Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30018899
Length (bp)1025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30018899) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30018899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30018899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30018899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30018899SMESG000078545.1 dd_Smed_v4_354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018899SMESG000078545.1 dd_Smed_v4_354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30018899SMESG000078545.1 dd_Smed_v4_354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30018899SMESG000078545.1 dd_Smed_v6_354_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30018899SMESG000078545.1 dd_Smed_v6_354_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN3 (tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752])

HSP 1 Score: 68.1662 bits (165), Expect = 1.690e-12
Identity = 45/135 (33.33%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            I A+V+I +G   FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  +P+A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNG-TNPDAA--SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 178          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN3 (tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752])

HSP 1 Score: 58.9214 bits (141), Expect = 1.808e-9
Identity = 40/135 (29.63%), Postives = 65/135 (48.15%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            I A+V+I +G   FIIG  GCC  I+E+ C L                            +N +D+++ K+ K+ +NG  +P+A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGL-------------------------ATVENEVDRSIQKVYKT-YNG-TNPDAA--SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 153          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 52.7582 bits (125), Expect = 2.012e-7
Identity = 46/214 (21.50%), Postives = 88/214 (41.12%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +++ +V+I +G F F++ F GCCGA KEN+CL+  ++  + +++L+EV     A +    F++ +        + +       N T    +   +  + KCCG  +  D       W +         P  CC    V                           N  +  ++  GC + +   + KN+ +V    +G+   E+  I+FACC++
Sbjct:   28 SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVA----AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHT--ASILDRMQADFKCCGAANYTD-------WEKIPSMSKNRVPDSCCINVTV-----------------------GCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLV 205          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 51.6026 bits (122), Expect = 5.926e-7
Identity = 46/214 (21.50%), Postives = 88/214 (41.12%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +++ +V+I +G F F++ F GCCGA KEN+CL+  ++  + +++L+EV     A +    F++ +        + +       N T    +   +  + KCCG  +  D       W +         P  CC    V                           N  +  ++  GC + +   + KN+ +V    +G+   E+  I+FACC++
Sbjct:   51 SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVA----AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHT--ASILDRMQADFKCCGAANYTD-------WEKIPSMSKNRVPDSCCINVTV-----------------------GCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLV 228          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 51.6026 bits (122), Expect = 5.926e-7
Identity = 46/214 (21.50%), Postives = 88/214 (41.12%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +++ +V+I +G F F++ F GCCGA KEN+CL+  ++  + +++L+EV     A +    F++ +        + +       N T    +   +  + KCCG  +  D       W +         P  CC    V                           N  +  ++  GC + +   + KN+ +V    +G+   E+  I+FACC++
Sbjct:   51 SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVA----AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHT--ASILDRMQADFKCCGAANYTD-------WEKIPSMSKNRVPDSCCINVTV-----------------------GCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLV 228          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 47.7506 bits (112), Expect = 4.750e-6
Identity = 56/225 (24.89%), Postives = 101/225 (44.89%), Query Frame = 1
Query:  361 LNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMS--PNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQ-----VNPIGCCAETEVYVYNTNDKFVLDKVKPFFKN-PDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISK 1011
            L   A V +V G    ++GF G CGA+  +  LL  +   +    L +V +G  +   K K  + + + + +I+KS++ G+M+  P   + T+    +    KCCG     D+ S++  W QS +  ++     + P+ CC +                + P  K+   C     + Q + +  GCS+ L+   N+ + I +G   G  L  +  I  +CC+ISK
Sbjct:   58 LKASAYVSLVCGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKVYS-VKENVREIVKSKY-GVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDYISSR--WSQSTNQDSEEIESPLFPVSCCTQIT----------GASALNPLAKSYARCQQIGANRQWR-HAVGCSERLMSWFNEQIWIFVGFGFGSALTMMLGICLSCCLISK 267          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 46.9802 bits (110), Expect = 8.914e-6
Identity = 42/140 (30.00%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  379 VLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI------MSPNATIFTK-VFTAVMLELKCCGIKDQ-EDFNSTKVNWRQSIDNKAQVNPIGCCAETE 774
            +L V G    ++ F GCCGA KE   LL  YS  + +++ I++   IYA +    F+N     L   LK  +NG        +P   +  K  +  +M+E  CCG+  +  +FN++   W Q    + Q  P  CC   E
Sbjct:   85 LLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKM-YNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNS--GWYQLNHGRYQFPP-ACCPPDE 220          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 46.9802 bits (110), Expect = 8.914e-6
Identity = 42/140 (30.00%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  379 VLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI------MSPNATIFTK-VFTAVMLELKCCGIKDQ-EDFNSTKVNWRQSIDNKAQVNPIGCCAETE 774
            +L V G    ++ F GCCGA KE   LL  YS  + +++ I++   IYA +    F+N     L   LK  +NG        +P   +  K  +  +M+E  CCG+  +  +FN++   W Q    + Q  P  CC   E
Sbjct:   85 LLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKM-YNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNS--GWYQLNHGRYQFPP-ACCPPDE 220          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp39D (gene:FBgn0032943 transcript:FBtr0273404)

HSP 1 Score: 55.4546 bits (132), Expect = 1.168e-8
Identity = 61/219 (27.85%), Postives = 104/219 (47.49%), Query Frame = 1
Query:  376 IVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMS--PNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVIS--KKSY 1020
            I+L+++G    +I F GCCGA+KE+ C++  ++ L  V+ L E+G+G+ AG  K          L +I++S+FN  M        +   +T +  EL CCGI    D+ +   N            P  CC+     V N ++              +C T T+ TQ      GC Q L+++++    I+  V +G+   ++  I+FACC+    ++SY
Sbjct:   54 IILMIVGAAVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGL-AGYVK-------HTGLHQIMESQFNSTMQHYKERADYRDAWTLLQTELDCCGINGPNDWETVYRN---------STLPAACCS-----VINLSEA------------KEC-TNTHATQ-----HGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSY 232          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ed (gene:FBgn0029507 transcript:FBtr0345536)

HSP 1 Score: 54.299 bits (129), Expect = 3.305e-8
Identity = 37/113 (32.74%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNST 702
            N VAI+++VLG   F++ F GCCGAI+EN C L  YS ++ V+++ ++ + IY  V+  +    I Q+L KI+++ ++   +    + T     +    KCCG+    D+  T
Sbjct:   50 NSVAIIILVLGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQ----IQQSLEKIVQTIWDQRKTDALLMDT-----LQRSFKCCGLNGFADYGIT 153          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ed (gene:FBgn0029507 transcript:FBtr0086181)

HSP 1 Score: 54.299 bits (129), Expect = 3.305e-8
Identity = 37/113 (32.74%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNST 702
            N VAI+++VLG   F++ F GCCGAI+EN C L  YS ++ V+++ ++ + IY  V+  +    I Q+L KI+++ ++   +    + T     +    KCCG+    D+  T
Sbjct:   50 NSVAIIILVLGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQ----IQQSLEKIVQTIWDQRKTDALLMDT-----LQRSFKCCGLNGFADYGIT 153          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076507)

HSP 1 Score: 49.6766 bits (117), Expect = 1.337e-6
Identity = 56/247 (22.67%), Postives = 105/247 (42.51%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI-MSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLID-LINKNXXXXXXXXXXXXXFEIFCIIFACC 999
            W+ VDK +L  +++ V    +      +    +  +A VL+V+G   F + F G  GA++E+ CLL  Y       +++ +   I AG     FK+ +       L++      +  N    + ++  +M    CCGI D  DF+++   W     N+    P  CC   +V            K+ P  ++ DC T  + + +     GC +   + LI +   +++ + VG+    +  + FA C
Sbjct:   34 WLAVDKHSLIALLKLVE---SERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYG----TFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPA-WVNGKGNRTI--PDACCILKDV-----------AKLVP--RDEDCTTNPSDSNS-FYKKGCYEVFTEWLIRQRELVIVAIAVGIVHLVLIILAFALC 256          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076506)

HSP 1 Score: 49.6766 bits (117), Expect = 1.337e-6
Identity = 56/247 (22.67%), Postives = 105/247 (42.51%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI-MSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLID-LINKNXXXXXXXXXXXXXFEIFCIIFACC 999
            W+ VDK +L  +++ V    +      +    +  +A VL+V+G   F + F G  GA++E+ CLL  Y       +++ +   I AG     FK+ +       L++      +  N    + ++  +M    CCGI D  DF+++   W     N+    P  CC   +V            K+ P  ++ DC T  + + +     GC +   + LI +   +++ + VG+    +  + FA C
Sbjct:   34 WLAVDKHSLIALLKLVE---SERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYG----TFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPA-WVNGKGNRTI--PDACCILKDV-----------AKLVP--RDEDCTTNPSDSNS-FYKKGCYEVFTEWLIRQRELVIVAIAVGIVHLVLIILAFALC 256          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan18a (tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-232])

HSP 1 Score: 65.0846 bits (157), Expect = 1.034e-11
Identity = 61/246 (24.80%), Postives = 109/246 (44.31%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            WV VD +   EI+   +L  T                  ++++G   F++GF GCCGAI+EN CLL  +  L+ V+ L E+ + I A + +           TK LK+ + G  S +  +FT  + A+M    CCG+   EDF+   +  R    N +++ P  CC  T++ +   + +  L  + P                 +   GC  +++D     + +   + + +   E+F ++FA C+
Sbjct:   33 WVLVDPTGFREIVAANSLLFTG--------------VYAILIMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLTR---DYFTKELKTHYQGTNSTD--VFTSTWNAIMTTFNCCGVNSAEDFDDQSLFRRL---NPSRIVPEVCCQRTDLMM---SKEECLRGIMP-----------------IRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFAMCL 236          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan18a (tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-232])

HSP 1 Score: 65.0846 bits (157), Expect = 1.034e-11
Identity = 61/246 (24.80%), Postives = 109/246 (44.31%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            WV VD +   EI+   +L  T                  ++++G   F++GF GCCGAI+EN CLL  +  L+ V+ L E+ + I A + +           TK LK+ + G  S +  +FT  + A+M    CCG+   EDF+   +  R    N +++ P  CC  T++ +   + +  L  + P                 +   GC  +++D     + +   + + +   E+F ++FA C+
Sbjct:   33 WVLVDPTGFREIVAANSLLFTG--------------VYAILIMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLTR---DYFTKELKTHYQGTNSTD--VFTSTWNAIMTTFNCCGVNSAEDFDDQSLFRRL---NPSRIVPEVCCQRTDLMM---SKEECLRGIMP-----------------IRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFAMCL 236          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan18a (tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-232])

HSP 1 Score: 65.0846 bits (157), Expect = 1.034e-11
Identity = 61/246 (24.80%), Postives = 109/246 (44.31%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            WV VD +   EI+   +L  T                  ++++G   F++GF GCCGAI+EN CLL  +  L+ V+ L E+ + I A + +           TK LK+ + G  S +  +FT  + A+M    CCG+   EDF+   +  R    N +++ P  CC  T++ +   + +  L  + P                 +   GC  +++D     + +   + + +   E+F ++FA C+
Sbjct:   45 WVLVDPTGFREIVAANSLLFTG--------------VYAILIMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLTR---DYFTKELKTHYQGTNSTD--VFTSTWNAIMTTFNCCGVNSAEDFDDQSLFRRL---NPSRIVPEVCCQRTDLMM---SKEECLRGIMP-----------------IRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFAMCL 248          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 59.3066 bits (142), Expect = 9.474e-10
Identity = 53/217 (24.42%), Postives = 101/217 (46.54%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISKKS 1017
            I A+V+I +G   FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   + + K ++ ++ ++ K+  +E+NG    N    ++    V  +L CCGI +  D+ +T+  W +   N +   P+ CC                   KP   N  C  +  H    L P GC + ++  + + +  VI   +     ++  ++ AC V+ ++S
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILMLVFVTEVVVVVLGYIYRAKVEDEVNHSIQKVY-NEYNG---TNTDAPSRAIDYVQRQLHCCGITNFADWRNTR--WFKESKNNSV--PLSCC-------------------KPNVSN--CTGSLLH-PGDLYPEGCEELVVKKLKEIMMYVIWAALTFAAIQMLGMLCACVVLCRRS 238          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 59.3066 bits (142), Expect = 9.474e-10
Identity = 53/217 (24.42%), Postives = 101/217 (46.54%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISKKS 1017
            I A+V+I +G   FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   + + K ++ ++ ++ K+  +E+NG    N    ++    V  +L CCGI +  D+ +T+  W +   N +   P+ CC                   KP   N  C  +  H    L P GC + ++  + + +  VI   +     ++  ++ AC V+ ++S
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILMLVFVTEVVVVVLGYIYRAKVEDEVNHSIQKVY-NEYNG---TNTDAPSRAIDYVQRQLHCCGITNFADWRNTR--WFKESKNNSV--PLSCC-------------------KPNVSN--CTGSLLH-PGDLYPEGCEELVVKKLKEIMMYVIWAALTFAAIQMLGMLCACVVLCRRS 238          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: gpr88 (G protein-coupled receptor 88 [Source:Xenbase;Acc:XB-GENE-984668])

HSP 1 Score: 61.6178 bits (148), Expect = 1.998e-10
Identity = 58/246 (23.58%), Postives = 103/246 (41.87%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            WV VD +   EI+    L              L + A +++ +G   F++GF GCCGAI+EN CLL  +   + V+ L E+   I A + +   +N       + +K  ++G    +  +F+  + ++M+   CCG+   EDFN      R    +     P  CC              V  +        +C T   + Q   N  GC   +++ +   + I   + +G+   E+  ++FA C+
Sbjct:   33 WVFVDPTGFREIIATTPL--------------LFMGAYLVLAMGGMLFLLGFLGCCGAIRENKCLLVFFFMFILVIFLAELSAAILAFLFR---ENLSKDFFAREVKKHYHG--DNSTEVFSSTWNSIMITFGCCGVNGPEDFNDAH---RFRAMHPFAPVPEACCRRE-----------VQSRAGKIVSRAECLTGGENYQ---NRQGCYSVIVNSVEPYVYIAGALAIGVLAIELLSMVFAMCL 242          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:NCBI gene;Acc:548861])

HSP 1 Score: 56.225 bits (134), Expect = 1.168e-8
Identity = 49/171 (28.65%), Postives = 78/171 (45.61%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDF-NSTKVNWRQSIDNKAQVNPIGCCAETE 774
            WV VD ++  +I   V+        +         V   LI +G+   I+GF GCCGA +E+ CLL  +  ++ ++ + EV   + A V     +  +   L  +L++E+    +P+    TK++ + M  L CCG  +  DF NST  N      N  Q  P  CC  T 
Sbjct:   19 WVSVDSNSFLKIFGTVSASAALQFVN---------VGYFLIAIGSLLVILGFLGCCGAQRESKCLLLTFFSIILIIFIAEVAGAVVALVYSSLAETILGPLLKPVLQNEYGS--NPDV---TKIWNSTMENLHCCGFNNYTDFSNSTFYN------NNHQQYPSYCCNSTS 169          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: ephx2 (epoxide hydrolase 2, cytoplasmic [Source:Xenbase;Acc:XB-GENE-947544])

HSP 1 Score: 55.8398 bits (133), Expect = 1.886e-8
Identity = 41/141 (29.08%), Postives = 74/141 (52.48%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYN 789
            I  +++I  GT  FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   + + K ++ +D  +  +  +++NGI SP++   ++    V  +L CCGI +  D+ +T   W     N +   P+ CC     YV+N
Sbjct:   52 IPGVIIIAAGTLLFIIGLIGCCATIRESRCGLATFVVILLLVFVTEVVVVVLGYIYRAKVEDEVDNTIANVF-NQYNGI-SPDSA--SRAIDYVQRQLHCCGIDNYLDWENTP--WFSEAKNNSV--PLSCCRN---YVFN 181          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:NCBI gene;Acc:548861])

HSP 1 Score: 55.8398 bits (133), Expect = 1.892e-8
Identity = 49/171 (28.65%), Postives = 78/171 (45.61%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDF-NSTKVNWRQSIDNKAQVNPIGCCAETE 774
            WV VD ++  +I   V+        +         V   LI +G+   I+GF GCCGA +E+ CLL  +  ++ ++ + EV   + A V     +  +   L  +L++E+    +P+    TK++ + M  L CCG  +  DF NST  N      N  Q  P  CC  T 
Sbjct:   31 WVSVDSNSFLKIFGTVSASAALQFVN---------VGYFLIAIGSLLVILGFLGCCGAQRESKCLLLTFFSIILIIFIAEVAGAVVALVYSSLAETILGPLLKPVLQNEYGS--NPDV---TKIWNSTMENLHCCGFNNYTDFSNSTFYN------NNHQQYPSYCCNSTS 181          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: wdr74 (WD repeat domain 74 [Source:Xenbase;Acc:XB-GENE-969801])

HSP 1 Score: 49.2914 bits (116), Expect = 2.358e-6
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  181 CESFSKTXXXXXXXXXXXXXXXXXXXXXWVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHC----LLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCA 765
            C SF KT++ +FN + F+ G   LG+G+WVKVD  +  +I+      G+A+       +    V  + I +G F  ++GF GCCGA+KE+ C       +   +    +   V +  ++ V +  F   +     K L  ++       +   T ++ A M ELKCCG    EDF ++    R       Q  P  CCA
Sbjct:    3 CFSFLKTMMFVFNGIIFLGGVAVLGIGVWVKVDGGSFLQIL------GSAAPQLMQVVN----VGYLCIAVGGFLILMGFLGCCGAVKESRCMLMLFFIIILIIFIAEVAGAVVVLAFSSVSR-IFIEYLGNVAVKYLHYQYG-----ESDELTTIWNATMKELKCCGFYSYEDFTNSTYYQRN------QQYPPVCCA 179          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 69.707 bits (169), Expect = 3.130e-13
Identity = 45/133 (33.83%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            A+V+I +G   FIIG  GCC  I+E+ C L  + F++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  S  A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   57 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNGTNSDAA---SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 181          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 69.707 bits (169), Expect = 3.162e-13
Identity = 45/133 (33.83%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            A+V+I +G   FIIG  GCC  I+E+ C L  + F++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  S  A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   54 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNGTNSDAA---SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 178          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 61.2326 bits (147), Expect = 1.161e-10
Identity = 37/110 (33.64%), Postives = 64/110 (58.18%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNST 702
            A+V+I +G   FIIG  GCC  I+E+ C L  + F++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  S  A   ++    V  +L CCGI +  D+ +T
Sbjct:   94 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNGTNSDAA---SRAIDYVQRQLHCCGIHNYSDWENT 199          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd63 (CD63 antigen [Source:MGI Symbol;Acc:MGI:99529])

HSP 1 Score: 55.0694 bits (131), Expect = 2.648e-8
Identity = 52/214 (24.30%), Postives = 96/214 (44.86%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +++ +V+I +G F F++ F GCCGA KEN+CL+  ++  + +++L+EV + I   V    F++ +     K  + +    +  N T    +   +  E  CCG  +  D+ +     +  +       P  CC    V   N                 D   +T HTQ      GC +++   + KN+ +V    +G+   E+  IIF+CC++
Sbjct:   51 SLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYV----FRDQVKSEFNKSFQQQMQNYLKDNKT--ATILDKLQKENNCCGASNYTDWENIPGMAKDRV-------PDSCCINITVGCGN-----------------DFKESTIHTQ------GCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLV 228          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd63 (CD63 antigen [Source:MGI Symbol;Acc:MGI:99529])

HSP 1 Score: 55.0694 bits (131), Expect = 2.648e-8
Identity = 52/214 (24.30%), Postives = 96/214 (44.86%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +++ +V+I +G F F++ F GCCGA KEN+CL+  ++  + +++L+EV + I   V    F++ +     K  + +    +  N T    +   +  E  CCG  +  D+ +     +  +       P  CC    V   N                 D   +T HTQ      GC +++   + KN+ +V    +G+   E+  IIF+CC++
Sbjct:   51 SLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYV----FRDQVKSEFNKSFQQQMQNYLKDNKT--ATILDKLQKENNCCGASNYTDWENIPGMAKDRV-------PDSCCINITVGCGN-----------------DFKESTIHTQ------GCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLV 228          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q9QY33|TSN3_MOUSE (Tetraspanin-3 OS=Mus musculus OX=10090 GN=Tspan3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.212e-12
Identity = 45/133 (33.83%), Postives = 76/133 (57.14%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            A+V+I +G   FIIG  GCC  I+E+ C L  + F++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  S  A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   54 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNGTNSDAA---SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 178          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q5RE11|TSN3_PONAB (Tetraspanin-3 OS=Pongo abelii OX=9601 GN=TSPAN3 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.118e-12
Identity = 45/135 (33.33%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            I A+V+I +G   FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  +P+A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNG-TNPDAA--SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 178          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|O60637|TSN3_HUMAN (Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.118e-12
Identity = 45/135 (33.33%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            I A+V+I +G   FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  +P+A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNG-TNPDAA--SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 178          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q3SZR9|TSN3_BOVIN (Tetraspanin-3 OS=Bos taurus OX=9913 GN=TSPAN3 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.275e-12
Identity = 45/135 (33.33%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            I A+V+I +G   FIIG  GCC  I+E+ C L  +  ++ +V + EV + +   V + K +N +D+++ K+ K+ +NG  +P+A   ++    V  +L CCGI +  D+ +T  +W +  + K Q  P+ CC ET
Sbjct:   52 IPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKT-YNG-TNPDAA--SRAIDYVQRQLHCCGIHNYSDWENT--DWFK--ETKNQSVPLSCCRET 178          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P28648|CD63_RAT (CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 5.793e-9
Identity = 55/214 (25.70%), Postives = 98/214 (45.79%), Query Frame = 1
Query:  364 NIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +++ +V+I +G F F++ F GCCGA KEN+CL+  ++  + +++L+EV + I   V    F++ +    +K  + +    ++ N T    +   +  E KCCG  +  D       W +         P  CC    V   N                 D   +T HTQ      GC +++   + KN+ +V G  +G+   E+  IIF+CC++
Sbjct:   51 SLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYV----FRDQVKSEFSKSFQKQMQNYLTDNKT--ATILDKLQKENKCCGASNYTD-------WERIPGMAKDRVPDSCCINITVGCGN-----------------DFKESTIHTQ------GCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLV 228          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267GUI3 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020035g1 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.073e-19
Identity = 81/268 (30.22%), Postives = 129/268 (48.13%), Query Frame = 1
Query:  265 WVKVDKSNLFEIM----RKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQAL-TKILKSEFNGIMSPNATIFTKVFTAVML---------ELKCCGIKDQEDFNSTKVNWRQS---IDNKAQVNPIGCC--AETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISK 1011
            WV   + +LFE M    + VN+D        + +S L   A + +  G  + IIGFCGCCGAIKEN C+L  Y+  + +++  E+   I A V    FKN I + L  + +  E N  +  N T+  +  T V +          L+CCG+ +Q D   +   W +S    +   QV P+ CC    T+  + + ND       + +  +P CP T  ++  +    GC   L   I+     +I VCV + +FEIFC++ A C+++K
Sbjct:   30 WVIASQGSLFEFMQLLTKDVNVDSKTMDNYLNGTSTLLAAAYIAVAFGGLSIIIGFCGCCGAIKENACMLIFYAVSISIILAAEIAGAIVAAV----FKNQISKELKPRFITLEKNHFIPLNQTLSNESSTDVTITTYINYLQVSLECCGVNNQSDITGSDTKWSKSERYYNGLPQVMPVTCCKMKSTKNELLSKND---WKNSRDYLSDPTCPNTGMNSLTE----GCYNKLEKTIDFYALPIIIVCVVVAVFEIFCVVIASCMVNK 286          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8HQE3 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020035g3 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.940e-19
Identity = 80/268 (29.85%), Postives = 128/268 (47.76%), Query Frame = 1
Query:  265 WVKVDKSNLFEIM----RKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQAL-TKILKSEFNGIMSPNATI---------FTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQS---IDNKAQVNPIGCC--AETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISK 1011
            WV   + +LFE M    + VN+D        + +S L   A + +  G  + IIGFCGCCGAIKEN C+L  Y+  + +++  E+   I A V    FKN I + L  + +  E N  +  N T+          T     + + L+CCG+ +Q D   +   W +S    +   QV P+ CC    T+  + + ND       + +  +P CP T  ++  +    GC   L   I+     +I VCV + +FEIFC++ A C+++K
Sbjct:   30 WVIASQGSLFEFMQLLTKDVNVDSKTMDNYLNGTSTLLAAAYIAVAFGGLSIIIGFCGCCGAIKENACMLIFYAVSISIILAAEIAGAIVAAV----FKNQISKELKPRFITLEKNHFIPLNQTLSNESSTDVTITTYINYLQVSLECCGVNNQSDITGSDTKWSKSERYYNGLWQVMPVTCCKMKSTKNELLSKND---WKNSRDYLSDPTCPNTGMNSLTE----GCYNKLEKTIDFYALPIIIVCVVVAVFEIFCVVIASCMVNK 286          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267ERG2 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023279g1 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.541e-19
Identity = 82/267 (30.71%), Postives = 134/267 (50.19%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNL-----DGTAXXXXXXXXXXLNIVA-IVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI-------MSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNW---RQSIDNKAQVNPIGCCA--ETEVYVYNTNDKFVLDKVKPFFKNPDCP--TTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            WV V+KS+LF ++  ++      D        ++ + L +VA  +LI +G FT ++GFCGCCGA+KE+ CLL +Y+FLVG+V+ +EV   I A V + + +   +  +  + +  F  +        S N    T +   + +   CCG K   D  ++  +W    +S + +    PI CC   + +           + K+     +P CP   TT HT+       C   ++D I K  G +IGVC G+ +FE+FCII ACC++
Sbjct:   32 WVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQNGLVMVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVAAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDIANSS-SWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLVDPSCPFTGTTQHTKT------CYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVACCLV 291          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GD10 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006680g1 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.448e-19
Identity = 82/267 (30.71%), Postives = 133/267 (49.81%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNL-----DGTAXXXXXXXXXXLNIVA-IVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI-------MSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNW---RQSIDNKAQVNPIGCCA--ETEVYVYNTNDKFVLDKVKPFFKNPDCP--TTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            WV V+KS+LF ++  ++      D        ++ + L  VA  +LI +G FT ++GFCGCCGA+KE+ CLL +Y+FLVG+V+ +EV   I A V + + +   +  +  + +  F  +        S N    T +   + +   CCG K   D  ++  +W    +S + +    PI CC   + +           + K+     +P CP   TT HT+       C   ++D I K  G +IGVC G+ +FE+FCII ACC++
Sbjct:   32 WVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQNGLVTVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVTAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDIANSS-SWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLVDPSCPFTGTTQHTKT------CYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVACCLV 291          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267EG05 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020731g1 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.082e-18
Identity = 74/268 (27.61%), Postives = 132/268 (49.25%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKV-----NLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGI-------MSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQS---IDNKAQVNPIGCCAETEVYVYNTNDKFV----LDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISK 1011
            WV V   ++F+++        N++        SS+S L   A V++V G  +F+IGFCGCCGAI+E+ CLL +Y+  V +V+++E+  GI AGV + +    +   L ++  + +  I        +PNA +F+ +     + + CCG+    D       W  S    + K  V P+ CC        N  D+ +      ++  +  + +CP   N + +++N  GC   L   I++    +I V + +G+FEI C++ AC ++ K
Sbjct:   30 WVIVSADSMFKLVHLATQGSDNINNETLMSYKSSTSTLVAAAYVILVFGALSFLIGFCGCCGAIRESSCLLSIYAGAVSIVLIVEIAGGIAAGVFRAQIGTEMLPTLRRLEATRYLPINLAVSNDSNPNA-VFSSLVNYAQVSMSCCGVSSMSDITGVNTLWTNSSRQYNGKTIVVPVTCCK------MNKKDELLSHQNWTRIDDYLIDRNCP--YNASSSQINKEGCYDKLNSYIDRYTLAIIVVGILVGMFEIICVVMACSMVQK 288          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:103032697])

HSP 1 Score: 62.003 bits (149), Expect = 8.119e-11
Identity = 56/210 (26.67%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  376 IVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +VLI++G   F I F GCCGA KEN+C++ +++ L+ ++I++E+G  I A V + K    +D  L  ++K   NG     +  + +    +  +LKCCG  +  D+    VN++   D+ +   P  CC                          DC     +   K+  TGC  +L  L+ +N+  V    + +   EI  ++FAC ++
Sbjct:   55 LVLIIVGVVIFFIAFFGCCGAWKENYCMVTMFAILLSLIIIVEIGTAIAAYVFRDKLTGLVDDGLRDMIKQYNNG-----SKEYQEGLDRIQKDLKCCGAANSSDW----VNFKP--DHTSV--PDSCCKNV---------------------TADCGKGAMNDDKKIYVTGCQPALEKLLKENVQWVAVAAIVIAFIEILGLVFACSLM 230          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18b (tetraspanin-18-like [Source:NCBI gene;Acc:103035514])

HSP 1 Score: 61.6178 bits (148), Expect = 1.700e-10
Identity = 64/246 (26.02%), Postives = 110/246 (44.72%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            W+ VD ++  EI+    L  T                 +++ +G   F++GF GCCGA++EN CLL  +   + V+ L E+   I A + +   ++   +  TK L+  + G  + +  + T  + A+M    CCG+   EDF  +  +    + N +QV P  CC +      N++    L  V   F N D   + N      N  GC  S++D     + I   + + +   E+F +IFA C+
Sbjct:   45 WMLVDPTDFREIVAANPLLFTG--------------VYIILAMGGMLFLLGFLGCCGALRENKCLLLFFFMFILVIFLAELATAILAFIFR---EHLTKEYFTKELRKHYQGYNTSD--VLTTTWNAIMKTFDCCGVNSPEDFEESLFH----VLNPSQVVPEACCRK------NSH----LGDVS--FSNKDECLSGNMLYR--NNKGCYSSVVDYFEMYIYIAGALAIVVLTIELFAMIFAMCL 253          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:103032697])

HSP 1 Score: 61.2326 bits (147), Expect = 2.052e-10
Identity = 56/210 (26.67%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  376 IVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVI 1005
            +VLI++G   F I F GCCGA KEN+C++ +++ L+ ++I++E+G  I A V + K    +D  L  ++K   NG     +  + +    +  +LKCCG  +  D+    VN++   D+ +   P  CC                          DC     +   K+  TGC  +L  L+ +N+  V    + +   EI  ++FAC ++
Sbjct:   76 LVLIIVGVVIFFIAFFGCCGAWKENYCMVTMFAILLSLIIIVEIGTAIAAYVFRDKLTGLVDDGLRDMIKQYNNG-----SKEYQEGLDRIQKDLKCCGAANSSDW----VNFKP--DHTSV--PDSCCKNV---------------------TADCGKGAMNDDKKIYVTGCQPALEKLLKENVQWVAVAAIVIAFIEILGLVFACSLM 251          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18a (tetraspanin 18 [Source:NCBI gene;Acc:103047105])

HSP 1 Score: 59.3066 bits (142), Expect = 5.488e-10
Identity = 55/246 (22.36%), Postives = 96/246 (39.02%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            WV VD +   EI+    L  T                 V++ +G   F++GF GCCGAI+EN CLL   S  +                   K +N      TK LK+ + G  S +  +FT  +  +M   +CCG+   +DF+   +  R      +++ P  CC   ++ +                   +C       + K    GC  +++D     + +   + + +   E+F ++FA C+
Sbjct:   33 WVLVDPTGFREIVAANPLLFTG--------------VYVILAMGGMLFLLGFLGCCGAIRENKCLLLFVSTFL-------------------KPENLRLDYFTKELKTYYQG--SNSTDVFTATWNTIMTTFECCGVNSADDFDQQSLFRRLY---PSRLVPEECCQRNDLLM----------------NKEECLKGIMQIRNK----GCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFAMCL 220          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18b (tetraspanin-18-like [Source:NCBI gene;Acc:103035514])

HSP 1 Score: 54.6842 bits (130), Expect = 3.063e-8
Identity = 45/166 (27.11%), Postives = 78/166 (46.99%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCC 762
            W+ VD ++  EI+    L  T                 +++ +G   F++GF GCCGA++EN CLL  +   + V+ L E+   I A + +   ++   +  TK L+  + G  + +  + T  + A+M    CCG+   EDF  +  +    + N +QV P  CC
Sbjct:   33 WMLVDPTDFREIVAANPLLFTG--------------VYIILAMGGMLFLLGFLGCCGALRENKCLLLFFFMFILVIFLAELATAILAFIFR---EHLTKEYFTKELRKHYQGYNTSD--VLTTTWNAIMKTFDCCGVNSPEDFEESLFH----VLNPSQVVPEACC 175          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 56.225 bits (134), Expect = 2.258e-9
Identity = 35/132 (26.52%), Postives = 70/132 (53.03%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCC 762
            +  +V++ +G F F++G  GCC  ++E+ C L  +  L+ ++  +EV   +     +G+ K+ +++ ++++  +E+NG  S  A   ++    V  +LKCCG+K+  D+      W     N +   PI CC
Sbjct:   54 LAPLVVVAVGIFLFVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVF-NEYNGTDSNTA---SRAIDYVQHQLKCCGVKNYLDWKDRP--WFNHTGNNSV--PISCC 177          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009492.1 (pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-1 gene:ENSPMAG00000008573.1 transcript:ENSPMAT00000009492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.823e-7
Identity = 35/133 (26.32%), Postives = 64/133 (48.12%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
            A+ +IV G    +IG  GC  A++E+ C L  ++ L+ ++  +EV       +  GK +  + Q + K     F   M P+    ++    +  EL+CCG  +  D+N+T+  W +   +K    P+ CC  +
Sbjct:   54 ALAIIVAGAVLLLIGVIGCWAAVRESRCALASFALLLLIIFSLEVAAVALGYIYHGKVEVEVQQKMHK----AFQNYMGPDYDPESRAVDYMQKELQCCGFANYSDWNTTE--WARR--HKYNSVPLSCCKRS 178          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000426.1 (pep scaffold:Pmarinus_7.0:GL477652:123953:135969:-1 gene:ENSPMAG00000000383.1 transcript:ENSPMAT00000000426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 4.292e-6
Identity = 36/141 (25.53%), Postives = 62/141 (43.97%), Query Frame = 1
Query:  580 LKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            LK ++ G    N  +F+K +  +M+ LKCCG+   +DF    V        + Q  P  CC        N  +   ++K + F ++PD            N  GC  +++      + +V  V +G+   E+F +IFA C+
Sbjct:   19 LKKQYRG--DNNTDVFSKTWNTIMISLKCCGVSGVDDFGKDSVFHELY---QMQPMPEACCKRQ----MNGQEGHSINKTRCFSQDPDF----------YNKEGCYLTMLKSFQMYVYVVGAVGIGVLAIELFAMIFAICL 140          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLY4])

HSP 1 Score: 53.5286 bits (127), Expect = 2.617e-8
Identity = 36/109 (33.03%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  379 VLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTK 705
            ++I +G    I+ F GC GA KEN C+L  +  L+ +++ +E+   + A   +GK K+ I+  LTK LK ++    S      TK F A+  + KCCG+    D+ ++K
Sbjct:   58 LVIAVGVIIAIVSFFGCLGAWKENRCMLGTFFVLLLILLTLEIAAAVLAYNYRGKVKDEIESDLTKALKGDYG---SSGQDGVTKAFDALQEKQKCCGVNGYLDWKASK 163          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN5])

HSP 1 Score: 53.5286 bits (127), Expect = 2.823e-8
Identity = 65/213 (30.52%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  370 VAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVIS 1008
             A +LI +G    IIGF GCCGA+KE+ CLL  +  ++G++ L+E+G  I   + + + K G+   L   LK        P    F   +  +   LKCCG ++  D+    V W         V P  CC +T+V   N     VL            P T N  Q      GC  + +      L I+ GV +GL +F++  I F+CC+ S
Sbjct:   56 AAYILIGIGFLIAIIGFIGCCGALKEHTCLLKTFGVILGLLFLVELGTAITGYIFRSEIKTGLSDGLDTALKDY------PEQG-FKDAWNDMQKNLKCCGSRNYTDW--FMVAWAGPNTKNGSV-PESCCKDTKVKSCNLE---VLSH----------PETINSEQ------GCYGAAVKYFEDKLVIIGGVALGLAVFQLIGIAFSCCLAS 239          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLT8])

HSP 1 Score: 51.9878 bits (123), Expect = 9.908e-8
Identity = 35/118 (29.66%), Postives = 63/118 (53.39%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSI 726
            A++L + G   F+I F GC GA++EN C+L  YS ++G+++L+E+   +   V  G+ K  +++A+  I+    +    P+      +   +  ELKCCG KD +        W Q++
Sbjct:   55 AVMLAIAGVLMFVISFSGCLGALRENVCMLRFYSIMLGIMLLLEIVAAVLGYVYAGEVKQQVEKAVDHIIVRYRD---DPD---LQNIIDLLQKELKCCGSKDYK-------TWEQNV 159          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE9])

HSP 1 Score: 50.8322 bits (120), Expect = 2.024e-7
Identity = 56/215 (26.05%), Postives = 92/215 (42.79%), Query Frame = 1
Query:  376 IVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKG-KFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQS--IDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISK 1011
            I++I  G    +I F GCCGAIKE+ CLL  +       +L  +     AG   G  +++ ++Q L + + +  +          T  +  +    KCCGI   ED       W+Q+   +  + + P  CC +                     +  DC   +N  Q  +N  GC  +++ L+  NL IV GV VG+ + +I  + FA  +I K
Sbjct:   55 IIVIAAGALIALISFFGCCGAIKESRCLLAAF-----FTLLFIILATEAAGTALGFVYRDKVNQKLRQDMNNTLDSYGQKGKEGITLAYDLIQKMEKCCGINGYED-------WQQTPFANGSSTLVPDSCCKK---------------------ETKDCG--SNFAQDDINTKGCLGTIMKLLKDNLMIVGGVGVGVAVIQILAMTFAMVLICK 234          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO41431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S485])

HSP 1 Score: 47.7506 bits (112), Expect = 2.616e-6
Identity = 35/133 (26.32%), Postives = 63/133 (47.37%), Query Frame = 1
Query:  373 AIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET 771
             ++  V+G   F IGF GC GA++EN C L +Y   V + +++ +  G  A  +K K +  + + L + LK   +  ++ +   F +        LKCCG++  +D+ +       S    +   P  CC E+
Sbjct:   54 VVIFFVIGILMFFIGFFGCVGALRENTCFLTVYGTSVFLCLILLIACGAVAYTQKDKVQ-ALKERLKQDLKKYLDDPLNQDLIDFMQTL------LKCCGVESYKDWQANPYFNCSSPGRMSCGVPFSCCKES 179          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan3b (tetraspanin-3 [Source:NCBI gene;Acc:101165292])

HSP 1 Score: 60.4622 bits (145), Expect = 3.534e-10
Identity = 39/132 (29.55%), Postives = 75/132 (56.82%), Query Frame = 1
Query:  367 IVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCC 762
            I A+V+I +GT  FIIG  GCC  I+E+ C L  ++ ++ +V + E  + +   + + K ++ ++ ++ K+  +E++GI   N+   ++    V  +L CCGI +  D+ +T  +W   I++K    P+ CC
Sbjct:   52 IPAVVIIAVGTLLFIIGLIGCCATIRESSCGLATFAAILLLVFVTECVVVVLGYIYRAKVEDQVNHSIQKV-YNEYSGI---NSDAPSRAIDYVQKQLHCCGIHNYSDWRNT--HWF--IESKNNSVPVSCC 175          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan18b (tetraspanin 18 [Source:NCBI gene;Acc:101168705])

HSP 1 Score: 58.5362 bits (140), Expect = 1.747e-9
Identity = 63/249 (25.30%), Postives = 105/249 (42.17%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCC---AETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCV 1002
            WV VD +   EI+    L  T                 V++ +G   F++GF GCCGAI+EN CLL  +  L+ ++ L E+   I A + +        +  TK LK  + G    N  +FT  + A+M    CCG+   EDF  +    R  + N   V P  CC   ++     Y + D+ +   +   F+N                 GC  +++D     + +   + + +   E+F ++FA C+
Sbjct:   45 WVLVDPTGFREIVAANPLLFTG--------------VYVILGMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILLIFLAELAAAILAFIFREHLTR---EYFTKELKRHYQGY--NNTDVFTSTWNAIMTTFDCCGVNSPEDFKDS----RFRLINPNHVVPEACCLRVSQNGELAYTSRDQCLSGNM--MFRNNK---------------GCYSAVVDYFELYIYVAGALAIVVLTIELFAMVFAMCL 253          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan18b (tetraspanin 18 [Source:NCBI gene;Acc:101168705])

HSP 1 Score: 55.8398 bits (133), Expect = 1.077e-8
Identity = 51/166 (30.72%), Postives = 74/166 (44.58%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCC 762
            WV VD +   EI+    L  T                 V++ +G   F++GF GCCGAI+EN CLL  +  L+ ++ L E+   I A + +        +  TK LK  + G    N  +FT  + A+M    CCG+   EDF  +    R  + N   V P  CC
Sbjct:   45 WVLVDPTGFREIVAANPLLFTG--------------VYVILGMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILLIFLAELAAAILAFIFREHLTR---EYFTKELKRHYQGY--NNTDVFTSTWNAIMTTFDCCGVNSPEDFKDS----RFRLINPNHVVPEACC 187          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan34 (tetraspanin-1 [Source:NCBI gene;Acc:101174246])

HSP 1 Score: 55.4546 bits (132), Expect = 1.534e-8
Identity = 57/183 (31.15%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  178 CCESFSKTXXXXXXXXXXXXXXXXXXXXXWVKVDKSNLFEIMRKV-NLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLY----SFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVN 711
            CC  F K ++ IFN   F+ G   LG+GIW+KVD  +L  ++  + N DG            L  VA VLI +G    IIGF GCCGA+KE+ C+L  +      +  V +   + +  + G+   K  + ++  +   L++EF           T V+ + M + KCCG ++  DF  +  N
Sbjct:    2 CCSGFLKVMMFIFNGGIFLAGAGCLGMGIWLKVDSGSLLGLLEGIENGDGL---------DQLVHVAYVLIGVGAALVIIGFLGCCGAVKESRCMLLTFFCIVLVIFIVEVAGAIVLFAFDGLAD-KILDNVENEVRSKLQTEFG-----RDESLTSVWGSTMEQFKCCGYRNYTDFTGSPFN 169          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:101174188])

HSP 1 Score: 53.5286 bits (127), Expect = 6.800e-8
Identity = 51/209 (24.40%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  370 VAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFAC 996
            + IV+I +G   F I F GCCGA KE++C++  ++ L+ ++I+IE+   I   V + K    +++ LTK++++  NG     AT+       +   LKCCG+    D++         +D+     P  CC                       K   C   +      +   GC   + +L+  N+  VI   + + L +I  ++F+C
Sbjct:   53 IPIVIIAVGALIFFIAFFGCCGAWKEHYCMVTTFAVLLTLIIIIEIAAAIAGFVFRNKISPIVNEGLTKMIENYKNGTDDFKATV-----DQIQENLKCCGVNSSSDWS--------YLDSDGNSVPDSCCIN---------------------KTKGCGKGSMKNAGTVYQKGCHDVIENLLKTNIQWVIVAAIVIALVQILGVVFSC 227          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000078545.1 (SMESG000078545.1)

HSP 1 Score: 426.402 bits (1095), Expect = 4.179e-151
Identity = 278/283 (98.23%), Postives = 278/283 (98.23%), Query Frame = 1
Query:  172 MGCCESFSKTXXXXXXXXXXXXXXXXXXXXXWVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISKKSY 1020
            MGCCESFSKTLLIIFNVLFFILGGVFLGVGIWVKVDKSNLFEIMRKVNLDGTASSFDSSSSSFLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFLVGVVILIEVGIGIYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQ IDNK Q NPIGCCAE EVYVYNTNDKFVLDKVKPFFKNPDCPTTTN TQAKLNPTGCSQSLIDLINKNLGIVIGVCVGLGLFEIFCIIFACCVISKKSY
Sbjct:    1 MGCCESFSKTLLIIFNVLFFILGGVFLGVGIWVKVDKSNLFEIMRKVNLDGTASSFDSSSSSFLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFLVGVVILIEVGIGIYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQIIDNKTQANPIGCCAEKEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNRTQAKLNPTGCSQSLIDLINKNLGIVIGVCVGLGLFEIFCIIFACCVISKKSY 283          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019443.1 (SMESG000019443.1)

HSP 1 Score: 218.779 bits (556), Expect = 2.135e-69
Identity = 149/280 (53.21%), Postives = 203/280 (72.50%), Query Frame = 1
Query:  172 MGCCESFSKTXXXXXXXXXXXXXXXXXXXXXWVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISK 1011
            M  CES +K LLIIFN+ FF++G + LG+GIWVK+DKSNLFE++R + L+ TASSFD+++SS  + +AI LIVLG  TFI GFCGCCGAIKE+ CLL+LYS  V VVI+ ++G+GIYAGV+K K +  ++ +L  +L++EFNGI+SPN ++FTK  TA+M E+KCCGI+++ DF  TK NW+Q+I  + QV+PIGCC   + + +++ +K     +     +P CP T      KLN  GC   LI+ I  NL IVI VCVGLGLFE+ CI+FACCV  +
Sbjct:    1 MSFCESIAKLLLIIFNICFFLIGALILGIGIWVKIDKSNLFEMLRNIKLEETASSFDNTNSSLFDTIAIFLIVLGAITFITGFCGCCGAIKESQCLLFLYSLFVTVVIVGQIGVGIYAGVQKNKVQYYLESSLVSVLENEFNGIISPNPSMFTKALTAIMFEMKCCGIRNENDFKITKQNWKQTIQGQNQVHPIGCCKIKQSFSFDSENKLNYTILSDILVDPLCPVT---KATKLNYEGCISVLIEKIRNNLTIVISVCVGLGLFEMLCIVFACCVARR 277          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000078589.1 (SMESG000078589.1)

HSP 1 Score: 210.69 bits (535), Expect = 2.599e-66
Identity = 151/281 (53.74%), Postives = 197/281 (70.11%), Query Frame = 1
Query:  172 MGCCESFSKTXXXXXXXXXXXXXXXXXXXXXWVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKNXXXXXXXXXXXXXFEIFCIIFACCVISKK 1014
            MG C+SFSK +LIIFNVLFFI+G   LGVGIWVKVDKSNLFEI+RK+ ++G+  SF+++ ++ L+++AIVLIV G FTF+ GFCGCCGAIKEN  LL  YS LV   ++ E+GIGIYAGVE+ KF N +  +L  ++K +FNG  + NAT FTK+FTA+M +L+CCGI D+ DFN T +NW  S   K Q +P+GCC       YN       + ++      +CP  T     +LN  GC  +LI L+ +NLGIVIG+C+GLGLFEIFCI FAC V  +K
Sbjct:    1 MGFCKSFSKIILIIFNVLFFIIGAAILGVGIWVKVDKSNLFEILRKIKIEGSDVSFENTDNTVLDVIAIVLIVFGAFTFVTGFCGCCGAIKENRILLITYSILVAAAVIAEIGIGIYAGVEEKKFVNQLSDSLKNLIKKDFNGAFANNATQFTKIFTAIMFDLQCCGIVDESDFNVTNLNWTIS-SGKLQSHPVGCCKLNNNLKYNAQSNLKYEDIQDKLVTTNCPFETT-VNVELNKDGCINALIKLLKENLGIVIGICIGLGLFEIFCIAFACIVARRK 279          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 209.92 bits (533), Expect = 3.389e-66
Identity = 114/221 (51.58%), Postives = 158/221 (71.49%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKN 927
            WVKVDKSNLFE+MR +NLD TA SF S++SS  +IVAI+LI+LG FTFI GFCGCCGAIKE+ CLL++YSFLV  VI+ +V +GIYA V++ KF+  ++++L KI+  +FNG +S N ++FTKVFTA+M E+KCCG+K + DFN     W+Q+I  + Q++PIGCC     + +N+ +K  L  V+   ++P+C       + KLN  GC  SLID I  +
Sbjct:   32 WVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTIEDPNC---IFEKETKLNQKGCVVSLIDKIKSH 249          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 210.69 bits (535), Expect = 3.878e-63
Identity = 114/221 (51.58%), Postives = 159/221 (71.95%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKN 927
            WVKVDKSNLFE+MR +NLD TA SF S++SS  +IVAI+LI+LG FTFI GFCGCCGAIKE+ CLL++YSFLV  VI+ +V +GIYA V++ KF+  ++++L KI+  +FNG +S N ++FTKVFTA+M E+KCCG+K + DFN     W+Q+I+ + Q++PIGCC     + +N+ +K  L  V+   ++P+C       + KLN  GC  SLID I  +
Sbjct:  345 WVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTMEDPNC---IFEKETKLNQKGCVVSLIDKIKSH 562          

HSP 2 Score: 210.305 bits (534), Expect = 6.026e-63
Identity = 114/221 (51.58%), Postives = 158/221 (71.49%), Query Frame = 1
Query:  265 WVKVDKSNLFEIMRKVNLDGTAXXXXXXXXXXLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFXXXXXXXXXXXXXXYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAETEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLINKN 927
            WVKVDKSNLFE+MR +NLD TA SF S++SS  +IVAI+LI+LG FTFI GFCGCCGAIKE+ CLL++YSFLV  VI+ +V +GIYA V++ KF+  ++++L KI+  +FNG +S N ++FTKVFTA+M E+KCCG+K + DFN     W+Q+I  + Q++PIGCC     + +N+ +K  L  V+   ++P+C       + KLN  GC  SLID I  +
Sbjct:   32 WVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTIEDPNC---IFEKETKLNQKGCVVSLIDKIKSH 249          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPAN31.690e-1233.33tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752][more]
TSPAN31.808e-929.63tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752][more]
CD632.012e-721.50CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
CD635.926e-721.50CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
CD635.926e-721.50CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tsp-174.750e-624.89Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-118.914e-630.00Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-118.914e-630.00Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp39D1.168e-827.85gene:FBgn0032943 transcript:FBtr0273404[more]
Tsp42Ed3.305e-832.74gene:FBgn0029507 transcript:FBtr0345536[more]
Tsp42Ed3.305e-832.74gene:FBgn0029507 transcript:FBtr0086181[more]
Tsp66E1.337e-622.67gene:FBgn0035936 transcript:FBtr0076507[more]
Tsp66E1.337e-622.67gene:FBgn0035936 transcript:FBtr0076506[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan18a1.034e-1124.80tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-2... [more]
tspan18a1.034e-1124.80tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-2... [more]
tspan18a1.034e-1124.80tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-2... [more]
tspan3a9.474e-1024.42tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
tspan3a9.474e-1024.42tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr881.998e-1023.58G protein-coupled receptor 88 [Source:Xenbase;Acc:... [more]
tspan11.168e-828.65tetraspanin 1 [Source:NCBI gene;Acc:548861][more]
ephx21.886e-829.08epoxide hydrolase 2, cytoplasmic [Source:Xenbase;A... [more]
tspan11.892e-828.65tetraspanin 1 [Source:NCBI gene;Acc:548861][more]
wdr742.358e-628.64WD repeat domain 74 [Source:Xenbase;Acc:XB-GENE-96... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspan33.130e-1333.83tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
Tspan33.162e-1333.83tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
Tspan31.161e-1033.64tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
Cd632.648e-824.30CD63 antigen [Source:MGI Symbol;Acc:MGI:99529][more]
Cd632.648e-824.30CD63 antigen [Source:MGI Symbol;Acc:MGI:99529][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QY33|TSN3_MOUSE2.212e-1233.83Tetraspanin-3 OS=Mus musculus OX=10090 GN=Tspan3 P... [more]
sp|Q5RE11|TSN3_PONAB8.118e-1233.33Tetraspanin-3 OS=Pongo abelii OX=9601 GN=TSPAN3 PE... [more]
sp|O60637|TSN3_HUMAN8.118e-1233.33Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE... [more]
sp|Q3SZR9|TSN3_BOVIN8.275e-1233.33Tetraspanin-3 OS=Bos taurus OX=9913 GN=TSPAN3 PE=2... [more]
sp|P28648|CD63_RAT5.793e-925.70CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GUI31.073e-1930.22Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A1I8HQE31.940e-1929.85Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267ERG22.541e-1930.71Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A1I8GD106.448e-1930.71Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267EG051.082e-1827.61Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd638.119e-1126.67CD63 molecule [Source:NCBI gene;Acc:103032697][more]
tspan18b1.700e-1026.02tetraspanin-18-like [Source:NCBI gene;Acc:10303551... [more]
cd632.052e-1026.67CD63 molecule [Source:NCBI gene;Acc:103032697][more]
tspan18a5.488e-1022.36tetraspanin 18 [Source:NCBI gene;Acc:103047105][more]
tspan18b3.063e-827.11tetraspanin-18-like [Source:NCBI gene;Acc:10303551... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tspan3a2.258e-926.52tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
ENSPMAT00000009492.15.823e-726.32pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-... [more]
ENSPMAT00000000426.14.292e-625.53pep scaffold:Pmarinus_7.0:GL477652:123953:135969:-... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352832.617e-833.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308372.823e-830.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352979.908e-829.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475932.024e-726.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414312.616e-626.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan3b3.534e-1029.55tetraspanin-3 [Source:NCBI gene;Acc:101165292][more]
tspan18b1.747e-925.30tetraspanin 18 [Source:NCBI gene;Acc:101168705][more]
tspan18b1.077e-830.72tetraspanin 18 [Source:NCBI gene;Acc:101168705][more]
tspan341.534e-831.15tetraspanin-1 [Source:NCBI gene;Acc:101174246][more]
cd636.800e-824.40CD63 molecule [Source:NCBI gene;Acc:101174188][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078545.14.179e-15198.23SMESG000078545.1[more]
SMESG000019443.12.135e-6953.21SMESG000019443.1[more]
SMESG000078589.12.599e-6653.74SMESG000078589.1[more]
SMESG000019444.13.389e-6651.58SMESG000019444.1[more]
SMESG000019444.13.878e-6351.58SMESG000019444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018899 ID=SMED30018899|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1025bp
AAAAATTAATTTTTTCTCGAAATTAATGAAATTGGATTTCTTGATTATTT
GTAGCTTGTGTTTTAGTAACATTACATCGACAGTGAATGTACTAAAATAA
GCTAACCAATAACATCTGGATGAAAAATACTATAAATTATTGTTGTGCTA
ACTGAGACTTACATTTTTACCATGGGCTGCTGTGAATCATTTTCGAAAAC
ATTATTAATAATTTTCAATGTCTTATTTTTCATCCTTGGAGGAGTTTTTC
TTGGTGTTGGAATATGGGTCAAGGTGGATAAATCGAATTTGTTTGAAATA
ATGAGAAAAGTCAATCTGGATGGTACGGCATCGTCGTTTGATAGTTCAAG
TTCTTCCTTTCTTAACATTGTGGCTATTGTTCTTATTGTTTTGGGTACCT
TCACTTTTATAATAGGATTTTGTGGATGTTGTGGTGCAATCAAAGAAAAT
CATTGCCTCTTATATTTATATTCATTTCTTGTTGGGGTGGTCATATTAAT
AGAAGTAGGAATCGGAATATATGCCGGAGTGGAAAAGGGAAAGTTTAAAA
ATGGTATTGATCAAGCACTGACTAAAATTTTGAAAAGTGAGTTCAATGGA
ATAATGTCTCCAAATGCTACAATCTTCACCAAAGTATTTACCGCTGTGAT
GTTAGAGTTGAAATGTTGTGGAATTAAAGATCAAGAAGATTTTAATAGCA
CAAAAGTGAATTGGCGGCAAAGTATTGACAATAAAGCTCAAGTTAATCCC
ATTGGATGTTGCGCCGAAACGGAGGTATACGTTTATAACACGAATGATAA
GTTTGTATTAGATAAAGTGAAACCCTTTTTTAAAAACCCAGACTGTCCTA
CTACAACAAATCATACACAAGCCAAATTAAATCCAACTGGATGCTCTCAA
TCTTTGATAGATTTGATAAATAAAAATCTGGGAATAGTTATTGGAGTTTG
CGTCGGTTTGGGTTTATTTGAAATATTTTGCATCATTTTCGCCTGTTGCG
TAATTAGCAAAAAGAGTTACTAAAC
back to top

protein sequence of SMED30018899-orf-1

>SMED30018899-orf-1 ID=SMED30018899-orf-1|Name=SMED30018899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MGCCESFSKTLLIIFNVLFFILGGVFLGVGIWVKVDKSNLFEIMRKVNLD
GTASSFDSSSSSFLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLY
SFLVGVVILIEVGIGIYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNAT
IFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQSIDNKAQVNPIGCCAET
EVYVYNTNDKFVLDKVKPFFKNPDCPTTTNHTQAKLNPTGCSQSLIDLIN
KNLGIVIGVCVGLGLFEIFCIIFACCVISKKSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 10..33
score: 39.36
coord: 91..119
score: 30.15
coord: 64..90
score: 37.27
coord: 255..281
score: 24.03
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..283
e-value: 7.6E-42
score: 140.8
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 9..278
e-value: 6.2E-40
score: 137.3
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 9..277
NoneNo IPR availablePANTHERPTHR19282:SF283TETRASPANIN-21coord: 9..277
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 11..33
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 255..277
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 125..253