Sequestosome 1 like

Overview
NameSequestosome 1 like
Smed IDSMED30018888
Length (bp)1256
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sequestosome 1 like (SMED30018888) t-SNE clustered cells

Violin plots show distribution of expression levels for Sequestosome 1 like (SMED30018888) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sequestosome 1 like (SMED30018888) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sequestosome 1 like (SMED30018888) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018888

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30018888SMESG000058620.1 dd_Smed_v4_2812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018888SMESG000058620.1 dd_Smed_v4_2812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30018888SMESG000058620.1 dd_Smed_v4_2812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018888SMESG000058620.1 dd_Smed_v4_2812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018888SMESG000058620.1 dd_Smed_v4_2812_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sequestosome 1 like vs. Ensembl Celegans
Match: sqst-1 (SeQueSTosome related [Source:UniProtKB/TrEMBL;Acc:F1LIM5])

HSP 1 Score: 58.9214 bits (141), Expect = 3.578e-9
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  387 KEDNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPE 647
            KE +++   E+   DL +   E  + ++   F  V  +  CD C   I+G RFKCLEC DYD+C+ C      +H EH +I + +P+
Sbjct:   72 KELSRVSALETMVADLHAKEREPVVEEVQKPFPPVKHSASCDACLGDIIGHRFKCLECADYDLCEKCERK--SLHYEHAMIRIVEPK 156          
BLAST of Sequestosome 1 like vs. Ensembl Celegans
Match: sqst-1 (SeQueSTosome related [Source:UniProtKB/TrEMBL;Acc:F1LIM5])

HSP 1 Score: 58.9214 bits (141), Expect = 3.738e-9
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  387 KEDNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPE 647
            KE +++   E+   DL +   E  + ++   F  V  +  CD C   I+G RFKCLEC DYD+C+ C      +H EH +I + +P+
Sbjct:  144 KELSRVSALETMVADLHAKEREPVVEEVQKPFPPVKHSASCDACLGDIIGHRFKCLECADYDLCEKCERK--SLHYEHAMIRIVEPK 228          
BLAST of Sequestosome 1 like vs. Ensembl Celegans
Match: sqst-1 (SeQueSTosome related [Source:UniProtKB/TrEMBL;Acc:F1LIM5])

HSP 1 Score: 58.9214 bits (141), Expect = 3.738e-9
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  387 KEDNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPE 647
            KE +++   E+   DL +   E  + ++   F  V  +  CD C   I+G RFKCLEC DYD+C+ C      +H EH +I + +P+
Sbjct:  144 KELSRVSALETMVADLHAKEREPVVEEVQKPFPPVKHSASCDACLGDIIGHRFKCLECADYDLCEKCERK--SLHYEHAMIRIVEPK 228          
BLAST of Sequestosome 1 like vs. Ensembl Zebrafish
Match: herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-070718-6])

HSP 1 Score: 49.6766 bits (117), Expect = 6.560e-6
Identity = 24/51 (47.06%), Postives = 29/51 (56.86%), Query Frame = 3
Query:  486 NVHMNVECDYCREF-IVGDRFKCLECDDYDICQMCF--------HSVPRIH 611
            +VH  V CD C+ F I G RFKC  CDD+D C+ CF        HS  RI+
Sbjct: 2695 SVHPGVRCDGCQMFPINGPRFKCRSCDDFDFCESCFKTRKHNPRHSFGRIN 2745          
BLAST of Sequestosome 1 like vs. Ensembl Xenopus
Match: sqstm1 (sequestosome 1 [Source:NCBI gene;Acc:493277])

HSP 1 Score: 58.151 bits (139), Expect = 1.381e-8
Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKP 644
            VH NV CD C   +VG+RFKCL C DYD+C  C      IH EH +I+   P
Sbjct:  117 VHPNVTCDGCDGPVVGNRFKCLICPDYDLCSTCEKK--GIHKEHNMIMFPTP 166          
BLAST of Sequestosome 1 like vs. Ensembl Mouse
Match: Sqstm1 (sequestosome 1 [Source:MGI Symbol;Acc:MGI:107931])

HSP 1 Score: 50.8322 bits (120), Expect = 2.235e-6
Identity = 22/52 (42.31%), Postives = 29/52 (55.77%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKP 644
            VH NV CD C   +VG R+KC  C DYD+C +C      +H EH  ++   P
Sbjct:  122 VHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGK--GLHREHSKLIFPNP 171          
BLAST of Sequestosome 1 like vs. Ensembl Mouse
Match: Sqstm1 (sequestosome 1 [Source:MGI Symbol;Acc:MGI:107931])

HSP 1 Score: 50.447 bits (119), Expect = 2.922e-6
Identity = 22/52 (42.31%), Postives = 29/52 (55.77%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKP 644
            VH NV CD C   +VG R+KC  C DYD+C +C      +H EH  ++   P
Sbjct:  122 VHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGK--GLHREHSKLIFPNP 171          
BLAST of Sequestosome 1 like vs. Ensembl Mouse
Match: Sqstm1 (sequestosome 1 [Source:MGI Symbol;Acc:MGI:107931])

HSP 1 Score: 49.6766 bits (117), Expect = 4.868e-6
Identity = 22/52 (42.31%), Postives = 29/52 (55.77%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKP 644
            VH NV CD C   +VG R+KC  C DYD+C +C      +H EH  ++   P
Sbjct:  122 VHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKG--LHREHSKLIFPNP 171          
BLAST of Sequestosome 1 like vs. Ensembl Mouse
Match: Herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:103234])

HSP 1 Score: 50.0618 bits (118), Expect = 5.656e-6
Identity = 19/38 (50.00%), Postives = 25/38 (65.79%), Query Frame = 3
Query:  486 NVHMNVECDYCREF-IVGDRFKCLECDDYDICQMCFHS 596
            ++H  V CD C+ F I G RFKC  CDD+D C+ CF +
Sbjct: 2702 SIHPGVTCDGCQTFPINGSRFKCRNCDDFDFCETCFKT 2739          
BLAST of Sequestosome 1 like vs. Ensembl Mouse
Match: Herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:103234])

HSP 1 Score: 50.0618 bits (118), Expect = 5.658e-6
Identity = 19/38 (50.00%), Postives = 25/38 (65.79%), Query Frame = 3
Query:  486 NVHMNVECDYCREF-IVGDRFKCLECDDYDICQMCFHS 596
            ++H  V CD C+ F I G RFKC  CDD+D C+ CF +
Sbjct: 2702 SIHPGVTCDGCQTFPINGSRFKCRNCDDFDFCETCFKT 2739          
BLAST of Sequestosome 1 like vs. TrEMBL
Match: A0A267DLT7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023326g2 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.596e-9
Identity = 45/160 (28.12%), Postives = 78/160 (48.75%), Query Frame = 3
Query:  207 DLLFSKQMEFKIRYINSYKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLKE---DNKILITESDWIDLVSSNSENR------IIKLSVYFGN---VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPED 650
            D L S  M   +     Y  NEI  RR+ +  ++ TY      L+ + ++  T ++ ++ ++   D   + T ++  + + S +  R       +K+ V  G+   VH  V CD C   + G RFKCL C D+D+C  C       HS+H ++L+R+P+D
Sbjct:   21 DKLISCNMASSVVPFKCYYGNEI--RRLSLAGQA-TYASLVEQLQAVFSIAPTQQLRLRWQDEEGDRVTMTTNAELQEAIRSLAARRDGGSGDAVKVFVSVGDPTVVHEGVVCDGCESGVTGQRFKCLLCPDFDLCSACMTG--GSHSQHPMLLIRRPDD 175          
BLAST of Sequestosome 1 like vs. TrEMBL
Match: A0A267G1S2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011612g1 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.567e-8
Identity = 42/143 (29.37%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  258 YKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLKE---DNKILITESDWIDLVSSNSENR------IIKLSVYFGN---VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPED 650
            Y  NEI  RR+ +  ++ TY      L+ + ++  T ++ ++ ++   D   + T ++  + V S +  R       +K+ V  G+   VH  V CD C   + G RFKCL C D+D+C  C       HS+H ++L+R+P+D
Sbjct:   11 YYGNEI--RRLSLAGQA-TYASLVEQLQAVFSIAPTQQLRLRWQDEEGDRVTMTTNAELQEAVRSLAARRDGGSGDAVKVFVSVGDPTVVHEGVVCDGCESGVTGQRFKCLLCPDFDLCSACMTGGS--HSQHPMLLIRRPDD 148          
BLAST of Sequestosome 1 like vs. TrEMBL
Match: A0A267GQI0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023326g1 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.591e-8
Identity = 42/143 (29.37%), Postives = 72/143 (50.35%), Query Frame = 3
Query:  258 YKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLKE---DNKILITESDWIDLVSSNSENR------IIKLSVYFGN---VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPED 650
            Y  NEI  RR+ +  ++ TY      L+ + ++  T ++ ++ ++   D   + T  +  + V S +  R       +K+ V  G+   VH  V CD C   + G RFKCL C D+D+C  C       HS+H ++L+R+P+D
Sbjct:   11 YYGNEI--RRLSLAGQA-TYASLVEQLQAVFSIAPTQQLRLRWQDEEGDRVTMTTNGELQEAVRSLAARRDGGSGDAVKVFVSVGDPTVVHEGVMCDGCESGVTGQRFKCLLCPDFDLCSACMTGGS--HSQHPMLLIRRPDD 148          
BLAST of Sequestosome 1 like vs. TrEMBL
Match: A0A267G1X2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021543g2 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.869e-8
Identity = 41/143 (28.67%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  258 YKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLKE---DNKILITESDWIDLVSSNSENR------IIKLSVYFGN---VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPED 650
            Y  NEI  RR+ +  ++ TY      L+ + ++  T ++ ++ ++   D   + T ++  + + S +  R       +K+ V  G+   VH  V CD C   + G RFKCL C D+D+C  C       HS+H ++L+R+P+D
Sbjct:   11 YYGNEI--RRLSLAGQA-TYASLVEQLQAVFSIAPTQQLRLRWQDEEGDRVTMTTNAELQEAIRSLAARRDGGSGDAVKVFVSVGDPTVVHEGVVCDGCESGVTGQRFKCLLCPDFDLCSACMTGGS--HSQHPMLLIRRPDD 148          
BLAST of Sequestosome 1 like vs. TrEMBL
Match: A0A165F9Y4 (Uncharacterized protein OS=Laetiporus sulphureus 93-53 OX=1314785 GN=LAESUDRAFT_723544 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.149e-8
Identity = 29/67 (43.28%), Postives = 37/67 (55.22%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPED---RNKFIKSIPY 680
            V  + EC+ C   I+GDR+KCL C D+D C  CF      H  H  +L+RKPED   RN   K + Y
Sbjct:  807 VAHSAECNMCDSRIIGDRYKCLNCPDFDTCSSCFQITKEQHPHHGFVLIRKPEDLFVRNALGKDVLY 873          
BLAST of Sequestosome 1 like vs. Ensembl Cavefish
Match: herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-070718-6])

HSP 1 Score: 49.6766 bits (117), Expect = 5.559e-6
Identity = 24/51 (47.06%), Postives = 29/51 (56.86%), Query Frame = 3
Query:  486 NVHMNVECDYCREF-IVGDRFKCLECDDYDICQMCF--------HSVPRIH 611
            +VH  V CD C+ F I G RFKC  CDD+D C+ CF        HS  RI+
Sbjct: 2694 SVHPGVRCDGCQMFPINGPRFKCRSCDDFDFCESCFKTRKHNPRHSFGRIN 2744          
BLAST of Sequestosome 1 like vs. Ensembl Cavefish
Match: sqstm1 (sequestosome 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2204])

HSP 1 Score: 48.521 bits (114), Expect = 8.576e-6
Identity = 19/52 (36.54%), Postives = 27/52 (51.92%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKP 644
            +H  V CD C   + G RFKC  C DYD+C  C      +H +H ++ +  P
Sbjct:  136 IHPGVTCDGCEGQVAGTRFKCTLCPDYDLCSTC--QAKGLHKDHPLLPIFHP 185          
BLAST of Sequestosome 1 like vs. Ensembl Nematostella
Match: EDO42482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C1])

HSP 1 Score: 51.9878 bits (123), Expect = 3.659e-7
Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSE-HCIILLR--------KPEDRNKFIKSIPYR 683
            VH  + CD+C   I G R+KC  C DYD+C+ C  ++P +H+E H  + LR        K  +    ++  PYR
Sbjct:  612 VHKGITCDHCDNTIRGIRYKCSNCADYDLCETC-EAIPGVHNELHAFLKLRFHAPGIGLKQGEMVPLLRQSPYR 684          
BLAST of Sequestosome 1 like vs. Ensembl Nematostella
Match: EDO41097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C8])

HSP 1 Score: 48.1358 bits (113), Expect = 5.246e-6
Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = 3
Query:  489 VHMNVECDYCREF-IVGDRFKCLECDDYDICQMCFHSVPRIHSEH 620
            V    +C  C+E+ IVG RF+CL+C +YD+CQ CF S  RI  EH
Sbjct:  562 VKHKAKCSICKEYPIVGFRFRCLKCFNYDLCQSCFWS-GRISHEH 605          
BLAST of Sequestosome 1 like vs. Ensembl Medaka
Match: sqstm1 (sequestosome 1 [Source:NCBI gene;Acc:101166287])

HSP 1 Score: 52.373 bits (124), Expect = 5.033e-7
Identity = 25/65 (38.46%), Postives = 35/65 (53.85%), Query Frame = 3
Query:  489 VHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPED---RNKFIKSI 674
            +H NV CD C   +VG RFKC  C DYD+C  C       H+EH ++ +  P     R K++K +
Sbjct:  127 LHPNVTCDGCEGPVVGMRFKCSVCPDYDLCSTC--QAQGKHTEHALLPIWHPLQWFPRGKWMKRM 189          
BLAST of Sequestosome 1 like vs. Planmine SMEST
Match: SMESG000058620.1 (SMESG000058620.1)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 289/296 (97.64%), Postives = 290/296 (97.97%), Query Frame = 3
Query:  228 MEFKIRYINSYKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLKEDNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPEDRNKFIKSIPYRMENGSDFRVVDIDIGALIGSHQASEKLDNSSQTDSRISPPLVDAPDKSQSIYHSIDKDKSSFEILDAEMPMKSGERQNCEKHKMNARTLNDVLQDQNCAPVSKEYLESLPAEILESVEKLKSMGFTNINGTLIALLVAHMEMFF 1115
            MEFKIRYINSYKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLK+DNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPEDRNKFIKSIPYRMENGSDFRVVDIDIGALIGSHQASEKLDNSSQTDSRISPPLVDAPDKSQSI HSIDKDKSSFEILDAEMPMKSGERQNCEKHKMNAR LNDVLQDQNCAPVSKEYLESLPAEILESVEKLKSMGFTNINGTLIALLVAH    F
Sbjct:    1 MEFKIRYINSYKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEICIKLKKDNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREFIVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPEDRNKFIKSIPYRMENGSDFRVVDIDIGALIGSHQASEKLDNSSQTDSRISPPLVDAPDKSQSISHSIDKDKSSFEILDAEMPMKSGERQNCEKHKMNARKLNDVLQDQNCAPVSKEYLESLPAEILESVEKLKSMGFTNINGTLIALLVAHNGNVF 296          
The following BLAST results are available for this feature:
BLAST of Sequestosome 1 like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sequestosome 1 like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sqst-13.578e-934.48SeQueSTosome related [Source:UniProtKB/TrEMBL;Acc... [more]
sqst-13.738e-934.48SeQueSTosome related [Source:UniProtKB/TrEMBL;Acc... [more]
sqst-13.738e-934.48SeQueSTosome related [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Sequestosome 1 like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sequestosome 1 like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
herc26.560e-647.06HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Sequestosome 1 like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sqstm11.381e-850.00sequestosome 1 [Source:NCBI gene;Acc:493277][more]
back to top
BLAST of Sequestosome 1 like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sqstm12.235e-642.31sequestosome 1 [Source:MGI Symbol;Acc:MGI:107931][more]
Sqstm12.922e-642.31sequestosome 1 [Source:MGI Symbol;Acc:MGI:107931][more]
Sqstm14.868e-642.31sequestosome 1 [Source:MGI Symbol;Acc:MGI:107931][more]
Herc25.656e-650.00HECT and RLD domain containing E3 ubiquitin protei... [more]
Herc25.658e-650.00HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Sequestosome 1 like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sequestosome 1 like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DLT77.596e-928.13Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G1S21.567e-829.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GQI01.591e-829.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G1X24.869e-828.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A165F9Y46.149e-843.28Uncharacterized protein OS=Laetiporus sulphureus 9... [more]
back to top
BLAST of Sequestosome 1 like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
herc25.559e-647.06HECT and RLD domain containing E3 ubiquitin protei... [more]
sqstm18.576e-636.54sequestosome 1 [Source:ZFIN;Acc:ZDB-GENE-040426-22... [more]
back to top
BLAST of Sequestosome 1 like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sequestosome 1 like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sequestosome 1 like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO424823.659e-735.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410975.246e-651.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sequestosome 1 like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sqstm15.033e-738.46sequestosome 1 [Source:NCBI gene;Acc:101166287][more]
back to top
BLAST of Sequestosome 1 like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058620.10.000e+097.64SMESG000058620.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018888 ID=SMED30018888|Name=Sequestosome 1 like|organism=Schmidtea mediterranea sexual|type=transcript|length=1256bp
GTCTTGTATCAAGTCACCTGATAATTACAAAAAATTTGATTGAATTTTAA
ATTTCTTTATCAATTGATTAATTAATATTTATTTGTCAAAATTATTTTGT
CTCTTAATAAACCAAAAATATTATTATTAGGTTCTAATTAAATTAAATTG
TTTATTAAAATTTTAATTTTAATAATAATTTAATTTTAATTCATAAATAT
TATTAAGATTTATTATTTAGTAAGCAAATGGAATTCAAAATACGATATAT
TAATTCTTATAAAATTAATGAAATTGACACAAGACGTATTTGTGTTGATT
GCAAGTCATTTACGTATTATGATTTTAAATGTTATCTAAAAAATTTGATA
AATTTAAAAGAAACAGATGAAATTTGTATCAAATTGAAAGAAGACAATAA
AATTTTGATAACTGAGTCTGATTGGATAGATTTGGTTTCTTCCAATTCAG
AAAATCGAATAATTAAATTGAGTGTTTATTTCGGCAATGTCCACATGAAT
GTAGAATGTGATTATTGCCGGGAATTTATTGTTGGCGACAGATTCAAGTG
TTTGGAATGTGATGACTATGATATCTGTCAAATGTGCTTTCATAGCGTCC
CTCGAATCCACTCGGAACACTGTATAATCTTGTTAAGGAAACCTGAGGAT
AGAAATAAATTCATCAAATCCATTCCATATAGAATGGAGAATGGATCAGA
TTTCCGAGTTGTAGATATCGATATCGGCGCATTAATCGGCAGTCACCAGG
CAAGTGAGAAACTGGATAACTCCAGTCAGACAGATTCTCGGATTTCTCCA
CCCCTTGTCGACGCTCCGGATAAATCTCAATCTATTTATCATTCGATTGA
TAAAGATAAAAGCTCATTTGAAATCTTGGACGCTGAAATGCCAATGAAAA
GCGGAGAAAGACAAAATTGTGAAAAGCACAAAATGAATGCCAGAACGTTA
AATGATGTTTTACAAGATCAAAATTGCGCGCCGGTTTCCAAAGAGTATTT
AGAAAGTCTGCCGGCTGAAATTCTCGAATCTGTTGAGAAATTAAAATCGA
TGGGATTTACAAATATTAATGGTACTTTGATTGCACTTCTCGTAGCTCAC
ATGGAAATGTTTTTCGAGTTCTCGAGGAATTGGATTATTCAACGAAGCAT
AACTGAATATCACCTGAGTTCTATAATTAGATTGACATTTTTGGCATTGC
TCTCAGATTTTATATACAAGGAAAACAATTTTTCATAATATATCATACAT
GGCAGA
back to top

protein sequence of SMED30018888-orf-1

>SMED30018888-orf-1 ID=SMED30018888-orf-1|Name=SMED30018888-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MEFKIRYINSYKINEIDTRRICVDCKSFTYYDFKCYLKNLINLKETDEIC
IKLKEDNKILITESDWIDLVSSNSENRIIKLSVYFGNVHMNVECDYCREF
IVGDRFKCLECDDYDICQMCFHSVPRIHSEHCIILLRKPEDRNKFIKSIP
YRMENGSDFRVVDIDIGALIGSHQASEKLDNSSQTDSRISPPLVDAPDKS
QSIYHSIDKDKSSFEILDAEMPMKSGERQNCEKHKMNARTLNDVLQDQNC
APVSKEYLESLPAEILESVEKLKSMGFTNINGTLIALLVAHMEMFFEFSR
NWIIQRSITEYHLSSIIRLTFLALLSDFIYKENNFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000433Znf_ZZ
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0042802identical protein binding
GO:0043130ubiquitin binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005776autophagosome
GO:0016235aggresome
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0016239positive regulation of macroautophagy