 KAFDVLERLDPNPEYWEGKRGACVGVFQQIIAGHEPRETLRDILQILRNTGNPQVEYIIRVMKKWAKDN 550          
BLAST of Intraflagellar transport protein 56 vs. TrEMBL
Match: A0A2T7PXV1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00865 PE=4 SV=1)

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 360/482 (74.69%), Postives = 423/482 (87.76%), Query Frame = 2
Query:  116 LLSRSKPANSLTTNL---DSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            +LSR+KPA  L       D  K K LPK+EDFL  RDYTG+ITLLE+S+ +     + ++WIAYCAFHLGD+K+A+EEY  + K +  NP++ +Y+ CC FFLGMY E+D S +KAPK RLQNRL FHLSHKF DERRLM YHQ+LQD+IEDQL+LASIHYLR+HYQEAID+YKRILL+NR++LALNVYVALCYYKLDYYDVSQEVL IYLQ FPDS +A+NLKACNHF+LYNGKAAE+ELK L ++SS SF +A+DLI+HNL VFRNG+GALQ LP LID LPEARLNLVIYYLK +DI +AY+L+KD++PTTPQEYILKGVVNAALGQ+Q SRE+LK+AQQYFQLVGGSASECDTIPGRQCM SCFFLL+QF+DVL+YLNSIKSYFYNDD FNFNYAQAKAA+GN+KEAEE+F+L+QS+K+K+DY YLSWLA+C+IMN+KAR AWELYLKMETS ESFSLLQL+AND YKMG FYYAAKA
Sbjct:    1 MLSRTKPAIGLGAGQQAKDPKKKKSLPKVEDFLDARDYTGAITLLEFSRASGKGNTDTDMWIAYCAFHLGDHKRAMEEYERLCKKDGSNPELCLYLACCYFFLGMYPEADESCQKAPKGRLQNRLLFHLSHKFGDERRLMGYHQHLQDVIEDQLTLASIHYLRSHYQEAIDIYKRILLDNRDYLALNVYVALCYYKLDYYDVSQEVLAIYLQHFPDSAIALNLKACNHFRLYNGKAAEAELKALQEMSSQSFQYAQDLIRHNLCVFRNGEGALQVLPPLIDVLPEARLNLVIYYLKQDDITEAYNLIKDLEPTTPQEYILKGVVNAALGQEQGSREHLKIAQQYFQLVGGSASECDTIPGRQCMGSCFFLLKQFEDVLIYLNSIKSYFYNDDLFNFNYAQAKAAVGNFKEAEEVFLLIQSDKLKSDYTYLSWLARCYIMNRKARLAWELYLKMETSGESFSLLQLIANDCYKMGHFYYAAKA 482          

HSP 2 Score: 112.079 bits (279), Expect = 3.587e-22
Identity = 44/69 (63.77%), Postives = 63/69 (91.30%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKEN 1752
            K+FDVLERLDPNPEYWEGKRG+C+G+FQLI+A  E ++ LR+++ +LRN+++PQ+EYII+ ++KWAK+N
Sbjct:  481 KAFDVLERLDPNPEYWEGKRGACVGVFQLIIAGHEQRETLRDVINMLRNTSSPQVEYIIRTMKKWAKDN 549          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Cavefish
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:103023963])

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 344/486 (70.78%), Postives = 418/486 (86.01%), Query Frame = 2
Query:  113 MLLSRSKPANSLTTNLDSHKYKE------LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            MLLSR KPA     +++S + K       +P+LED++ +RDY G +TLLE+ +N     ENA+LWI YCAFHLGD+K+A+EEY  +T       +VWV++GC  FFLG+YEE++  A K PKS+LQNRL FHL+HKF DE++LM +HQNL+D+ EDQLSLASIHY+R+HYQEAID+YKRILL+NREFLALNVYVALCYYKLDYYDVSQEVL +YLQ FPDST+A+NLKACNHF+LYNGKAAE ELK L DISS SF FAK+LI+HNL VFR G+GALQ LP LID + EARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YL S+KSYF  DD++NFNYAQAKAA+G+YKEAEE+F+L+QSEKIK DYVYLSWLA+C+IMN+KAR AWELYL METS++SFSLLQL+AND YKMG+FY+AAKA
Sbjct:    1 MLLSRVKPAVGGDGSVNSSEKKRKNKSKKIPRLEDYMSQRDYLGGLTLLEFHRNGGVPEENADLWIGYCAFHLGDHKRAMEEYKALTLKPDCPAEVWVFLGCALFFLGLYEEAEEMALKGPKSQLQNRLLFHLAHKFEDEKKLMGFHQNLEDVTEDQLSLASIHYMRSHYQEAIDIYKRILLQNREFLALNVYVALCYYKLDYYDVSQEVLAVYLQNFPDSTIALNLKACNHFRLYNGKAAEVELKNLIDISSSSFEFAKELIRHNLVVFRGGEGALQVLPPLIDVISEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEIGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLGSVKSYFCTDDTYNFNYAQAKAALGSYKEAEEVFLLIQSEKIKNDYVYLSWLARCYIMNQKARLAWELYLTMETSSDSFSLLQLIANDCYKMGQFYFAAKA 486          

HSP 2 Score: 117.472 bits (293), Expect = 2.692e-27
Identity = 48/73 (65.75%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQLILA +E +D L+E++ +LR++ NPQ+EYII+I++KWAK+N + L
Sbjct:  485 KAFDVLERLDPNPEYWEGKRGACVGIFQLILAGREPRDSLKEVLPMLRSTGNPQVEYIIRIMKKWAKDNRVGL 557          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Cavefish
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:103023963])

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 330/448 (73.66%), Postives = 396/448 (88.39%), Query Frame = 2
Query:  209 KRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            +RDY G +TLLE+ +N     ENA+LWI YCAFHLGD+K+A+EEY  +T       +VWV++GC  FFLG+YEE++  A K PKS+LQNRL FHL+HKF DE++LM +HQNL+D+ EDQLSLASIHY+R+HYQEAID+YKRILL+NREFLALNVYVALCYYKLDYYDVSQEVL +YLQ FPDST+A+NLKACNHF+LYNGKAAE ELK L DISS SF FAK+LI+HNL VFR G+GALQ LP LID + EARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YL S+KSYF  DD++NFNYAQAKAA+G+YKEAEE+F+L+QSEKIK DYVYLSWLA+C+IMN+KAR AWELYL METS++SFSLLQL+AND YKMG+FY+AAKA
Sbjct:    3 QRDYLGGLTLLEFHRNGGVPEENADLWIGYCAFHLGDHKRAMEEYKALTLKPDCPAEVWVFLGCALFFLGLYEEAEEMALKGPKSQLQNRLLFHLAHKFEDEKKLMGFHQNLEDVTEDQLSLASIHYMRSHYQEAIDIYKRILLQNREFLALNVYVALCYYKLDYYDVSQEVLAVYLQNFPDSTIALNLKACNHFRLYNGKAAEVELKNLIDISSSSFEFAKELIRHNLVVFRGGEGALQVLPPLIDVISEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEIGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLGSVKSYFCTDDTYNFNYAQAKAALGSYKEAEEVFLLIQSEKIKNDYVYLSWLARCYIMNQKARLAWELYLTMETSSDSFSLLQLIANDCYKMGQFYFAAKA 450          

HSP 2 Score: 117.472 bits (293), Expect = 1.807e-27
Identity = 48/73 (65.75%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQLILA +E +D L+E++ +LR++ NPQ+EYII+I++KWAK+N + L
Sbjct:  449 KAFDVLERLDPNPEYWEGKRGACVGIFQLILAGREPRDSLKEVLPMLRSTGNPQVEYIIRIMKKWAKDNRVGL 521          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Cavefish
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:103023963])

HSP 1 Score: 400.593 bits (1028), Expect = 1.436e-139
Identity = 187/247 (75.71%), Postives = 224/247 (90.69%), Query Frame = 2
Query:  812 AAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            A + ELK L DISS SF FAK+LI+HNL VFR G+GALQ LP LID + EARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQ+  SR++LK+AQQ+FQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YL S+KSYF  DD++NFNYAQAKAA+G+YKEAEE+F+L+QSEKIK DYVYLSWLA+C+IMN+KAR AWELYL METS++SFSLLQL+AND YKMG+FY+AAKA
Sbjct:  116 AHKVELKNLIDISSSSFEFAKELIRHNLVVFRGGEGALQVLPPLIDVISEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEIGSRDHLKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLGSVKSYFCTDDTYNFNYAQAKAALGSYKEAEEVFLLIQSEKIKNDYVYLSWLARCYIMNQKARLAWELYLTMETSSDSFSLLQLIANDCYKMGQFYFAAKA 362          

HSP 2 Score: 117.087 bits (292), Expect = 1.436e-139
Identity = 48/73 (65.75%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRG+C+G+FQLILA +E +D L+E++ +LR++ NPQ+EYII+I++KWAK+N + L
Sbjct:  361 KAFDVLERLDPNPEYWEGKRGACVGIFQLILAGREPRDSLKEVLPMLRSTGNPQVEYIIRIMKKWAKDNRVGL 433          

HSP 3 Score: 139.428 bits (350), Expect = 2.552e-35
Identity = 60/107 (56.07%), Postives = 81/107 (75.70%), Query Frame = 2
Query:  182 LPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHK 502
            +P+LED++ +RDY G +TLLE+ +N     ENA+LWI YCAFHLGD+K+A+EEY  +T       +VWV++GC  FFLG+YEE++  A K PKS+LQNRL FHL+HK
Sbjct:   12 IPRLEDYMSQRDYLGGLTLLEFHRNGGVPEENADLWIGYCAFHLGDHKRAMEEYKALTLKPDCPAEVWVFLGCALFFLGLYEEAEEMALKGPKSQLQNRLLFHLAHK 118          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Sea Lamprey
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:494074])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 359/483 (74.33%), Postives = 417/483 (86.34%), Query Frame = 2
Query:  116 LLSRSKPANSLTTNL---DSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            +LSR+KPA             K K +PKLED L  RDYTG+IT LE+ ++A    E  +LW+AYCAFHLGDYK+A+EEY  +TK +  NPDVWV + C  FFLGMY E+D +A KAPKSRLQNRL FHLSHKF+DE+RLM YHQNLQDI+EDQLSLASIHY+R+HYQEAID+YKRILL+NR++LALNVYVALCYYKLDYYDVSQEVL +YLQ F DS  AINLKACNHF+LYNGKAAE ELK L +++SPSF FAK+L+KHNL VFR GDGALQ LP LID +PEARLNLVIYYL+ +D+ +AY+L+KD++PTTPQEYILKGVVNAALGQDQ S E++K+AQQYFQLVGGSASECDTIPGRQCMASCFFLL+QF+DVL+YLNSIKSYFYNDD FNFNYAQ KAAIGNYKEAEEIF+L+QSEK+K D+VY SWLA+C+IMN+KAR AWELYLKM+TS ESFSLLQL+AND YKMG+F+YAAKA 
Sbjct:    1 MLSRAKPAVGAGAQPAVEKKKKGKTIPKLEDLLSNRDYTGAITYLEFQRHAGEGNEETDLWMAYCAFHLGDYKRAMEEYEAMTKRDGCNPDVWVNLACVYFFLGMYSEADAAALKAPKSRLQNRLLFHLSHKFSDEKRLMGYHQNLQDIVEDQLSLASIHYMRSHYQEAIDIYKRILLDNRDYLALNVYVALCYYKLDYYDVSQEVLAVYLQHFTDSATAINLKACNHFRLYNGKAAEMELKNLQEMASPSFEFAKELVKHNLVVFRAGDGALQVLPPLIDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQDQGSVEHVKIAQQYFQLVGGSASECDTIPGRQCMASCFFLLKQFEDVLIYLNSIKSYFYNDDGFNFNYAQTKAAIGNYKEAEEIFLLIQSEKLKNDFVYASWLARCYIMNRKARLAWELYLKMDTSGESFSLLQLIANDCYKMGQFFYAAKAF 483          

HSP 2 Score: 114.39 bits (285), Expect = 4.589e-27
Identity = 45/69 (65.22%), Postives = 62/69 (89.86%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKEN 1752
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ+I+A  E K+ LR+++ LLRN+ NPQ+EY ++I++KWAK+N
Sbjct:  481 KAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGHEPKETLRDVIQLLRNTGNPQVEYFLRILKKWAKDN 549          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Nematostella
Match: EDO30962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZB0])

HSP 1 Score: 443.351 bits (1139), Expect = 3.014e-153
Identity = 205/294 (69.73%), Postives = 250/294 (85.03%), Query Frame = 2
Query:  116 LLSRSKPA------NSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLV 979
            +LSR+KPA       ++++  D  K ++LPK +DFL  RD+TG++TLLE+++N+  S E   LWIAYCAFHLGDYKK++EEYL++TK    +PDVW+ +GCC FFLGMY+E+  +A KAPKSRLQNRLQFHLSHKFNDE++LMT+HQ LQDIIEDQLSLASIHYLR+HYQEAID+YKRILL+NR++LALNVYVALCYYKLDYYDVSQEVL +YLQ +PDS  A+NLKACNHF+LYNGKAAE+ELK L + +SPSF+FA DLIKHNL VFR G+GALQ LP L+D +PEARLNLV
Sbjct:    1 MLSRTKPAMGPGSGPTVSSAKDGKKKRKLPKYDDFLQGRDFTGALTLLEFNRNSGKSTEETSLWIAYCAFHLGDYKKSMEEYLSLTKSEACHPDVWINLGCCYFFLGMYQEATDAADKAPKSRLQNRLQFHLSHKFNDEKKLMTHHQALQDIIEDQLSLASIHYLRSHYQEAIDIYKRILLDNRDYLALNVYVALCYYKLDYYDVSQEVLAVYLQHYPDSATAVNLKACNHFRLYNGKAAETELKALQENASPSFSFASDLIKHNLVVFRGGEGALQVLPPLVDVIPEARLNLV 294          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Nematostella
Match: EDO30160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1L6])

HSP 1 Score: 338.191 bits (866), Expect = 2.047e-120
Identity = 154/185 (83.24%), Postives = 178/185 (96.22%), Query Frame = 2
Query: 1001 DIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            D+++AY+L+KD++PTTPQEYILKGVVNA+LGQ+Q SRE+LK+AQQYFQLVGGSASECDTIPGRQCMA+CFFLL+QF+DVL+YLNSIKSYFYNDD+FNFNYAQAKAA+GNYKEAEEIF+L+QSEKIK+DY YLSWLA+C+IMN KAR AWELYLKMETS ESFSLLQL+AND YKMG+FYYAAKA 
Sbjct:    2 DVVEAYNLIKDLEPTTPQEYILKGVVNASLGQEQGSREHLKIAQQYFQLVGGSASECDTIPGRQCMAACFFLLKQFEDVLIYLNSIKSYFYNDDTFNFNYAQAKAAVGNYKEAEEIFLLIQSEKIKSDYTYLSWLARCYIMNHKARMAWELYLKMETSGESFSLLQLVANDCYKMGQFYYAAKAF 186          

HSP 2 Score: 114.005 bits (284), Expect = 2.047e-120
Identity = 47/71 (66.20%), Postives = 63/71 (88.73%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGI 1758
            K+FDVLERLDPNPEYWEGKRG+C+G+FQ I+AN E ++ LR+++ +LRN+ NPQ+EYII+ ++KWAKEN I
Sbjct:  184 KAFDVLERLDPNPEYWEGKRGACVGIFQQIIANHEPRETLRDVLQILRNTANPQVEYIIRTMKKWAKENRI 254          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Medaka
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:101157670])

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 332/485 (68.45%), Postives = 411/485 (84.74%), Query Frame = 2
Query:  113 MLLSRSKPA----NSLTTNLDSHKYK-ELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 1552
            M+LSR KPA    ++L+ +    K K ++P LE++L +RDY G++TLLE+ K+     E+A+LWI YCAFHLGDYK+A+EEY  +T       +VWVY+ C  FFLG+Y++++ +A KAPKS LQNRL FHL+HKF DE+RLM +HQNL+D+ EDQLSLASIHY+R+HYQEAID+YKR+LL+NR+FLA+NVYVALCYYKLDYYD+SQ+VL +YLQ  PDST+A+NLKACNHF+LYNGK AESELK L DISS SF FAK+LI+HNL VFR G+GALQ L  LID +PEARLNLVIYYL+ +D+ +AY+L++D+ PTTPQEYILKGVVNAALGQ+  SR++LK+A+Q FQLVGGSASECDTIPGR CMASCFFLLRQF DVL+YLNS+K Y +NDD+F FN AQAKAA+G YKEAEEIF+ +QSEKIK DYVYLSWLA+C+IMN++ + AW+LYLKM TS++SFSLLQL+AND YKMG+FYYAAKA
Sbjct:    1 MILSRVKPAVGGESALSISEKKRKNKNKVPSLEEYLQQRDYLGALTLLEFHKSIGEKEEHADLWIGYCAFHLGDYKRAMEEYRALTLKPDCPAEVWVYLACALFFLGLYKDAEDAASKAPKSPLQNRLLFHLAHKFTDEKRLMGFHQNLEDVTEDQLSLASIHYMRSHYQEAIDIYKRLLLQNRDFLAVNVYVALCYYKLDYYDISQDVLAVYLQSIPDSTIALNLKACNHFRLYNGKEAESELKNLIDISSCSFEFAKELIQHNLVVFRGGEGALQMLSPLIDVIPEARLNLVIYYLRQDDVQEAYNLIQDLVPTTPQEYILKGVVNAALGQEIGSRDHLKIAEQLFQLVGGSASECDTIPGRLCMASCFFLLRQFKDVLIYLNSVKDYLFNDDTFKFNCAQAKAAVGKYKEAEEIFLSIQSEKIKNDYVYLSWLARCYIMNQRGQLAWDLYLKMGTSSDSFSLLQLIANDCYKMGQFYYAAKA 485          

HSP 2 Score: 115.161 bits (287), Expect = 1.650e-26
Identity = 49/73 (67.12%), Postives = 63/73 (86.30%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FD LE+LDP   YWEGKRG+C+G+FQLILANKESK+ L+E++ LLRNS NPQ+EYII+ +RKWAK+N + L
Sbjct:  484 KAFDALEKLDPGSNYWEGKRGACVGVFQLILANKESKETLKEVLALLRNSGNPQVEYIIRAMRKWAKDNRVLL 556          
BLAST of Intraflagellar transport protein 56 vs. Ensembl Medaka
Match: ttc26 (tetratricopeptide repeat domain 26 [Source:NCBI gene;Acc:101157670])

HSP 1 Score: 215.698 bits (548), Expect = 7.013e-66
Identity = 96/157 (61.15%), Postives = 128/157 (81.53%), Query Frame = 2
Query:  179 ELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENR 649
            ++P LE++L +RDY G++TLLE+ K+     E+A+LWI YCAFHLGDYK+A+EEY  +T       +VWVY+ C  FFLG+Y++++ +A KAPKS LQNRL FHL+HKF DE+RLM +HQNL+D+ EDQLSLASIHY+R+HYQEAID+YKR+LL+NR
Sbjct:   25 KVPSLEEYLQQRDYLGALTLLEFHKSIGEKEEHADLWIGYCAFHLGDYKRAMEEYRALTLKPDCPAEVWVYLACALFFLGLYKDAEDAASKAPKSPLQNRLLFHLAHKFTDEKRLMGFHQNLEDVTEDQLSLASIHYMRSHYQEAIDIYKRLLLQNR 181          
BLAST of Intraflagellar transport protein 56 vs. Planmine SMEST
Match: SMESG000031670.1 (SMESG000031670.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 479/481 (99.58%), Postives = 480/481 (99.79%), Query Frame = 2
Query:  113 MLLSRSKPANSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAL 1555
            MLLSRSKPANSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKAR+AWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKA 
Sbjct:    1 MLLSRSKPANSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNADSSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFFLGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIEDQLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDVSQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSFTFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQAYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSASECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAKAAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARNAWELYLKMETSTESFSLLQLLANDYYKMGEFYYAAKAF 481          

HSP 2 Score: 151.369 bits (381), Expect = 6.519e-39
Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
Query: 1546 KSFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 1764
            K+FDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL
Sbjct:  479 KAFDVLERLDPNPEYWEGKRGSCIGLFQLILANKESKDKLREIVLLLRNSNNPQIEYIIKIIRKWAKENGITL 551          
The following BLAST results are available for this feature:
BLAST of Intraflagellar transport protein 56 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC263.162e-2671.49tetratricopeptide repeat domain 26 [Source:HGNC Sy... [more]
TTC260.000e+071.46tetratricopeptide repeat domain 26 [Source:HGNC Sy... [more]
TTC262.071e-2668.12tetratricopeptide repeat domain 26 [Source:HGNC Sy... [more]
TTC267.307e-14061.98tetratricopeptide repeat domain 26 [Source:HGNC Sy... [more]
TTC261.643e-13260.82tetratricopeptide repeat domain 26 [Source:HGNC Sy... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dyf-134.135e-11439.71Intraflagellar transport protein 56 homolog [Sour... [more]
dyf-131.835e-11339.83Intraflagellar transport protein 56 homolog [Sour... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ttc269.410e-17450.99gene:FBgn0038358 transcript:FBtr0083170[more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc269.002e-2770.16tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdt19.991e-2572.88chromatin licensing and DNA replication factor 1 [... [more]
cdt11.023e-2470.95chromatin licensing and DNA replication factor 1 [... [more]
cdt19.296e-2567.49chromatin licensing and DNA replication factor 1 [... [more]
cdt12.370e-14063.25chromatin licensing and DNA replication factor 1 [... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ttc261.845e-2672.11tetratricopeptide repeat domain 26 [Source:MGI Sym... [more]
Ttc264.884e-9363.06tetratricopeptide repeat domain 26 [Source:MGI Sym... [more]
Ttc264.089e-3449.59tetratricopeptide repeat domain 26 [Source:MGI Sym... [more]
Ttc268.522e-2152.56tetratricopeptide repeat domain 26 [Source:MGI Sym... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4III8|IFT56_XENTR5.293e-2472.88Intraflagellar transport protein 56 OS=Xenopus tro... [more]
sp|Q8BS45|IFT56_MOUSE1.291e-2572.11Intraflagellar transport protein 56 OS=Mus musculu... [more]
sp|Q5U2N8|IFT56_RAT1.245e-2572.11Intraflagellar transport protein 56 OS=Rattus norv... [more]
sp|A0AVF1|IFT56_HUMAN1.519e-2571.49Intraflagellar transport protein 56 OS=Homo sapien... [more]
sp|Q4R7Z9|IFT56_MACFA4.214e-2571.49Intraflagellar transport protein 56 OS=Macaca fasc... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TES62.340e-2275.98TPR_REGION domain-containing protein OS=Pocillopor... [more]
A0A2B4RLZ52.026e-2275.77Tetratricopeptide repeat protein 26 OS=Stylophora ... [more]
K1QQF91.545e-2372.00Tetratricopeptide repeat protein 26 OS=Crassostrea... [more]
A0A2G8KFI43.533e-2273.76Putative intraflagellar transport protein OS=Stich... [more]
A0A2T7PXV13.587e-2274.69Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc262.692e-2770.78tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
ttc261.807e-2773.66tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
ttc261.436e-13975.71tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc264.589e-2774.33tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO309623.014e-15369.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301602.047e-12083.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc261.650e-2668.45tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
ttc267.013e-6661.15tetratricopeptide repeat domain 26 [Source:NCBI ge... [more]
back to top
BLAST of Intraflagellar transport protein 56 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000031670.16.519e-3999.58SMESG000031670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018900 ID=SMED30018900|Name=Intraflagellar transport protein 56|organism=Schmidtea mediterranea sexual|type=transcript|length=1921bp
GCAAAAATGTTTTAAAGTTTATAATAAACTTTAATATTTTACGAAATTCA
TTTATTGAATTATCAAATAGTTTCTGATTTTGTTTAAAATTATTGTTTCT
AAAACGACAGAAATGTTATTATCTCGATCAAAACCGGCGAATTCTCTAAC
AACTAATTTGGATTCACACAAATATAAAGAACTACCTAAACTCGAAGATT
TTTTAATTAAAAGAGATTACACTGGATCAATTACTCTTTTAGAATATTCC
AAAAATGCTGATTCTTCACCCGAAAATGCCGAACTTTGGATTGCATATTG
TGCTTTTCATTTAGGTGACTATAAAAAAGCTCTGGAAGAATATTTAAACA
TCACTAAATTTAATAAATTTAATCCTGATGTATGGGTATATATTGGATGT
TGTCAATTTTTTTTGGGTATGTATGAAGAATCAGATTTCTCTGCTAAAAA
GGCTCCCAAAAGTAGGTTGCAGAATAGATTGCAATTTCATTTATCTCATA
AATTCAACGATGAAAGAAGACTTATGACTTATCATCAAAACCTTCAAGAT
ATTATTGAAGACCAGCTGTCACTCGCTTCTATACATTATTTAAGAAATCA
TTACCAAGAAGCGATTGATGTTTATAAAAGAATTTTATTAGAAAACAGGG
AATTCTTGGCTCTCAACGTATATGTTGCACTATGTTATTATAAATTGGAC
TATTATGATGTCTCTCAAGAAGTTTTACAAATCTATTTACAACAATTTCC
TGATAGTACTGTTGCAATTAATTTAAAAGCTTGTAATCACTTTAAGTTAT
ATAACGGAAAGGCAGCAGAATCAGAATTAAAGACATTATATGATATTTCA
TCACCTTCTTTCACATTCGCTAAAGATTTAATAAAACATAATTTGACCGT
TTTTAGAAATGGCGATGGTGCACTGCAAACCTTGCCAAGTTTGATAGACA
CCTTACCCGAAGCTCGTTTAAACCTTGTTATTTATTATTTAAAACTTAAT
GATATAATTCAAGCTTATGATCTAATGAAAGATGTTGATCCAACTACTCC
TCAAGAATATATTCTTAAAGGAGTTGTCAATGCAGCATTAGGTCAAGATC
AGAATTCTAGAGAAAATTTAAAGTTAGCTCAACAGTACTTTCAATTAGTT
GGAGGATCTGCCAGCGAATGTGATACAATACCTGGCAGACAATGTATGGC
GTCATGTTTTTTTTTATTGAGACAATTTGATGATGTTCTTGTTTACCTAA
ATTCAATTAAAAGCTATTTCTATAATGATGACAGTTTTAATTTTAATTAT
GCGCAAGCAAAAGCGGCAATTGGTAACTACAAAGAAGCTGAGGAAATATT
TGTTTTAGTACAAAGTGAAAAAATTAAGGCAGATTATGTCTATCTTAGTT
GGTTAGCCAAGTGCTTTATAATGAACAAAAAAGCTAGACATGCTTGGGAA
TTATATTTAAAAATGGAAACTTCTACTGAATCATTTAGCTTGCTTCAATT
GTTGGCTAATGATTATTATAAAATGGGGGAGTTTTATTACGCCGCAAAAG
CTTTGATGTATTGGAGAGACTCGATCCTAATCCTGAATATTGGGAAGGCA
AACGCGGATCTTGTATTGGATTATTTCAATTAATTCTAGCAAATAAAGAA
TCTAAAGATAAATTAAGAGAAATAGTTTTACTTCTTCGAAATTCAAATAA
TCCTCAAATTGAATATATAATAAAAATTATTAGAAAATGGGCCAAAGAAA
ATGGAATAACCCTTTGAAGTGAATTTCGAATTTTGTTATTAAATATAAAT
TTTTTAGTAAATTAATATTTTGTCAATGTAACTTAACCGTTGATGTGTGT
TCTTTTGAAATTGTTTTGTAAATATTAACGCCTGTTTATTTTAATTAAAT
TTATGTTGTACGCTTATAAAA
back to top

protein sequence of SMED30018900-orf-1

>SMED30018900-orf-1 ID=SMED30018900-orf-1|Name=SMED30018900-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MLLSRSKPANSLTTNLDSHKYKELPKLEDFLIKRDYTGSITLLEYSKNAD
SSPENAELWIAYCAFHLGDYKKALEEYLNITKFNKFNPDVWVYIGCCQFF
LGMYEESDFSAKKAPKSRLQNRLQFHLSHKFNDERRLMTYHQNLQDIIED
QLSLASIHYLRNHYQEAIDVYKRILLENREFLALNVYVALCYYKLDYYDV
SQEVLQIYLQQFPDSTVAINLKACNHFKLYNGKAAESELKTLYDISSPSF
TFAKDLIKHNLTVFRNGDGALQTLPSLIDTLPEARLNLVIYYLKLNDIIQ
AYDLMKDVDPTTPQEYILKGVVNAALGQDQNSRENLKLAQQYFQLVGGSA
SECDTIPGRQCMASCFFLLRQFDDVLVYLNSIKSYFYNDDSFNFNYAQAK
AAIGNYKEAEEIFVLVQSEKIKADYVYLSWLAKCFIMNKKARHAWELYLK
METSTESFSLLQLLANDYYKMGEFYYAAKALMYWRDSILILNIGKANADL
VLDYFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008594photoreceptor cell morphogenesis
GO:0035082axoneme assembly
GO:0035845photoreceptor cell outer segment organization
GO:0039023pronephric duct morphogenesis
GO:0046530photoreceptor cell differentiation
GO:0060271cilium morphogenesis
GO:0061512protein localization to cilium
GO:0006810transport
GO:0007224smoothened signaling pathway
GO:0015031protein transport
GO:0042073intraciliary transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR030511TTC26
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005929cilium
GO:0030992intraciliary transport particle B
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 56..87
e-value: 170.0
score: 4.2
coord: 148..181
e-value: 2.6
score: 17.1
coord: 458..491
e-value: 35.0
score: 10.2
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 28..127
e-value: 7.4E-9
score: 37.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 359..499
e-value: 4.5E-6
score: 28.3
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 360..491
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 149..341
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 33..114
IPR030511Tetratricopeptide repeat protein 26PANTHERPTHR14781UNCHARACTERIZEDcoord: 1..506
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 148..215
score: 9.193
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 458..491
score: 7.172