Enkurin domain-containing protein

Overview
NameEnkurin domain-containing protein
Smed IDSMED30018893
Length (bp)1319
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Enkurin domain-containing protein (SMED30018893) t-SNE clustered cells

Violin plots show distribution of expression levels for Enkurin domain-containing protein (SMED30018893) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Enkurin domain-containing protein (SMED30018893) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Enkurin domain-containing protein (SMED30018893) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018893

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018893SMESG000081414.1 SmedASXL_001517SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018893SMESG000081414.1 dd_Smed_v4_12339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018893SMESG000081414.1 dd_Smed_v4_12339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018893SMESG000081414.1 dd_Smed_v6_12339_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018893SMESG000081414.1 dd_Smed_v4_12339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Enkurin domain-containing protein vs. Ensembl Human
Match: ENKD1 (enkurin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25246])

HSP 1 Score: 119.398 bits (298), Expect = 1.478e-29
Identity = 99/329 (30.09%), Postives = 161/329 (48.94%), Query Frame = 3
Query:  183 LSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGP--IKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTK------KPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            L L G       S +   PKDH  EN++++REIQ+  ++ QE SR+   P  +K+  R+                   Y+   K+   +K+                             + GP +   +  FLRAH + GP  GL    ++        S    P    A+E  L    +DF+R NA AAK +  +   S    V+ Q +E++++ +      + G +P YL++RR+ W+ E +   Q+QPDP  PPGH +M E +RL TL  L  ++  +L EL  LP  +D+L+ ++ + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   79 LQLEGISLGPGASLKRKDPKDHEKENLRRIREIQKRFRE-QERSREQGQPRPLKALWRSPK-----------------YD---KVESRVKA--------------------------QLQEPGPASGTESAHFLRAHSRCGP--GLPPPHVS--------SPQPTPPGPEAKEPGL---GVDFIRHNARAAKRAPRRHSCSLQ--VLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. Ensembl Fly
Match: CG11125 (gene:FBgn0033174 transcript:FBtr0336911)

HSP 1 Score: 68.5514 bits (166), Expect = 2.868e-12
Identity = 68/246 (27.64%), Postives = 117/246 (47.56%), Query Frame = 3
Query:  459 NNNTSHRRAQSAG---PSIVTKLQIDDFNDSGPLTVGSNKTFLRAH---EKTGPPLGLNAYPL----------TPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL--VINQNVEKEKKTKKPGEI--PSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFV 1136
            +++T   R QS G    S    +Q +D  D   LT    K    A    E++G   G N  P+           P+    N SK S    S    + +   +     A+   A  S   R+++A ++  + +++  +E K     E+  P YL K++ +    +QL      DP+ P GH  +S+++RL+ L   K   + ++ EL  +P+ + TL++R +K EI+++L  +EE I+I+SK KVFV
Sbjct:  137 SSDTDIDRCQSCGTNRSSTSIAIQTEDITDELYLTNALKKCNFDARSILEESGAKYGENYKPMQYENEEDLEQLPLSARSNSSKQSRFNMSEMEAMPMTEAEPANYGASDDEAPLSARSRFTTASNVTTISSKSKRREHKLGSRDEVRLPRYLEKQKREKAVAKQL--AESLDPDCPRGHVLLSDQDRLTHLTNAKKRYEQLVNELNHMPMTAQTLRVRNRKAEIDKELTTVEEDIRIYSKAKVFV 380          
BLAST of Enkurin domain-containing protein vs. Ensembl Fly
Match: CG11125 (gene:FBgn0033174 transcript:FBtr0088974)

HSP 1 Score: 68.5514 bits (166), Expect = 2.868e-12
Identity = 68/246 (27.64%), Postives = 117/246 (47.56%), Query Frame = 3
Query:  459 NNNTSHRRAQSAG---PSIVTKLQIDDFNDSGPLTVGSNKTFLRAH---EKTGPPLGLNAYPL----------TPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL--VINQNVEKEKKTKKPGEI--PSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFV 1136
            +++T   R QS G    S    +Q +D  D   LT    K    A    E++G   G N  P+           P+    N SK S    S    + +   +     A+   A  S   R+++A ++  + +++  +E K     E+  P YL K++ +    +QL      DP+ P GH  +S+++RL+ L   K   + ++ EL  +P+ + TL++R +K EI+++L  +EE I+I+SK KVFV
Sbjct:  137 SSDTDIDRCQSCGTNRSSTSIAIQTEDITDELYLTNALKKCNFDARSILEESGAKYGENYKPMQYENEEDLEQLPLSARSNSSKQSRFNMSEMEAMPMTEAEPANYGASDDEAPLSARSRFTTASNVTTISSKSKRREHKLGSRDEVRLPRYLEKQKREKAVAKQL--AESLDPDCPRGHVLLSDQDRLTHLTNAKKRYEQLVNELNHMPMTAQTLRVRNRKAEIDKELTTVEEDIRIYSKAKVFV 380          
BLAST of Enkurin domain-containing protein vs. Ensembl Zebrafish
Match: ENKD1 (si:ch211-220d9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-180])

HSP 1 Score: 122.094 bits (305), Expect = 1.171e-30
Identity = 90/302 (29.80%), Postives = 149/302 (49.34%), Query Frame = 3
Query:  240 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            +D   ENV+K+RE+QR  ++  E  R+H  P+      ++   +P      + QDV      +L ET                                   PL     + FL+AH   G   G       P+ R  +    +     +  E+ +    +DFV  NA AA  + ++R  S  +L      +K       G++P YL +R+ QW++EE+   +N PDP  P GH +MSE+ER  TL  LK T + +++EL  LP+++DTL +R+++ +++Q+L+E+EEAIKIFS+ KV+V+++
Sbjct:  109 RDFGKENVRKLREVQRRFRE-LEAQREHAKPVP----VKALWISP------KYQDVPSRVMAQLQET----------------------------------SPLKKPEYQNFLKAHSVCG--AGGR-----PVLRRSDSGPTAA--GDSDSEMHVRGHTVDFVSHNARAAAKTSMRRSQSLQNLQ-----DKTPACAVKGKVPPYLEQRKAQWRKEEEEKKRNTPDPSVPAGHTQMSERERQETLHSLKETHRSLVSELLSLPVKADTLSIRSRRADLDQRLSEVEEAIKIFSRDKVYVKVD 351          
BLAST of Enkurin domain-containing protein vs. Ensembl Xenopus
Match: ENKD1 (enkurin domain containing 1 [Source:NCBI gene;Acc:496799])

HSP 1 Score: 108.997 bits (271), Expect = 1.051e-25
Identity = 95/324 (29.32%), Postives = 157/324 (48.46%), Query Frame = 3
Query:  183 LSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQ-RQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL--VINQ--NVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1139
            L L G     S   ++ S KDH+ ENVK+MREIQR  ++  QE+ +    P+K+  +++  ++    K   ++Q+    S  K +  +K+Y                           +  G       +TF              + P TP   +  E+K         +E+++    IDFV  NA  AK ++L+   S  +L  V+ Q    ++E  +K+ G IP YL+  +  W + ++   +N PD   PPGH  M E E+  TL  LK  ++ ++ EL  LP+ SDTL ++ ++ E+E+K+ E+EEAIKIFS+ KVF++
Sbjct:   89 LQLEGISLHPSLPTKSKS-KDHVKENVKRMREIQRKCREIEQENGKGTPKPVKALWKSQKYVNVES-KVKTKLQENPSPSEPKFSNFLKAY---------------------------SGCGSGMQPMRRTF--------------SVPGTPSNIDEQENK--------NKEIKVNGSGIDFVTHNAKNAKRAQLRPSRSLHNLNNVLEQKKQEQEEYDSKQKGYIPQYLLDYKEMWLKMKEESKKNTPDFSTPPGHTLMPEAEKHETLNNLKQNQEKLVKELQMLPLGSDTLSIQKRRTELEKKMVEVEEAIKIFSRTKVFIK 361          
BLAST of Enkurin domain-containing protein vs. Ensembl Mouse
Match: Enkd1 (enkurin domain containing 1 [Source:MGI Symbol;Acc:MGI:2142593])

HSP 1 Score: 116.316 bits (290), Expect = 1.202e-28
Identity = 99/326 (30.37%), Postives = 155/326 (47.55%), Query Frame = 3
Query:  192 FGKGYFGS-FSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHR--GPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKK-----TKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
             G    GS  S +  +PKDH  EN+++++EIQR   Q QE SR+     P+K+  R+                                 P  +N   R           K ++ +    GP +V     FLRAH + GP L        P R    +  +  P+A            +DF+  NA AAK +  +   S   L   Q  +++ +     T+K G +P YL++RR+ W++E +   ++QPDP  PPGH  M E +RL TL  L  ++  +L EL  LP  +D+L+ +  + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   81 LGCISLGSGVSPKRKNPKDHEKENLRRIKEIQRRF-QDQERSREQGQPKPLKALWRS---------------------------------PKYDNVESR----------VKARMKEL---GPTSVTEPAHFLRAHSRCGPGL-------PPSRASSPQLALPGPQAKGPG------LGVDFISRNALAAKRAPRRHSRSLQVLAQVQEQQRQAQERYNATQK-GHVPHYLLERRDLWRKEAEARQRSQPDPSMPPGHTLMPENQRLETLNNLLQSQSQLLRELVLLPAGADSLRAQGHRAELDRKLVQIEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H0I2|ENKD1_HUMAN (Enkurin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ENKD1 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 7.099e-29
Identity = 99/329 (30.09%), Postives = 161/329 (48.94%), Query Frame = 3
Query:  183 LSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGP--IKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTK------KPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            L L G       S +   PKDH  EN++++REIQ+  ++ QE SR+   P  +K+  R+                   Y+   K+   +K+                             + GP +   +  FLRAH + GP  GL    ++        S    P    A+E  L    +DF+R NA AAK +  +   S    V+ Q +E++++ +      + G +P YL++RR+ W+ E +   Q+QPDP  PPGH +M E +RL TL  L  ++  +L EL  LP  +D+L+ ++ + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   79 LQLEGISLGPGASLKRKDPKDHEKENLRRIREIQKRFRE-QERSREQGQPRPLKALWRSPK-----------------YD---KVESRVKA--------------------------QLQEPGPASGTESAHFLRAHSRCGP--GLPPPHVS--------SPQPTPPGPEAKEPGL---GVDFIRHNARAAKRAPRRHSCSLQ--VLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TSV9|ENKD1_MOUSE (Enkurin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Enkd1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 8.405e-28
Identity = 99/326 (30.37%), Postives = 155/326 (47.55%), Query Frame = 3
Query:  192 FGKGYFGS-FSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHR--GPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKK-----TKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
             G    GS  S +  +PKDH  EN+++++EIQR   Q QE SR+     P+K+  R+                                 P  +N   R           K ++ +    GP +V     FLRAH + GP L        P R    +  +  P+A            +DF+  NA AAK +  +   S   L   Q  +++ +     T+K G +P YL++RR+ W++E +   ++QPDP  PPGH  M E +RL TL  L  ++  +L EL  LP  +D+L+ +  + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   81 LGCISLGSGVSPKRKNPKDHEKENLRRIKEIQRRF-QDQERSREQGQPKPLKALWRS---------------------------------PKYDNVESR----------VKARMKEL---GPTSVTEPAHFLRAHSRCGPGL-------PPSRASSPQLALPGPQAKGPG------LGVDFISRNALAAKRAPRRHSRSLQVLAQVQEQQRQAQERYNATQK-GHVPHYLLERRDLWRKEAEARQRSQPDPSMPPGHTLMPENQRLETLNNLLQSQSQLLRELVLLPAGADSLRAQGHRAELDRKLVQIEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3T078|ENKD1_BOVIN (Enkurin domain-containing protein 1 OS=Bos taurus OX=9913 GN=ENKD1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 7.665e-25
Identity = 98/330 (29.70%), Postives = 160/330 (48.48%), Query Frame = 3
Query:  183 LSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSR---QHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKK------TKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            L L G       S +   PKDH  EN++++REIQR  ++ QE SR   Q R P+K+  R+                   Y+   K+   +K+                             + GP +      FLRAH + GP L        P R  V   ++++P  S     +     +DF+  NA  AK +  +R+S +  ++     ++++       T+K G +P YL++RR+ W+ E +    +QPDP  PPGH +M E +RL TL  L  ++  +L EL  LP  +D+L+ ++ + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   81 LQLGGISLGPGASPKRKDPKDHEKENMRRIREIQRRFRE-QEHSREQGQSR-PLKALWRSPK-----------------YD---KVESRVKA--------------------------QLQEPGPASGTEPAHFLRAHSRCGPGL-------PPPR--VPSPQLTLPGPS----AKAPGPGVDFITHNARTAKRA-PRRHSRSLQVLAQVLEQQQQAQEHYNATQK-GHVPQYLLERRDLWRREAEARQHSQPDPAMPPGHTRMPENQRLETLSSLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD 347          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A2C9KT92 (Enkurin domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106066369 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 6.065e-50
Identity = 117/319 (36.68%), Postives = 178/319 (55.80%), Query Frame = 3
Query:  219 SNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTE--SCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKP-------GEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEG 1148
            SN     K+ + ENV+++REIQR+ K+RQE+ ++   P+K   ++E  SC+ +  +      QD+         + + S P++ N                                   FLRAH + GPP+ L + P+TP   ++  +K SVP ASTA+ V LIR + DF++ N   AK + L R  S  +L      +  KK ++        GE+PSYL KR+ +W+ EE   I N PDP  PPGHR++ E ER  TLELL A  KD++T++ +LPI +DT++++ ++Q +E++L E+EEAIKIFS+PKVFVR+E 
Sbjct:    3 SNFDFKTKNQLNENVRRLREIQRNFKKRQEEKQE---PVKVLWKSEKYSCVESKIK------QDIE--------KPVSSRPSSAN-----------------------------------FLRAHSRAGPPVKLESRPVTP---DIT-NKTSVPPASTAQNVTLIRHNWDFIKVNGINAKKASLNRPHSLTAL------DDSKKRQEDLLNNYHFGEVPSYLQKRKQEWRHEEDQRIANTPDPSMPPGHRQLPENERKETLELLLAKLKDVVTQIQKLPIGTDTIRVKQQRQSLEKQLTEVEEAIKIFSRPKVFVRVES 259          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: R7UKA9 (Enkurin domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_166725 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.781e-49
Identity = 125/384 (32.55%), Postives = 199/384 (51.82%), Query Frame = 3
Query:   66 VSHVSGPIASHHIYEQNDDIYYEKKPQNKVSKLKTESTQLSLFGKGYFG-------------SFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESK--------ISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKR---YSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            VS ++GPI  H  +++ D   Y       ++ ++ E+  ++  G+G  G             S S       DH+ +NV++MR+IQ+ ++ +QE++++   P+K+  ++                                     N S R        ++  ++ D  N   P    S+  FLRAH ++G          TP  R  ++S          SVP+A++ARE++L+R DIDF++AN  A +   + R    S+ D L   Q+  +    +  G++P YL  R+ QWKEEE   I + PDPE P GHRKM + ER  TL+ L+ T+K++LT+LG LPIR+DTL +R +K+EIE KL+E+EEAIKIFS+PKVFV+++
Sbjct:   21 VSTLNGPIPPHPYFDKGDVRAY-------LNLVRPEAQDIAQKGQGSVGNLMTLQIEGTRVPSASKSKPQSADHLKDNVRRMRQIQKDARHKQEETKK---PVKALWKSS---------------------------------KYENVSSR--------VMEAIETDSCNAPRP----SSANFLRAHSRSG---------WTPNSRRGSQSAREMASDRPPSVPRATSAREIKLVRNDIDFIKANGKAVRAFSIPRSPSLSALDDLKHKQSSAEVNYQR--GKVPKYLESRKKQWKEEEAERIASIPDPEMPVGHRKMEDHERKDTLQKLRQTQKELLTQLGHLPIRTDTLTVRKRKEEIETKLSEIEEAIKIFSRPKVFVKLD 338          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A2T7PXT7 (Enkurin domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00829 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.564e-48
Identity = 110/303 (36.30%), Postives = 167/303 (55.12%), Query Frame = 3
Query:  240 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL-VINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            K+H+ ENV++MR+IQ+  KQ++ +++Q   P+K   ++                D      +++ E ++  P        R  SA                         TFLRAH ++GP + L + P TP   +    K+SVP AS+A +V+LIR + DF++ N  +AK S+++R  S  +L  + +  +      + GE+P YL  R+ QWK  E+  I N PDP  PPGHR + E ER  TL+LLK  E+++L EL  LPI  DT ++R K++EIE KL ELEEA+KIF++PKVFVR++
Sbjct:    2 KNHLSENVRRMRQIQKQCKQKERETQQ---PVKVLWKS----------------DKYSGVQSRIKEELEKPPLPP-----RPHSA-------------------------TFLRAHSRSGPIVKLESRPCTPDFTD----KLSVPPASSANDVKLIRHNFDFIKVNGCSAKHSKIQRPPSLTALDELRKKDDDRMADYEFGEVPKYLKHRKEQWKRNEEERIANTPDPSMPPGHRALPENERRETLDLLKKREQELLKELASLPIGVDTARVRNKRKEIEGKLAELEEAVKIFARPKVFVRVD 251          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A0B7A794 (Enkurin domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF97401 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.117e-47
Identity = 108/303 (35.64%), Postives = 175/303 (57.76%), Query Frame = 3
Query:  240 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKP-GEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            K+ ++ENV++MREIQR  KQR+ + ++             C+             V + S        + Y N               + +K++ D  N   P    S   FLRAH + GPP+ L + P +P   ++++ K++VP AS+A +V+LIR + DF++ N   AK + L+R  SA +L  ++  + E  ++   GEIP YL +R+ QW+++E+  I N PDP  P GHR++ E ER  TL+LLK  + D++ ++ RLPI +DT++++ ++Q +E++L E+EEAIKIFS+PKVFVRI+
Sbjct:   10 KNQLIENVRRMREIQRRCKQREAEGQE-------------CVK------------VLWKS--------QKYSN---------------VESKIKQDAQNPEAPRPRSSQ--FLRAHSRAGPPVKLQSRPCSP---DISD-KMTVPPASSAGDVKLIRNNFDFIKVNGINAKRTTLQRPLSASALDNHKKRQDELLSQHHIGEIPGYLNQRKKQWQKDEEHRIVNTPDPTMPVGHRQLPENERRETLDLLKKKQDDVIGQIQRLPIGADTVRVKLQRQSMEKQLTEIEEAIKIFSRPKVFVRID 258          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A1S3ILG6 (enkurin domain-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106165400 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.569e-47
Identity = 122/365 (33.42%), Postives = 200/365 (54.79%), Query Frame = 3
Query:  117 DDIYYEKKPQNKVSK----LKTESTQ-------------LSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPL--TPIRREVNE--SKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLV-INQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            D +Y +++P++ VS+    +K E++              L + GK    S   +   PKDH  ENVK+MR+IQR S+++++++ Q   P+K+  ++E            + +DV     +K+ E ++  P                              P     +  FLR+H + G    ++  P   +P+R +  E   K  +P+ S+A +  L R + DF+R N + AK S++KR  S  +L  + +  E+E +  + G++P YL  R+ QWK+E +  I+N+PDP+ PPGH+ M ++ERL TL  LK T+ ++L +L  LPIRSDTL++RTKK+E+E K+ E+EEAIKIFS+PKVFV+I+
Sbjct:   13 DPMYDDRRPESYVSRPVPRVKPEASHIATAQQGGSIGFMLGITGKAVGPSKWKKNDPPKDHFSENVKRMRQIQRKSRKKEQEAAQPPTPVKALWKSE------------KFKDV----QSKVVEELEKEP------------------------------PAPRPHSANFLRSHSRCG---AISKEPRAPSPVRCQAPEHRGKSPIPRPSSAADT-LKRNNFDFIRINGHNAKYSQMKRAPSLTALDDLKKKKEEELQQYERGKVPKYLQDRKQQWKKEIEDRIKNRPDPDLPPGHKLMPKEERLVTLGQLKETQAELLRQLNSLPIRSDTLRVRTKKEELETKMAEVEEAIKIFSRPKVFVKID 327          
BLAST of Enkurin domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:103033941])

HSP 1 Score: 118.627 bits (296), Expect = 1.708e-29
Identity = 107/380 (28.16%), Postives = 167/380 (43.95%), Query Frame = 3
Query:   69 SHVSGPIASHHIYEQNDDIY--YEKKPQNKVSKLKTESTQLSLFGKG--------YFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTES-CISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTV------------GSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1139
            S +SGPI        +  ++  Y ++P +   +L+  S   SL   G        + G +S R   P   I  N K + E            R  +G + +  + E  C+  P  K     QD    +  +L E  + +        R    A P  V  L         P  V               + FLRAH   G   G    P  P     + S+      +   E+++    +DFV  NA AA+ + LKR  S   L   Q     K     G +P YL +R+ QW+ E +   +N PDP  P GH +MS++ER  TL  L+   + +++EL  LP+R+DT+ +R+++ E++Q+L+E+EEAIKIFS+ KV+V+
Sbjct:    6 SMISGPIPP------DPSLFPEYYRRPTSARGRLEGNSKSGSLTLNGPLAPDPALHPGCYSARPAHPPPRIGPNAKHILE------------RSQKGEVGALLKLEGVCLKPPPVKHKPAAQDYGKENVRRLREIQRRFREQEAQKER----AKPVPVKALWSSPKYQDIPSRVMAQLQEKSHPKKAECQNFLRAHSVCG--AGGRPQPSRPQSVSASPSENGQKPQTADPEMEVRGHFVDFVSHNARAARKTALKRSQSLQDLNNKQPPSAVK-----GRVPQYLEERKEQWRREAEERRRNAPDPSAPAGHTQMSDRERRETLNSLRENHRSLVSELLSLPVRADTVSVRSRRAELDQRLSEVEEAIKIFSRDKVYVK 356          
BLAST of Enkurin domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:103033941])

HSP 1 Score: 118.242 bits (295), Expect = 3.132e-29
Identity = 90/300 (30.00%), Postives = 148/300 (49.33%), Query Frame = 3
Query:  240 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1139
            +D+  ENV+++REIQR  ++ QE  ++   P+      ++  S+P      + QD+      +L E  KS+P                                     + FLRAH   G   G    P  P     + S+      +   E+++    +DFV  NA AA+ + LKR  S   L       K+  +   G +P YL +R+ QW+ E +   +N PDP  P GH +MS++ER  TL  L+   + +++EL  LP+R+DT+ +R+++ E++Q+L+E+EEAIKIFS+ KV+V+
Sbjct:  115 QDYGKENVRRLREIQRRFRE-QEAQKERAKPVP----VKALWSSP------KYQDIPSRVMAQLQE--KSHPKKAEC--------------------------------QNFLRAHSVCG--AGGRPQPSRPQSVSASPSENGQKPQTADPEMEVRGHFVDFVSHNARAARKTALKRSQSLQDLN-----NKQPPSAVKGRVPQYLEERKEQWRREAEERRRNAPDPSAPAGHTQMSDRERRETLNSLRENHRSLVSELLSLPVRADTVSVRSRRAELDQRLSEVEEAIKIFSRDKVYVK 362          
BLAST of Enkurin domain-containing protein vs. Ensembl Nematostella
Match: EDO36286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ21])

HSP 1 Score: 140.584 bits (353), Expect = 4.135e-38
Identity = 109/350 (31.14%), Postives = 178/350 (50.86%), Query Frame = 3
Query:  159 KLKTESTQLSLFGKGYFGSFSNRT------------VSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPL---GLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEK------KTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            ++K E+   ++ G+G      N T              PK+   ENV  +++IQ+++K++Q+D      PIK+  +                 D   +  +K+ + +K+ P                              P    ++ T+LRAH + GPP+     +  P+ P      E K++VPKA  A+E Q +R++ + V  NA  A +  L R S + ++ + +  +K+K      +TK  G +P YL  R+ QWK+EE+  I N PDP  PPGH  M   ERL TL+ L+  ++++L EL  LP+R DTL++RT+K E+E++L E+E AIKIFS+PKVFV+++
Sbjct:   36 RVKPEAITNAIKGQGSLSQLFNPTSKPYNILSRPGSAQPKNFTKENVNHIKKIQKANKEKQKDLSVVGEPIKAVYKP----------------DKFEHVESKVAKEVKAPP------------------------------PPPRSNSATYLRAHSRNGPPVKDRPSSTEPVIP-----KEQKLTVPKADIAKERQPVRKERNHVAMNARRAASPGLYRRSPS-AMALEELKQKKKAEEELYRTKSYGNVPKYLKTRQQQWKKEEETRIANIPDPSIPPGHTLMQRDERLKTLDALQKNQEELLNELRLLPVRVDTLRVRTRKTELERRLTEIENAIKIFSRPKVFVKLD 333          
BLAST of Enkurin domain-containing protein vs. Ensembl Medaka
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:101155774])

HSP 1 Score: 105.916 bits (263), Expect = 5.303e-25
Identity = 55/143 (38.46%), Postives = 90/143 (62.94%), Query Frame = 3
Query:  717 IDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            I+F+R NA AA  +  +R  S   L      +K   +   G++P YL +R+ QW++EE+   +N PDP  PPGH  M + ER  TL+ LK T + ++ EL  LP+++D L  R+++  ++ +L+E+EEAIKIFS+ KV+++ +
Sbjct:  213 INFIRHNARAAGKTVTRRSQSLTDLR-----DKPVPSAVKGQVPQYLEERKAQWRKEEEERKRNTPDPTIPPGHTLMQDSERQETLKSLKDTHRTLVMELNSLPLKADNLSTRSRRAHLDCRLSEIEEAIKIFSRDKVYIKTD 350          
BLAST of Enkurin domain-containing protein vs. Ensembl Medaka
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:101155774])

HSP 1 Score: 105.145 bits (261), Expect = 1.268e-24
Identity = 55/143 (38.46%), Postives = 90/143 (62.94%), Query Frame = 3
Query:  717 IDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1145
            I+F+R NA AA  +  +R  S   L      +K   +   G++P YL +R+ QW++EE+   +N PDP  PPGH  M + ER  TL+ LK T + ++ EL  LP+++D L  R+++  ++ +L+E+EEAIKIFS+ KV+++ +
Sbjct:  233 INFIRHNARAAGKTVTRRSQSLTDLR-----DKPVPSAVKGQVPQYLEERKAQWRKEEEERKRNTPDPTIPPGHTLMQDSERQETLKSLKDTHRTLVMELNSLPLKADNLSTRSRRAHLDCRLSEIEEAIKIFSRDKVYIKTD 370          
BLAST of Enkurin domain-containing protein vs. Planmine SMEST
Match: SMESG000081414.1 (SMESG000081414.1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 366/368 (99.46%), Postives = 367/368 (99.73%), Query Frame = 3
Query:   51 MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNKVSKLKTESTQLSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS 1154
            MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNKVSKLKTESTQLSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESC+STPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDS PLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS
Sbjct:    1 MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNKVSKLKTESTQLSLFGKGYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCMSTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSCPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS 368          
BLAST of Enkurin domain-containing protein vs. Planmine SMEST
Match: SMESG000020205.1 (SMESG000020205.1)

HSP 1 Score: 102.064 bits (253), Expect = 7.633e-24
Identity = 67/195 (34.36%), Postives = 116/195 (59.49%), Query Frame = 3
Query:  564 NKTFLRAHEKTGPPLGLNAYP-LTPIRREVNES-KISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQL-FIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1139
            N+TFL+AHE +GPPL  N YP +  I  + +E  ++SVP   +A EV+  RR I+++RANAYA ++ R ++ S   S V  + ++      + GE+P YL   +N+ +E+    F+ ++         R ++  E+   LE LK   + +  EL  LPI  +T++ RT+K ++E++L+E+ + I I++KP V+V+
Sbjct:  147 NRTFLKAHENSGPPLDTNKYPTIQKINLKNSEKVRVSVPTGKSAIEVKFQRRQINYIRANAYALQSERYRKISK--SAVSTRQIDMS--NYRNGEVPKYLKTFKNKSEEKASRNFVVSK--------ERTLTGLEKQIILEKLKIDLERVYGELNSLPISMETIRSRTRKDQLEKQLDEINKCIDIYNKPNVYVK 329          
The following BLAST results are available for this feature:
BLAST of Enkurin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKD11.478e-2930.09enkurin domain containing 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG111252.868e-1227.64gene:FBgn0033174 transcript:FBtr0336911[more]
CG111252.868e-1227.64gene:FBgn0033174 transcript:FBtr0088974[more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKD11.171e-3029.80si:ch211-220d9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKD11.051e-2529.32enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Enkd11.202e-2830.37enkurin domain containing 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9H0I2|ENKD1_HUMAN7.099e-2930.09Enkurin domain-containing protein 1 OS=Homo sapien... [more]
sp|Q7TSV9|ENKD1_MOUSE8.405e-2830.37Enkurin domain-containing protein 1 OS=Mus musculu... [more]
sp|Q3T078|ENKD1_BOVIN7.665e-2529.70Enkurin domain-containing protein 1 OS=Bos taurus ... [more]
back to top
BLAST of Enkurin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KT926.065e-5036.68Enkurin domain-containing protein OS=Biomphalaria ... [more]
R7UKA91.781e-4932.55Enkurin domain-containing protein OS=Capitella tel... [more]
A0A2T7PXT78.564e-4836.30Enkurin domain-containing protein OS=Pomacea canal... [more]
A0A0B7A7941.117e-4735.64Enkurin domain-containing protein OS=Arion vulgari... [more]
A0A1S3ILG62.569e-4733.42enkurin domain-containing protein 1-like OS=Lingul... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-220d9.31.708e-2928.16enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
si:ch211-220d9.33.132e-2930.00enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362864.135e-3831.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-220d9.35.303e-2538.46enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
si:ch211-220d9.31.268e-2438.46enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000081414.10.000e+099.46SMESG000081414.1[more]
SMESG000020205.17.633e-2434.36SMESG000020205.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018893 ID=SMED30018893|Name=Enkurin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1319bp
GTAATTACAGAGTTTAGTAATACGAAAGTTACAAATAAATTTCGTTTAGA
ATGGCTACGAGTTGGGTTTCTCATGTATCTGGACCAATTGCTAGTCATCA
TATATATGAACAAAATGATGACATTTATTATGAAAAGAAACCTCAAAATA
AAGTGAGTAAATTAAAAACAGAAAGCACACAATTAAGTCTTTTTGGTAAA
GGATATTTTGGTTCTTTCAGTAACAGAACAGTGTCACCAAAAGATCACAT
TGTGGAAAATGTCAAGAAAATGCGTGAAATTCAAAGGTCTAGCAAGCAAC
GACAAGAAGATAGCAGGCAACATAGAGGTCCTATTAAATCTACTAGTCGA
ACTGAGTCGTGTATTAGTACACCAGGGCGGAAATCCGATAATCAAGTTCA
AGATGTTTCATATAATTCAAACACCAAACTGAATGAGACAATCAAATCAT
ATCCAAATAATAATAATACCAGTCATCGTCGTGCTCAATCTGCTGGCCCA
AGTATTGTCACAAAATTGCAAATTGATGATTTCAATGATTCTGGTCCTTT
GACTGTTGGCAGCAATAAAACGTTTCTTCGAGCTCATGAGAAAACTGGCC
CACCATTGGGTCTTAATGCCTATCCATTAACACCTATTCGTAGAGAAGTT
AATGAATCCAAAATCAGTGTACCAAAAGCTTCAACTGCCAGAGAAGTCCA
GCTTATTAGACGTGATATTGATTTTGTTCGAGCAAATGCTTATGCTGCTA
AAACGTCGAGGCTGAAAAGGTATTCTAGCGCTGATAGTTTAGTGATCAAT
CAAAATGTGGAAAAAGAGAAAAAAACTAAGAAACCAGGAGAAATTCCTTC
ATACCTTATTAAAAGGCGTAATCAATGGAAAGAAGAAGAACAGCTATTTA
TTCAAAACCAGCCAGATCCTGAACAACCACCTGGTCATCGAAAAATGTCA
GAAAAAGAAAGATTATCTACTCTGGAGTTACTTAAAGCTACTGAAAAAGA
CATGTTAACTGAGCTTGGGCGACTTCCCATTCGTTCTGATACGCTTAAAT
TACGTACTAAGAAGCAAGAAATCGAACAAAAACTTAACGAATTAGAAGAG
GCCATAAAGATATTTTCAAAACCTAAGGTATTCGTGCGTATTGAAGGTTC
AAGCTGAAATATTGTTACGCTTTTCATTAAGTCATGATTCAGTACTTTTT
TATTAGTTATATGTACATAATGATGACAATGAAGATTTCTTTCTATTTGA
TCTAGCACTATTTTGTCTATTAATATTATATACAATGTGATAAAACATTT
TCATCAAATATAAAGTTAC
back to top

protein sequence of SMED30018893-orf-1

>SMED30018893-orf-1 ID=SMED30018893-orf-1|Name=SMED30018893-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNKVSKLKTESTQLSLFGK
GYFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSR
TESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGP
SIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREV
NESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVIN
QNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMS
EKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEE
AIKIFSKPKVFVRIEGSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027710ENKD1
IPR027012Enkurin_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005881cytoplasmic microtubule
GO:0015630microtubule cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 331..354
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..118
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 76..118
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 76..96
NoneNo IPR availablePANTHERPTHR21490UNCHARACTERIZEDcoord: 57..364
IPR027012Enkurin domainPFAMPF13864Enkurincoord: 263..358
e-value: 3.8E-24
score: 85.0
IPR027012Enkurin domainPROSITEPS51665ENKURINcoord: 271..363
score: 23.136
IPR027710Enkurin domain-containing protein 1PANTHERPTHR21490:SF2ENKURIN DOMAIN-CONTAINING PROTEIN 1coord: 57..364