Tetratricopeptide repeat protein 36 homolog

Overview
NameTetratricopeptide repeat protein 36 homolog
Smed IDSMED30018892
Length (bp)717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat protein 36 homolog (SMED30018892) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 36 homolog (SMED30018892) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat protein 36 homolog (SMED30018892) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 36 homolog (SMED30018892) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018892

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30018892h1SMcG0004815 SmedASXL_017082SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig27319uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig27319newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig26962uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig26962newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig34027uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig34027newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig34026newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018892h1SMcG0004815 Contig34026uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30018892h1SMcG0004815 dd_Smed_v4_1962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018892h1SMcG0004815 dd_Smed_v4_1962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018892h1SMcG0004815 dd_Smed_v4_1962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30018892h1SMcG0004815 dd_Smed_v6_1962_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018892h1SMcG0004815 dd_Smed_v6_1962_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Human
Match: TTC36 (tetratricopeptide repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:33708])

HSP 1 Score: 118.242 bits (295), Expect = 1.496e-32
Identity = 56/129 (43.41%), Postives = 84/129 (65.12%), Query Frame = 3
Query:  198 EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            E++ +  AE      +L+  G+ I L P  ASA+NNRAQ  +L      A+ DL++A+ELSGG G+   Q+  QRG++ +  G D  A  D+ERA++LG  FARR +++ NPYAALCN+ML+ M+ ++R
Sbjct:   55 ELQGVMAAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGRAARQSFVQRGLLARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLR 183          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Celegans
Match: ttc-36 (Tetratricopeptide repeat protein 36 [Source:UniProtKB/Swiss-Prot;Acc:Q20683])

HSP 1 Score: 107.071 bits (266), Expect = 9.709e-29
Identity = 61/175 (34.86%), Postives = 101/175 (57.71%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGEDLRDFDDETI-----ETTNGESPDPDIVKQ-EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            TSHD+ +L +I N   L    D  I     E+ + E P  ++  Q E E + LAE  + D++++   K + + P   SA+NNRAQ ++L  + + A++DL++A+ L+G   K   QA  QR  IY+  G D  A  D+  A++LG  FA+  ++  NPYAA+CN+ML+++  + +
Sbjct:    3 TSHDRAVLNQILN--PLMPTSDSGIAEIHLESDSLEHPGYELSLQLEREGVALAEGVRLDEAIEKFTKALEVCPKNPSAYNNRAQAYRLQNKPEKALDDLNEALSLAGPKTKTACQAYVQRASIYRLRGDDDKARTDFASAAELGSSFAKMQLVALNPYAAMCNKMLAEVFEKAK 175          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Fly
Match: CG14105 (gene:FBgn0036359 transcript:FBtr0075857)

HSP 1 Score: 95.1301 bits (235), Expect = 5.562e-24
Identity = 65/187 (34.76%), Postives = 109/187 (58.29%), Query Frame = 3
Query:   66 NQNLTSHDKEILTRIFNGEDLRDFDDETIETTN---------GESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGL-GKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            N  L+ HD+++L  IFN  +L      +++T N          E PD   +K     E++AI L+E  + D +L++  + ++L    AS  NNRAQ  +L K++++A++DL+KA+EL+     +    A  QRG++Y+ L   + A  D+E A++LG +FAR  ++  NPYAALCNQML +   +++
Sbjct:    5 NLTLSPHDQQVLDSIFNPLEL-----SSLQTNNLIPAESDLKDEEPDTQAIKASRELELKAIALSESGELDGALELFQQSLNL-AQRASVLNNRAQTLRLAKRDEEALDDLNKALELANDQQTRTKCHAHCQRGVLYRKLDNLEAARADFEAAAQLGSKFAREQLVEINPYAALCNQMLRQAFDQLK 185          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Zebrafish
Match: ttc36 (tetratricopeptide repeat domain 36 [Source:NCBI gene;Acc:492516])

HSP 1 Score: 132.494 bits (332), Expect = 3.121e-38
Identity = 72/177 (40.68%), Postives = 108/177 (61.02%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFDDETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            ++HD+ +L  IFN      D+   + E     +  + DP++VKQ    E++ +  AE      +L+   + I + P  ASA+NNRAQ  +LL   K A+ DL+ AI LS G G+   QAL QRG++ +  G D+ A  D+ERA+ LG +FAR+  +I NPYAALCN+MLS++IS++R
Sbjct:    3 SAHDRAVLQAIFNPTSPIGDVPGLNQEEELMDDDSAFDPELVKQVKDLELQGVSSAESGDLPAALQHFNQAISVLPQRASAYNNRAQTKRLLGDTKGAVEDLEHAISLSNGKGRSACQALVQRGLLLRLSGHDEEARLDFERAAALGSEFARQQAVILNPYAALCNRMLSEVISKLR 179          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Zebrafish
Match: ttc36 (tetratricopeptide repeat domain 36 [Source:NCBI gene;Acc:492516])

HSP 1 Score: 132.494 bits (332), Expect = 3.121e-38
Identity = 72/177 (40.68%), Postives = 108/177 (61.02%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFDDETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            ++HD+ +L  IFN      D+   + E     +  + DP++VKQ    E++ +  AE      +L+   + I + P  ASA+NNRAQ  +LL   K A+ DL+ AI LS G G+   QAL QRG++ +  G D+ A  D+ERA+ LG +FAR+  +I NPYAALCN+MLS++IS++R
Sbjct:    3 SAHDRAVLQAIFNPTSPIGDVPGLNQEEELMDDDSAFDPELVKQVKDLELQGVSSAESGDLPAALQHFNQAISVLPQRASAYNNRAQTKRLLGDTKGAVEDLEHAISLSNGKGRSACQALVQRGLLLRLSGHDEEARLDFERAAALGSEFARQQAVILNPYAALCNRMLSEVISKLR 179          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Mouse
Match: Ttc36 (tetratricopeptide repeat domain 36 [Source:MGI Symbol;Acc:MGI:2384760])

HSP 1 Score: 115.931 bits (289), Expect = 8.422e-32
Identity = 53/130 (40.77%), Postives = 85/130 (65.38%), Query Frame = 3
Query:  198 EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVRC 587
            E++ ++ AE      +L+  G+ I L P+ ASA+NNRAQ  +L      A+ DL++A+ LSGG G+   Q+  Q G++ ++ G D  A  D+E+A++LG  FARR +++ NPYAALCN+ML+ M+ ++R 
Sbjct:   52 ELQGVRAAEAGDLHTALEKFGQAISLLPDRASAYNNRAQARRLQGDVAGALEDLERAVTLSGGRGRAARQSFVQSGLLARFQGRDDDARRDFEKAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLRA 181          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. UniProt/SwissProt
Match: sp|A8E7I5|TTC36_DANRE (Tetratricopeptide repeat protein 36 OS=Danio rerio OX=7955 GN=ttc36 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.356e-37
Identity = 72/177 (40.68%), Postives = 108/177 (61.02%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFDDETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            ++HD+ +L  IFN      D+   + E     +  + DP++VKQ    E++ +  AE      +L+   + I + P  ASA+NNRAQ  +LL   K A+ DL+ AI LS G G+   QAL QRG++ +  G D+ A  D+ERA+ LG +FAR+  +I NPYAALCN+MLS++IS++R
Sbjct:    3 SAHDRAVLQAIFNPTSPIGDVPGLNQEEELMDDDSAFDPELVKQVKDLELQGVSSAESGDLPAALQHFNQAISVLPQRASAYNNRAQTKRLLGDTKGAVEDLEHAISLSNGKGRSACQALVQRGLLLRLSGHDEEARLDFERAAALGSEFARQQAVILNPYAALCNRMLSEVISKLR 179          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. UniProt/SwissProt
Match: sp|A6NLP5|TTC36_HUMAN (Tetratricopeptide repeat protein 36 OS=Homo sapiens OX=9606 GN=TTC36 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 7.184e-32
Identity = 56/129 (43.41%), Postives = 84/129 (65.12%), Query Frame = 3
Query:  198 EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            E++ +  AE      +L+  G+ I L P  ASA+NNRAQ  +L      A+ DL++A+ELSGG G+   Q+  QRG++ +  G D  A  D+ERA++LG  FARR +++ NPYAALCN+ML+ M+ ++R
Sbjct:   55 ELQGVMAAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGRAARQSFVQRGLLARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLR 183          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. UniProt/SwissProt
Match: sp|Q3SZV0|TTC36_BOVIN (Tetratricopeptide repeat protein 36 OS=Bos taurus OX=9913 GN=TTC36 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.133e-31
Identity = 69/184 (37.50%), Postives = 106/184 (57.61%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFD---DETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR--CD 590
            T +D+ +L  IFN +    D+   D   +   E   GE      ++Q    E++A+  AE      +L+  G+ I+L P  ASA+NNRAQ  +L      A+ DL++A+ LSGG G+   Q   QRG++ +  G D  A  D+ERA++LG  FARR +++ NPYAALCN+ML+ ++ ++R  CD
Sbjct:    3 TPNDQAVLQAIFNPDSPFGDIVGLDLGEEAEKEVDEGEVFPRAQLEQSKALELQAVIAAEAGDLSTALERFGQAINLLPERASAYNNRAQARRLQGDVAGALEDLERALALSGGRGRTARQGFVQRGLVARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADVMGQLRRPCD 186          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. UniProt/SwissProt
Match: sp|Q66H45|TTC36_RAT (Tetratricopeptide repeat protein 36 OS=Rattus norvegicus OX=10116 GN=Ttc36 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.130e-31
Identity = 54/128 (42.19%), Postives = 84/128 (65.62%), Query Frame = 3
Query:  198 EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEV 581
            E++ ++ AE      +L+  GK I L P  ASA+NNRAQ  +L      A+ DL++A+ LSGG G+   Q+  QRG++ ++ G D  A  D+E+A++LG  FARR +++ NPYAALCN+ML+ M+ ++
Sbjct:   52 ELQGVRAAEAGDLHTALERFGKAISLLPERASAYNNRAQARRLQGDVAGALEDLERAVTLSGGRGRAARQSFVQRGLLARFQGRDDDARRDFEQAARLGSSFARRQLVLLNPYAALCNRMLADMMGQL 179          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. UniProt/SwissProt
Match: sp|Q8VBW8|TTC36_MOUSE (Tetratricopeptide repeat protein 36 OS=Mus musculus OX=10090 GN=Ttc36 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 5.891e-31
Identity = 53/130 (40.77%), Postives = 85/130 (65.38%), Query Frame = 3
Query:  198 EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVRC 587
            E++ ++ AE      +L+  G+ I L P+ ASA+NNRAQ  +L      A+ DL++A+ LSGG G+   Q+  Q G++ ++ G D  A  D+E+A++LG  FARR +++ NPYAALCN+ML+ M+ ++R 
Sbjct:   52 ELQGVRAAEAGDLHTALEKFGQAISLLPDRASAYNNRAQARRLQGDVAGALEDLERAVTLSGGRGRAARQSFVQSGLLARFQGRDDDARRDFEKAARLGSPFARRQLVLLNPYAALCNRMLADMMGQLRA 181          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. TrEMBL
Match: V4A1P3 (TPR_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_193123 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.966e-37
Identity = 71/178 (39.89%), Postives = 119/178 (66.85%), Query Frame = 3
Query:   69 QNLTSHDKEILTRIFN-----GEDLRDFDDETIETTNGESP--DPDIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEV 581
            +++T+HDK IL++IFN      E   ++D  +I     +S     +  + E++ +K AE + YD++LK L + ++  P++AS +NNRAQV++L+ QN +A+ DL KAI LS G G+   QA TQR ++ K  G D+ +M D+++A++LG +FA++ V+  NPYAA+CN MLS++I ++
Sbjct:    7 KDITAHDKAILSQIFNPNLPFSESNDEYDTASIIDIEPQSTLEVKEAKELEVKGVKEAEEENYDEALKYLNQAVNKAPSWASTYNNRAQVYRLMGQNDEALEDLSKAITLSCGRGQAAKQAYTQRALLRKLAGNDEDSMTDFKKAAELGNEFAKQQVVSANPYAAMCNAMLSEVIHKI 184          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. TrEMBL
Match: A0A1W4XA58 (tetratricopeptide repeat protein 36 homolog OS=Agrilus planipennis OX=224129 GN=LOC108740034 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.430e-36
Identity = 81/185 (43.78%), Postives = 114/185 (61.62%), Query Frame = 3
Query:   75 LTSHDKEILTRIFN----------GED----LRDFDDETIETTNGESPDPDIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSG-GLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            L+ HD+ +L+ IFN           ED    LRD D+E+ +          I   E +AI LAE  K D+++KIL + IHL P  AS +NNRAQV+QL ++  DA++DL KAIELSG  L +   +AL QRG++Y+ +  ++LA  D+  ASKLG QFA+  +I  NPYAALCNQML + +  ++
Sbjct:    4 LSVHDRAVLSCIFNPSLPLDAIVEAEDVNMHLRDDDEESYQEIEK------IKVMECKAIHLAESGKTDEAIKILEEAIHLAPQKASLYNNRAQVYQLKRKPNDALDDLTKAIELSGDKLLRTKREALCQRGLLYRKMENEELARNDFNEASKLGSQFAKNQLIEMNPYAALCNQMLKQAVENLQ 182          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. TrEMBL
Match: B2L3M7 (TRPA_3 OS=Philodina roseola OX=96448 GN=TPRA_3 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.408e-36
Identity = 76/184 (41.30%), Postives = 115/184 (62.50%), Query Frame = 3
Query:   72 NLTSHDKEILTRIFNGEDLRDFDDET-IETTNGESPDP--------DIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGG---LGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVRC 587
            N+T +DK +L  +FN     DFD ET  +TT+ E+           +I K E E +KLAE  +  +++K   + I L PN  SA+NNRAQ +QL  +  DAMNDL+KAI+L+       K    ALTQRG++++ L  +K ++ D+ +A++LG  FA++ V+++NP+AA CNQMLSKM+ +  C
Sbjct:    3 NITDNDKYVLNAMFNPTYPLDFDKETATDTTDAENRSKIFIYQLALEIKKLEEEGVKLAEQNQLPEAIKRFDQAITLDPNQPSAYNNRAQAYQLQNRIDDAMNDLNKAIQLASAGAHYQKTLSMALTQRGVLHRVLQNEKESLDDFTQAAELGSNFAKQQVLLSNPFAAACNQMLSKMLKQTAC 186          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. TrEMBL
Match: A0A0P5ZTV4 (Tetratricopeptide repeat protein OS=Daphnia magna OX=35525 GN=APZ42_014458 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 6.068e-36
Identity = 73/175 (41.71%), Postives = 104/175 (59.43%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGEDLRD--FDDETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            TS+D+ IL  I N     D       ++    ++ D + VK     E + +  AE  + D +L++ GK +   P +ASA+NNRAQ  +LLK+N++AM DLD AIELS G GK   QA  QR +++ Y G + LA+ DWE AS LG QFA+  +   NPYAALCN+ML  + + +R
Sbjct:    3 TSNDRAILNSIINPLLPSDEFVSHNVVQDDTADTDDSEGVKMAKEFEKQGVIFAESGRMDQALEMFGKAVDCSPMWASAYNNRAQALRLLKRNEEAMKDLDTAIELSHGKGKAACQAYCQRAMLHHYTGNEDLALMDWESASNLGSQFAKNQLTQKNPYAALCNKMLHDVFNNLR 177          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. TrEMBL
Match: A0A4D5S0P8 (Putative tetratricopeptide repeat protein (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.625e-35
Identity = 70/175 (40.00%), Postives = 109/175 (62.29%), Query Frame = 3
Query:   78 TSHDKEILTRIFN------GEDLRDFDDETIETTNGESPDPDIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            T++DK +L  +FN      G    D D   I  ++ + P  ++ + E+E ++ AEM++ D++++I  K I L P  AS +NNRAQ  ++    + A+ DL+ AI LS G G    QAL QRG+IY+    D+ A+ D++RA+KLG QFA+  V+  NPYAALCNQML +M ++++
Sbjct:    3 TANDKAVLEAVFNPLFSELGFSCDDEDSAEISESDTDVP-AEVKELEVEGVRAAEMQEIDEAIEIFSKAIQLCPRRASGYNNRAQALRIKGDVEHALEDLNNAINLSEGKGHAACQALCQRGLIYRLQKRDEEALVDFKRAAKLGSQFAKAQVVQMNPYAALCNQMLGQMFAKLK 176          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Cavefish
Match: ttc36 (tetratricopeptide repeat domain 36 [Source:NCBI gene;Acc:492516])

HSP 1 Score: 125.176 bits (313), Expect = 9.592e-35
Identity = 67/177 (37.85%), Postives = 104/177 (58.76%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFDDETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            ++ D+ +L  IFN      D+   + E   T N  S DP +++Q    E+  +  AE  +   +L    + + + P+ ASA+NNRAQ  +L      A+ DL++AI LS G G+   QAL QRG++ +    D+ A  D+ERA+ LG +FAR+  +I NPYAALCN+MLS++I ++R
Sbjct:   65 SAQDRAVLQAIFNPNTPFGDVPGLNQEEELTDNDSSFDPVLLQQVKDLELRGVSAAEAGELQTALSHFNQAVQILPSRASAYNNRAQAKRLQGDTTGAIEDLERAISLSEGTGRSACQALVQRGLLLRLAKRDEEARADFERAAALGSEFARQQAVILNPYAALCNRMLSEVIGKLR 241          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Sea Lamprey
Match: ttc36 (tetratricopeptide repeat domain 36 [Source:NCBI gene;Acc:492516])

HSP 1 Score: 102.064 bits (253), Expect = 2.987e-27
Identity = 62/180 (34.44%), Postives = 97/180 (53.89%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFD-DETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLL--KQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            T +D  +L  IFN      D+   D    ++       DP ++ +    E++ +  AE    D ++ +  + I L P   SA+NNRAQ  +L    +   A+ DLD+AI L  G G    QAL QRG+I +    +  A+ D++ AS LG  FAR+ ++  NPYAALCN+ML+++I ++R
Sbjct:    3 TENDCAVLQAIFNPNTPFGDIPGLDYPHEVKNNEDSGLDPALLAEAKALEMQGVACAEDADLDRAVHLFDRAIELLPQRPSAYNNRAQALRLQGDTEGSGALADLDRAISLGTGTGHSACQALVQRGLIRRLQDRNDEAVQDFQLASALGSAFARQQLVQLNPYAALCNRMLAQVIGQMR 182          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Nematostella
Match: TTC36 (Tetratricopeptide repeat protein 36 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7RL75])

HSP 1 Score: 103.99 bits (258), Expect = 9.267e-28
Identity = 62/171 (36.26%), Postives = 98/171 (57.31%), Query Frame = 3
Query:   87 DKEILTRIFN-----GEDLRDFDDETIETTNGESPDPDIVKQ-EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEV 581
            D+ +L  IFN     G+  ++  +E +   N    D    K+ EI+ ++ AE   +  +L    K I + P  AS +NNRAQ+ +L   N+ AM DL+KAIELS   G    QA TQRG++++  G D+ A  D++  + LG  FA+ + +  NPYAA+CN+ML++ I ++
Sbjct:    7 DRAVLDAIFNPLLPLGDCPQEIIEEELPIENTNEDDVKRAKEYEIQGVEKAEAGDFVGALDCFNKAIDVAPLRASGYNNRAQLSRLRGDNQSAMEDLNKAIELSHEHGAAAAQAYTQRGLLHRLEGNDEAASEDFQHGATLGNAFAKAMTVQLNPYAAMCNKMLAEAIGKL 177          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Medaka
Match: ttc36 (tetratricopeptide repeat domain 36 [Source:NCBI gene;Acc:101170288])

HSP 1 Score: 119.398 bits (298), Expect = 1.524e-32
Identity = 66/177 (37.29%), Postives = 105/177 (59.32%), Query Frame = 3
Query:   78 TSHDKEILTRIFNGE----DLRDFDDETIETTNGESPDPDIVKQ----EIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVR 584
            +++D+ +L  IFN      D+   + E   T +    D +++KQ    E+  +  AE      +L++  + I + P  ASA+NNRAQ  +L      A+ DLD+AI LSGG G+ G QAL QRG++ +       A  D+E+A+ LG +FAR+  ++ NPYAALCN+MLS++I+++R
Sbjct:   68 SANDRAVLQAIFNPTSPFGDIPGINREEELTDDDSGFDTELLKQVKELEMRGVSAAEAGDLQGALQLFSQAIQILPERASAYNNRAQALRLQGDTTGALQDLDRAIVLSGGDGRTGCQALVQRGLLRRLGSQMDEARADFEKAASLGSEFARQQAVVLNPYAALCNKMLSEVINKLR 244          
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Planmine SMEST
Match: SMESG000037255.1 (SMESG000037255.1)

HSP 1 Score: 363.999 bits (933), Expect = 9.396e-130
Identity = 176/177 (99.44%), Postives = 177/177 (100.00%), Query Frame = 3
Query:   63 MNQNLTSHDKEILTRIFNGEDLRDFDDETIETTNGESPDPDIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVRCDL 593
            MNQNLTSHDKEILTRIFNGEDLRDFDDETIETTNGESPDPDIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNK+AMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVRCDL
Sbjct:    1 MNQNLTSHDKEILTRIFNGEDLRDFDDETIETTNGESPDPDIVKQEIEAIKLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKEAMNDLDKAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARRLVIINNPYAALCNQMLSKMISEVRCDL 177          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TTC361.496e-3243.41tetratricopeptide repeat domain 36 [Source:HGNC Sy... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc-369.709e-2934.86Tetratricopeptide repeat protein 36 [Source:UniPr... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG141055.562e-2434.76gene:FBgn0036359 transcript:FBtr0075857[more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc363.121e-3840.68tetratricopeptide repeat domain 36 [Source:NCBI ge... [more]
ttc363.121e-3840.68tetratricopeptide repeat domain 36 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ttc368.422e-3240.77tetratricopeptide repeat domain 36 [Source:MGI Sym... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8E7I5|TTC36_DANRE2.356e-3740.68Tetratricopeptide repeat protein 36 OS=Danio rerio... [more]
sp|A6NLP5|TTC36_HUMAN7.184e-3243.41Tetratricopeptide repeat protein 36 OS=Homo sapien... [more]
sp|Q3SZV0|TTC36_BOVIN1.133e-3137.50Tetratricopeptide repeat protein 36 OS=Bos taurus ... [more]
sp|Q66H45|TTC36_RAT2.130e-3142.19Tetratricopeptide repeat protein 36 OS=Rattus norv... [more]
sp|Q8VBW8|TTC36_MOUSE5.891e-3140.77Tetratricopeptide repeat protein 36 OS=Mus musculu... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A1P35.966e-3739.89TPR_REGION domain-containing protein OS=Lottia gig... [more]
A0A1W4XA581.430e-3643.78tetratricopeptide repeat protein 36 homolog OS=Agr... [more]
B2L3M72.408e-3641.30TRPA_3 OS=Philodina roseola OX=96448 GN=TPRA_3 PE=... [more]
A0A0P5ZTV46.068e-3641.71Tetratricopeptide repeat protein OS=Daphnia magna ... [more]
A0A4D5S0P81.625e-3540.00Putative tetratricopeptide repeat protein (Fragmen... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc369.592e-3537.85tetratricopeptide repeat domain 36 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc362.987e-2734.44tetratricopeptide repeat domain 36 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
TTC369.267e-2836.26Tetratricopeptide repeat protein 36 homolog [Sour... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc361.524e-3237.29tetratricopeptide repeat domain 36 [Source:NCBI ge... [more]
back to top
BLAST of Tetratricopeptide repeat protein 36 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037255.19.396e-13099.44SMESG000037255.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018892 ID=SMED30018892|Name=Tetratricopeptide repeat protein 36 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=717bp
CATCGATGATGCTTTATCCAAAGTCCAAACACCAATTTTGTTAATTAGTT
AAAATTTGTACAATGAATCAAAATTTAACATCTCACGATAAAGAAATATT
AACAAGAATATTCAATGGAGAAGATTTGAGAGATTTCGACGATGAAACAA
TCGAGACGACAAATGGAGAATCACCAGACCCAGATATTGTCAAACAAGAA
ATAGAGGCTATTAAATTGGCCGAAATGAAAAAATATGACGACTCGTTAAA
AATTTTAGGAAAAATTATCCATTTATTTCCGAATTACGCCTCAGCTTTTA
ATAACCGAGCTCAAGTTCATCAATTGTTAAAACAAAATAAAGATGCAATG
AATGATCTAGATAAAGCGATTGAATTGAGCGGCGGTCTAGGAAAAGTCGG
AATTCAAGCTTTGACCCAAAGAGGTATCATTTATAAATATCTCGGTGCAG
ATAAGCTTGCAATGGGAGATTGGGAAAGAGCAAGTAAATTGGGGGGCCAA
TTTGCTAGAAGACTTGTGATAATTAACAATCCATATGCTGCACTGTGCAA
TCAAATGCTGTCGAAAATGATTTCGGAAGTCAGATGTGATTTATAATTTT
AAAATGAAATTTAATTGGATTGTTTTTTGTTGTTTATTTTAAACTTTTGA
AAAAGGAATATTTTAAAGACTTTTTGTTTGGTTATATAATACGGCTTTTT
ACAATTTTATTTTGGAA
back to top

protein sequence of SMED30018892-orf-1

>SMED30018892-orf-1 ID=SMED30018892-orf-1|Name=SMED30018892-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MNQNLTSHDKEILTRIFNGEDLRDFDDETIETTNGESPDPDIVKQEIEAI
KLAEMKKYDDSLKILGKIIHLFPNYASAFNNRAQVHQLLKQNKDAMNDLD
KAIELSGGLGKVGIQALTQRGIIYKYLGADKLAMGDWERASKLGGQFARR
LVIINNPYAALCNQMLSKMISEVRCDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0032474otolith morphogenesis
GO:0060271cilium morphogenesis
GO:0061371determination of heart left/right asymmetry
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038906TTC36
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 85..105
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 76..109
e-value: 0.0035
score: 26.6
coord: 114..147
e-value: 17.0
score: 12.8
coord: 42..75
e-value: 340.0
score: 1.5
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 9..157
e-value: 9.7E-19
score: 69.6
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 48..161
IPR038906Tetratricopeptide repeat protein 36PANTHERPTHR21405CDNA SEQUENCE BC021608coord: 3..174
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 42..147
score: 10.844