Dynein intermediate chain 2, ciliary

Overview
NameDynein intermediate chain 2, ciliary
Smed IDSMED30018869
Length (bp)2209
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein intermediate chain 2, ciliary (SMED30018869) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein intermediate chain 2, ciliary (SMED30018869) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein intermediate chain 2, ciliary (SMED30018869) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein intermediate chain 2, ciliary (SMED30018869) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018869

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018869h1SMcG0017057 SmedASXL_005616SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018869h1SMcG0017057 SmedASXL_019522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018869h1SMcG0017057 SmedASXL_000970SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018869h1SMcG0017057 dd_Smed_v4_11393_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018869h1SMcG0017057 dd_Smed_v4_11393_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018869h1SMcG0017057 dd_Smed_v4_11393_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018869h1SMcG0017057 dd_Smed_v6_11393_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018869h1SMcG0017057 dd_Smed_v6_59373_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30018869h1SMcG0017057 Contig36348uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018869h1SMcG0017057 Contig36348newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 394.43 bits (1012), Expect = 1.649e-126
Identity = 238/665 (35.79%), Postives = 371/665 (55.79%), Query Frame = 2
Query:   44 KPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHY---QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSN------LSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQT-------STTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            +P ++  S     +++D+D  T+   + E  D +   +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YKP+ +++   +H++   NL+ KDS E          ++V       SV +  E       E  ++  +   SQT       +    +E           K +NQF +  RA+QT NNP++ +  Q+E PPR  FS   +Q  IYD+Y  + ++Q +  +        ++K      ++++ + E    D+  +    KI+ERM+N NT+D+IAQDF YY+D ADE+R D  GTLLPLWKF  DK ++L VT++ W+  Y+DLF V +G Y+ +  + +G +  YSLKNPS+PEY   + S V+ +D++++   L+  G  DG V I +L +K  S P     S+  S KH DP WQVKW   + D  + F+S+SSDGRI  W++ K +L   D++ L+      ++ E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  + W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT D K  ++D +IN+ E +  Q V + K++  LT + F+  +PII++GD R +
Sbjct:   12 QPHKQSISIGRGTRKRDEDSGTE---VGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAVSYQGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSM-ESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYR-DQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMK-QSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNL-KKPHSQP--SFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNR--LTHVQFNLIHPIIIVGDDRGH 656          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 394.045 bits (1011), Expect = 1.769e-126
Identity = 233/663 (35.14%), Postives = 370/663 (55.81%), Query Frame = 2
Query:   44 KPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHY---QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            +P ++  S     +++D+D  T+   + E  D +   +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YKP+ +++   +H++   NL+           Y+D + A S  SV    +  + +L  + +   +      +     +  +    +E           K +NQF +  RA+QT NNP++ +  Q+E PPR  FS   +Q  IYD+Y  + ++Q +  +        ++K      ++++ + E    D+  +    KI+ERM+N NT+D+IAQDF YY+D ADE+R D  GTLLPLWKF  DK ++L VT++ W+  Y+DLF V +G Y+ +  + +G +  YSLKNPS+PEY   + S V+ +D++++   L+  G  DG V I +L +K  S P     S+  S KH DP WQVKW   + D  + F+S+SSDGRI  W++ K +L   D++ L+      ++ E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  + W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT D K  ++D +IN+ E +  Q V + K++  LT + F+  +PII++GD R +
Sbjct:   12 QPHKQSISIGRGTRKRDEDSGTE---VGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISE--TGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSM-ESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYR-DQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMK-QSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNL-KKPHSQP--SFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNR--LTHVQFNLIHPIIIVGDDRGH 652          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 169.474 bits (428), Expect = 3.265e-43
Identity = 119/365 (32.60%), Postives = 185/365 (50.68%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMA-------FYSISSDGRICEWSVNKYELNCQDIVALRQI----NLPIDMETVADRFLES----GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNP-LFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS D T+ L V+S+ W+    DL  V +G +    F+EQ  G  C +S+KNP +PE    +   V A+D +I    L+  G  +G + I ++  +S+SN V  L S+   +KH  P WQ++W  IE+D             SIS+DGRI +W + K  L+C D++ L++     N     +   D  L S    G C A HPK  + +L GT++G+I+       +   N  Y  T+    HK  +Y++ W+ +  D+F SCSADW + IW      P L        V  +AW+P SS + AA   +R V ++D  I+ L+PL   +V ++   +  T I+F+     +L+GDS     +Y
Sbjct:  475 LWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHF---GFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNV--RSNSN-VPVLDSSESPQKHLGPVWQLQW--IEQDRGTTGDGKREILVSISADGRISKWVIRK-GLDCYDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIH-----KCSCSYNEQYLDTYRG--HKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENR-VEIWDLHISTLDPL---IVNTANPGIKFTTILFAKQTDCLLVGDSDGQVSVY 819          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 140.969 bits (354), Expect = 1.765e-34
Identity = 109/365 (29.86%), Postives = 167/365 (45.75%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMA-------FYSISSDGRICEWSVNKYELNCQDIVALRQI----NLPIDMETVADRFLES----GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNP-LFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS D T+ L V+S+ W+    DL  V +G +    F+EQ  G  C +S+KNP +PE    +   V A+D +I    L+  G  +G + I ++  +S+SN V  L S+   +KH  P WQ++W  IE+D             SIS+DGRI +W + K  L+C D++ L++     N     +   D  L S    G C A HPK                                          +Y++ W+ +  D+F SCSADW + IW      P L        V  +AW+P SS + AA   +R V ++D  I+ L+PL   +V ++   +  T I+F+     +L+GDS     +Y
Sbjct:  241 LWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHF---GFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNV--RSNSN-VPVLDSSESPQKHLGPVWQLQW--IEQDRGTTGDGKREILVSISADGRISKWVIRK-GLDCYDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKGP----------------------------------------VYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENR-VEIWDLHISTLDPL---IVNTANPGIKFTTILFAKQTDCLLVGDSDGQVSVY 552          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 122.479 bits (306), Expect = 3.517e-30
Identity = 84/281 (29.89%), Postives = 145/281 (51.60%), Query Frame = 2
Query:   86 RKDDDFYTKDPTLNENEDHY---QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQ 886
            ++D+D  T+   + E  D +   +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YKP+ +++   +H++   NL+           Y+D + A S  SV    +  + +L  + +   +      +     +  +    +E           K +NQF +  RA+QT NNP++ +  Q+E PPR  FS   +Q  IYD+Y  + ++Q +  +        ++K      ++++ + E    D+  +    KI+ERM+N NT+D+IAQ
Sbjct:   15 KQDEDSGTE---VGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISE--TGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSM-ESQTDDLIKLSQAAKIMERMVNQNTYDDIAQ 289          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Match: dyci-1 (DYnein Chain, light Intermediate [Source:UniProtKB/TrEMBL;Acc:O45087])

HSP 1 Score: 82.4185 bits (202), Expect = 5.070e-16
Identity = 96/431 (22.27%), Postives = 182/431 (42.23%), Query Frame = 2
Query:  836 KILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKT--RKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSY-PEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADR--FLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWH--------PDIFASCSADWTIGIWNCRQSN--------PLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIYFSKITFLHEYIVKQYLFKIFQARI 2065
            K++ R +N    +EI    +Y +DP +  +  +   LL L +   D+T   K  VT + +S  Y DL  VS+G  +I + E  G I  ++ K+     E+ ++ +S + ++        L+ AG   G + +      S   P+ R      +  +   C  V    +   N   F S+S DGRIC W+V+              +  P+D + +  +     S T ++    +  TF+VGT  G I       +  ++ +D ++   +  +K     L    +H          +F S S DWT+ +W+ + +N        P  VLD       +AW+P    V A++  D  + V++ + +   P+     G+    V + ++++S +   + +GD      +Y  + +    Y++K   +  F AR+
Sbjct:  238 KVISRALN----EEIDICINYTKDPYE--KAIASDDLLHLAQVYQDETWTAKRLVTGMAFSEHYPDLLAVSYGPCDIPN-EPPGVIVVWNTKSKRMTAEFIVYCQSEIQSVAFARFHAHLLLAGCESGQICVWDNRLTSRKLPINRSPLTTQAHTYTVSCLAV----VGTKNAHNFVSLSRDGRICSWNVD-------------NLTQPVDGKELMTKEGKAASATRMSFPIGEMQTFVVGTDTGEIL------AASRNGADPAVIKTDVCYKGHSGTLTGIEFHRASGVVDFSHLFISSSHDWTVKLWSTKDANLKFSFESHPDLVLD-------VAWSPVHPAVFASIDADGNIFVWNLNEDVEGPVARLRAGAEGESVYMNRLIWSPDGKHVFVGDDEGRVHMYDVRESL---YVLKSEEWNRF-ARV 627          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 50.447 bits (119), Expect = 2.983e-6
Identity = 42/177 (23.73%), Postives = 76/177 (42.94%), Query Frame = 2
Query: 1487 ESGTCIALHPKKYHTFLVGTQDGNI-YYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFA-VTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILI--GDSRFYYFIYFSKI 2005
            + G  ++ +P K    L  + D  + ++ +  N N+         F    H+ ++  + W   H  +F S   D  + IW+ R S P   +D   A V  +A+ PYS  +LA  + D+ V ++D     L  L  ++     H+  + Q+ +S +   IL   G  +  +    SKI
Sbjct:  173 KEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKG--HESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWD-----LRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKI 342          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0071521)

HSP 1 Score: 310.842 bits (795), Expect = 9.836e-95
Identity = 183/484 (37.81%), Postives = 264/484 (54.55%), Query Frame = 2
Query:  551 NQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPI--------LPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESG-TCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            NQF YC R   T  NP +   TQ+  PPR  F  N+ Q VIYDSY              + NF  SQK     ++R     EK F D + I        L   +ILERMIN N +D+IA D+ Y+EDPADEFR +  G LLPLWKF +DKT+K+ VT I+++  Y DLF V  G ++ +    +G +C +++KNPS+P+Y + T   V+  D++     L   GL DG V + +L E       +    N    KH +  WQ+KW     D  + F+S+SSDGR+  W + + +L    I+ L + N  +D        L+SG +C+  HP     FLVGT+ G IY   T  S     S Y MT+    H M +Y++ ++ ++ +IF SC ADW + +W   + +PLF+ DLG AV  + WAPYSSTV AAVT + KV V+D ++N+ + +  Q V   K K  LT++ F++    I++GD +
Sbjct:  221 NQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSY--------------MENFAESQKDGTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFR-EGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNC---KHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQNKLWVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFS-----SKYLMTYY--AHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAV-VPKRKNKLTRLSFNEKLAFIVVGDEK 678          

HSP 2 Score: 63.1586 bits (152), Expect = 6.947e-10
Identity = 38/107 (35.51%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQEN 466
            + L+KP DQL+LTE EL EEITKVL  TN     N+V Y+FKE ++ P P   +T    +   N ++ DS E    +      + + +  P+      V+E  E +N
Sbjct:   43 RQLLKPDDQLDLTEAELGEEITKVLTPTNTNIVRNLVVYSFKEGEFVPAPLPGNTVTLIAFAGNSLHVDSDEGRRQIE-----ESDEIGYPLPMPNYTVVEQRETDN 144          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0345666)

HSP 1 Score: 310.842 bits (795), Expect = 9.836e-95
Identity = 183/484 (37.81%), Postives = 264/484 (54.55%), Query Frame = 2
Query:  551 NQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPI--------LPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESG-TCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            NQF YC R   T  NP +   TQ+  PPR  F  N+ Q VIYDSY              + NF  SQK     ++R     EK F D + I        L   +ILERMIN N +D+IA D+ Y+EDPADEFR +  G LLPLWKF +DKT+K+ VT I+++  Y DLF V  G ++ +    +G +C +++KNPS+P+Y + T   V+  D++     L   GL DG V + +L E       +    N    KH +  WQ+KW     D  + F+S+SSDGR+  W + + +L    I+ L + N  +D        L+SG +C+  HP     FLVGT+ G IY   T  S     S Y MT+    H M +Y++ ++ ++ +IF SC ADW + +W   + +PLF+ DLG AV  + WAPYSSTV AAVT + KV V+D ++N+ + +  Q V   K K  LT++ F++    I++GD +
Sbjct:  221 NQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSY--------------MENFAESQKDGTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFR-EGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNC---KHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQNKLWVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFS-----SKYLMTYY--AHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAV-VPKRKNKLTRLSFNEKLAFIVVGDEK 678          

HSP 2 Score: 63.1586 bits (152), Expect = 6.947e-10
Identity = 38/107 (35.51%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQEN 466
            + L+KP DQL+LTE EL EEITKVL  TN     N+V Y+FKE ++ P P   +T    +   N ++ DS E    +      + + +  P+      V+E  E +N
Sbjct:   43 RQLLKPDDQLDLTEAELGEEITKVLTPTNTNIVRNLVVYSFKEGEFVPAPLPGNTVTLIAFAGNSLHVDSDEGRRQIE-----ESDEIGYPLPMPNYTVVEQRETDN 144          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0342788)

HSP 1 Score: 310.842 bits (795), Expect = 1.017e-94
Identity = 183/484 (37.81%), Postives = 264/484 (54.55%), Query Frame = 2
Query:  551 NQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPI--------LPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESG-TCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            NQF YC R   T  NP +   TQ+  PPR  F  N+ Q VIYDSY              + NF  SQK     ++R     EK F D + I        L   +ILERMIN N +D+IA D+ Y+EDPADEFR +  G LLPLWKF +DKT+K+ VT I+++  Y DLF V  G ++ +    +G +C +++KNPS+P+Y + T   V+  D++     L   GL DG V + +L E       +    N    KH +  WQ+KW     D  + F+S+SSDGR+  W + + +L    I+ L + N  +D        L+SG +C+  HP     FLVGT+ G IY   T  S     S Y MT+    H M +Y++ ++ ++ +IF SC ADW + +W   + +PLF+ DLG AV  + WAPYSSTV AAVT + KV V+D ++N+ + +  Q V   K K  LT++ F++    I++GD +
Sbjct:  222 NQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSY--------------MENFAESQKDGTKKEERKRGKREKKFRDKSAIAEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFR-EGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNC---KHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQNKLWVTTIITLYRENGLVDGPDGTKVTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFS-----SKYLMTYY--AHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAV-VPKRKNKLTRLSFNEKLAFIVVGDEK 679          

HSP 2 Score: 63.1586 bits (152), Expect = 7.133e-10
Identity = 38/107 (35.51%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQEN 466
            + L+KP DQL+LTE EL EEITKVL  TN     N+V Y+FKE ++ P P   +T    +   N ++ DS E    +      + + +  P+      V+E  E +N
Sbjct:   44 RQLLKPDDQLDLTEAELGEEITKVLTPTNTNIVRNLVVYSFKEGEFVPAPLPGNTVTLIAFAGNSLHVDSDEGRRQIE-----ESDEIGYPLPMPNYTVVEQRETDN 145          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072538)

HSP 1 Score: 82.4185 bits (202), Expect = 6.856e-16
Identity = 94/357 (26.33%), Postives = 150/357 (42.02%), Query Frame = 2
Query:  974 KTRKLPVTSIIWSSFYKDLFVVSHGMYEIVS--FEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKD-----NIMAFYSISSDGRICEWSVNK--YELNCQDIVALRQINLP--IDMETVADRFLES-----GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLF-VLDLGFAVTSIAWAPYSSTVLAAVTVDRK-VRVYDFSINRLEPLVCQVVGSSKHKVSL---TQIVFSDNYPIILIGDSR 1975
            K  +  V+ I +     D+  V++G+Y   S      G++  +S+KNP  PE   +   PV AI+ +     L+  GL DG V +    + SS        S   +     P   ++W+    D     +I  F S+S DG +  + + K  + L    ++  R    P  I +   +    ES     G  I  HP     + V T +G I+         K + +Y   + E    H   +  + +S W P +F +C  DW + IW    + PL  +LD    V    W+P  ST++  VTV+R+   V+DF  N L P+       SKHK+     T   FS     ++IG+ R
Sbjct:  294 KDERKAVSDIDFCRSNGDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEV---RDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDIYYVLTDEGCIH---------KCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTII--VTVNRETANVWDFRRNLLRPM-------SKHKMDSSFNTVARFSHCGRTLVIGNER 629          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072539)

HSP 1 Score: 81.6481 bits (200), Expect = 1.152e-15
Identity = 96/360 (26.67%), Postives = 152/360 (42.22%), Query Frame = 2
Query:  974 KTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ-----GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKD-----NIMAFYSISSDGRICEWSVNK--YELNCQDIVALRQINLP--IDMETVADRFLES-----GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLF-VLDLGFAVTSIAWAPYSSTVLAAVTVDRK-VRVYDFSINRLEPLVCQVVGSSKHKVSL---TQIVFSDNYPIILIGDSR 1975
            K  +  V+ I +     D+  V++G+Y   SF  Q     G++  +S+KNP  PE   +   PV AI+ +     L+  GL DG V +    + SS        S   +     P   ++W+    D     +I  F S+S DG +  + + K  + L    ++  R    P  I +   +    ES     G  I  HP     + V T +G I+         K + +Y   + E    H   +  + +S W P +F +C  DW + IW    + PL  +LD    V    W+P  ST++  VTV+R+   V+DF  N L P+       SKHK+     T   FS     ++IG+ R
Sbjct:  374 KDERKAVSDIDFCRSNGDILAVAYGLY---SFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEV---RDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDIYYVLTDEGCIH---------KCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTII--VTVNRETANVWDFRRNLLRPM-------SKHKMDSSFNTVARFSHCGRTLVIGNER 709          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 409.068 bits (1050), Expect = 5.939e-133
Identity = 238/614 (38.76%), Postives = 353/614 (57.49%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVH-EKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQIN-LPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            +TLVKPPDQL+LTE+EL+EEIT+VL A NP AP N+V+Y+FKE  YK + ++D   IHF ++ NLV+K+S E    ++     +D      +E   N+ ++  ++E                          K +NQF +  RA+QTLNN  +    Q+E PPR  FS   +Q  IYD Y  + +R+ +  + + + F   ++    D+ +  ++  E    DI+ +    KI+ERM+N N FDE+AQDF Y+ED ADEFR +  GTLLPLWKF +DK + L VT++ W+  Y DLF V  G YE    +E+G +  Y+LKNPS+PE+   T S V+ +D++     L+  GL DG V +  L +KS       ++S   S KH    WQVKW   + D+   F+S+S+DGR+  W++ K+E+   DI+ L  ++ +P D++ V      +GT +  H +K H FLVGT+ G I+         K +  YS  F E  + H M +  + W+ +HP++F SC  DW + IW+   ++P+F  +L  +VT +AW+PYSSTV AAVT D KV V+D SIN+ E L  Q V S K +  L  I F+  +PII++GD R
Sbjct:   55 KTLVKPPDQLDLTEEELKEEITRVLTANNPNAPQNVVRYSFKEGCYKTIVFVDQMAIHFELEGNLVHKESDEGRRLMAKHTEREDCGGDERLE---NVPIKPGKREQ-------------------------KVTNQFNFIDRASQTLNNLPREISCQTEPPPRANFSATANQWEIYDFYVEELQRREKSKEKQESQFPNKEE----DRSKKKMIQAEAQSDDISQLAKPAKIIERMVNQNIFDEVAQDFMYFEDAADEFRGEK-GTLLPLWKFQYDKAKGLSVTALCWNHIYSDLFAVGLGSYEFTQ-QERGMLLFYTLKNPSFPEFIFNTDSGVMCVDIHEQLSYLVAVGLYDGCVSVYDLRKKSDQPMYNSIAS---SGKHTGAVWQVKWQKDDLDSNHNFFSVSTDGRVVSWTLVKHEIVFTDIIKLPPVDKVPDDLKNVV---ATAGTSLDFHKQKDHHFLVGTEAGKIH---------KGSKYYSSKFLEMYDAHFMTVSCVRWNPFHPNVFISCGWDWMVKIWDHTINSPVFTFELKSSVTDVAWSPYSSTVFAAVTADGKVHVFDLSINKYEALCQQKVVSKKTR--LLHIEFNPVHPIIIVGDDR 617          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 258.455 bits (659), Expect = 1.478e-76
Identity = 187/606 (30.86%), Postives = 296/606 (48.84%), Query Frame = 2
Query:  185 EQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKM-FSDNLDQSVIYDSYEIDF-KRQNRINKSRLTN--FGGSQKIIVPDKKRISLVHE---KHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQIN-LPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE-NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            E  L E+   + +A   AA  ++++++FKE  +KPV   D   I   ++ +LV+KDS                                  +E   + ++                   KS   F     ATQT  NP +    Q+E  P  + +S   +Q  IYD Y+ +  KR +   K    N    G++ +       +SL+ +   K   D+  +    K+LE  +N N   +I  DF ++ED ADEFR D  GTLLPLW+F ++K + L V+++ W+  Y DLF V  G ++    E  G +  Y+ +N ++PE+   T S V+ +D++     L+  GL +G V + +L  K    P+   +S   S KH    WQVKW   +      F+S+S+DGR+  W++ KYEL   +I+ L  ++ +P D+  V    + +G  +  H +K + FLVGT+ G I+         K ++ Y+        H  ++  + W+ ++P +F +C  DW + IW+    +P+F  DL  +V  +AWAPYSSTV AAVT D KV V+D SINR E L  Q V S+K    LT I F+  +PII++G+ R
Sbjct:   10 ESNLSEKTVVLRRARLNAATSSLMRFSFKECCFKPVA--DEPDIE--IEGSLVHKDS----------------------------------EEGQILCAEKEV--------------GRKSKTLFSCITTATQTTINPPREVACQTESQPLLVNYSATANQWEIYDFYQEELQKRTSSTKKDEKENEIAEGAEGV----HGNLSLLRDFTDKSDHDLAMLSTAAKLLEYAVNENINGDIIADFKHFEDEADEFRGDK-GTLLPLWEFQYNKVKSLHVSALCWNKKYNDLFAVGLGSHKFTELE-CGMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLMAKDD-QPI--YNSMASSGKHSGTVWQVKWWEDDLYGNHTFFSVSADGRVVSWTLGKYELFSTNIIKLPPMDKVPDDLNNV---IVTAGLTLDFHKQKPYHFLVGTEAGKIH---------KGSTHYTRFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDETTDSPVFTFDLKSSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKRH--LTCIEFNPVHPIIIVGNDR 540          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 254.603 bits (649), Expect = 2.671e-75
Identity = 165/489 (33.74%), Postives = 255/489 (52.15%), Query Frame = 2
Query:  536 SNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKM-FSDNLDQSVIYDSYEIDFKRQNRINK--SRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEI----AQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQIN-LPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE-NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
              KS   F     ATQT  NP +    Q+E  P  + +S   +Q  IYD Y+ + +++    K  S  +N    Q+I          +   H  D+  +    K+LE  +N N   +I      DF ++ED ADEFR D  GTLLPLW+F ++K + L V+++ W+  Y DLF V  G ++    E  G +  Y+ +N ++PE+   T S V+ +D++     L+  GL +G V + +L  K    P+   +S   S KH    WQVKW   +      F+S+S+DGR+  W++ KYEL   +I+ L  ++ +P D+  V    + +G  +  H +K + FLVGT+ G I+         K ++ Y+        H  ++  + W+ ++P +F +C  DW + IW+    +P+F  DL  +V  +AWAPYSSTV AAVT D KV V+D SINR E L  Q V S+K    LT I F+  +PII++G+ R
Sbjct:   43 GRKSKTLFSCITTATQTTINPPREVACQTESQPLLVNYSATANQWEIYDFYQEELQKRTSSTKKCSHNSNIQKIQQIARNKNSIFGRIMSDH--DLAMLSTAAKLLEYAVNENINGDIIAAQTSDFKHFEDEADEFRGDK-GTLLPLWEFQYNKVKSLHVSALCWNKKYNDLFAVGLGSHKFTELE-CGMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLMAKDD-QPI--YNSMASSGKHSGTVWQVKWWEDDLYGNHTFFSVSADGRVVSWTLGKYELFSTNIIKLPPMDKVPDDLNNV---IVTAGLTLDFHKQKPYHFLVGTEAGKIH---------KGSTHYTRFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDETTDSPVFTFDLKSSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKRH--LTCIEFNPVHPIIIVGNDR 510          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 160.999 bits (406), Expect = 1.005e-40
Identity = 107/357 (29.97%), Postives = 182/357 (50.98%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLS--SNMHSKKHRDPCWQVKWLPIEKDNIMA-----FYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNEN--IHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVT-SIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS + T    V+ ++W+    DL  V +G  E  +    G +C +SLKNP++P+     +S V A+D + ++   +  G+ DG + I ++ + S   P+   S  +N+H+     P WQ+ W+  E D + A       S+SSDGRI +W ++   + C D++ L+  +L       +   L  G C   HP     +LVGT++G+I+         K +S Y+  + E+   HK  +Y++ WS +  D+F SCS+DWTI +W      P+     G  V   I W+P+ +TV  AV+ + KV ++D  ++ L+P    +V  +   V+ T ++FS     +L+GDS     +Y
Sbjct:  418 LWDFSCELTMGRNVSCMVWNKKNPDLLAVGYGQVEFKN-PNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNV-QTSEQTPITDSSDCANLHTS----PVWQLTWIDHE-DGLAADKGEILVSVSSDGRISKW-IHYKSMECVDLMKLKIHDLQWKRHISS---LTPGMCFDFHPNDSKIYLVGTEEGHIH---------KCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAVS-EGKVEIWDLRVSSLDPT---LVNWTSPGVNPTALLFSPETDCVLVGDSEGQVTVY 750          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 160.999 bits (406), Expect = 1.005e-40
Identity = 107/357 (29.97%), Postives = 182/357 (50.98%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLS--SNMHSKKHRDPCWQVKWLPIEKDNIMA-----FYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNEN--IHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVT-SIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS + T    V+ ++W+    DL  V +G  E  +    G +C +SLKNP++P+     +S V A+D + ++   +  G+ DG + I ++ + S   P+   S  +N+H+     P WQ+ W+  E D + A       S+SSDGRI +W ++   + C D++ L+  +L       +   L  G C   HP     +LVGT++G+I+         K +S Y+  + E+   HK  +Y++ WS +  D+F SCS+DWTI +W      P+     G  V   I W+P+ +TV  AV+ + KV ++D  ++ L+P    +V  +   V+ T ++FS     +L+GDS     +Y
Sbjct:  418 LWDFSCELTMGRNVSCMVWNKKNPDLLAVGYGQVEFKN-PNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNV-QTSEQTPITDSSDCANLHTS----PVWQLTWIDHE-DGLAADKGEILVSVSSDGRISKW-IHYKSMECVDLMKLKIHDLQWKRHISS---LTPGMCFDFHPNDSKIYLVGTEEGHIH---------KCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAVS-EGKVEIWDLRVSSLDPT---LVNWTSPGVNPTALLFSPETDCVLVGDSEGQVTVY 750          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 167.933 bits (424), Expect = 5.542e-43
Identity = 123/413 (29.78%), Postives = 201/413 (48.67%), Query Frame = 2
Query:  824 LPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLP----LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIM-----AFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETV------ADRFLES---GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENI--HKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LPV+ I    +++N+F        Y+E+  D+    S   + P    LW F+ D T+   V+SI W+    DL  V +G +    F EQ  G  C +SLKN  +PE     +  V A+D +     L+  G+ +G V I ++ + +   PV+  S N    KH  P WQ+KW+  ++ N+         S+ +DGRI  W + K  L+C D++ L++       ++        + F+     G C    PK  + +L GT++G+I+         K +  Y+  F +    HK  +Y++ WS + PD+F SCSADW I +W     +P+    +   AV  I W+P S+ +  AVT +R V ++D   + ++PL   +V  +   V LT I+F+ N   +LIGDS     +Y
Sbjct:  326 LPVI-INPEGVHMNSFLAF-----YHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQF---GFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNV-QNNEDFPVLDSSDN--PNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWHIRK-GLDCNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIH---------KCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTENR-VEIWDLGTSTIDPL---IVNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVY 712          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 166.007 bits (419), Expect = 3.764e-42
Identity = 121/413 (29.30%), Postives = 200/413 (48.43%), Query Frame = 2
Query:  842 LERMINLNTFDEIAQDF------SYYEDPADEFRFDSHGTLLP----LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIM-----AFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETV------ADRFLES---GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENI--HKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            +ER++  NTF      +      + +E+  D+    S   + P    LW F+ D T+   V+SI W+    DL  V +G +    F EQ  G  C +SLKN  +PE     +  V A+D +     L+  G+ +G V I ++ + +   PV+  S N +  KH  P WQ+KW+  ++ N+         S+ +DGRI  W + K  L+C D++ L++       ++        + F+     G C    PK  + +L GT++G+I+         K +  Y+  F +    HK  +Y++ WS + PD+F SCSADW I +W     +P+    +   AV  I W+P S+ +  AVT +R V ++D   + ++PL   +V  +   V LT I+F+ N   +LIGDS     +Y
Sbjct:  375 MERVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQF---GFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNV-QNNEDFPVLDSSDNPN--KHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWHIRKG-LDCNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIH---------KCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTENR-VEIWDLGTSTIDPL---IVNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVY 767          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 165.622 bits (418), Expect = 4.419e-42
Identity = 121/413 (29.30%), Postives = 200/413 (48.43%), Query Frame = 2
Query:  842 LERMINLNTFDEIAQDF------SYYEDPADEFRFDSHGTLLP----LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIM-----AFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETV------ADRFLES---GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENI--HKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            +ER++  NTF      +      + +E+  D+    S   + P    LW F+ D T+   V+SI W+    DL  V +G +    F EQ  G  C +SLKN  +PE     +  V A+D +     L+  G+ +G V I ++ + +   PV+  S N +  KH  P WQ+KW+  ++ N+         S+ +DGRI  W + K  L+C D++ L++       ++        + F+     G C    PK  + +L GT++G+I+         K +  Y+  F +    HK  +Y++ WS + PD+F SCSADW I +W     +P+    +   AV  I W+P S+ +  AVT +R V ++D   + ++PL   +V  +   V LT I+F+ N   +LIGDS     +Y
Sbjct:  375 MERVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQF---GFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNV-QNNEDFPVLDSSDNPN--KHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWHIRKG-LDCNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIH---------KCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTENR-VEIWDLGTSTIDPL---IVNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVY 767          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: rwdd2b (RWD domain containing 2B [Source:Xenbase;Acc:XB-GENE-963133])

HSP 1 Score: 78.5666 bits (192), Expect = 1.343e-14
Identity = 79/328 (24.09%), Postives = 150/328 (45.73%), Query Frame = 2
Query:  980 RKLPVTSIIWSSFYKDLFVVSHGMYEIVSFE-EQGAICGYSLK----NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIE-KDNIMAFYSISSDGRICEWSVNK---------YELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMT----------FNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFA-VTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVC 1885
            ++L VTS+ W+S    +   S+G +    +  E+  +C ++L     N + P+  L   S V+ +  + +   LI  GL +G V++       + +P+I  + ++    H D  +QV W+  + + +    +S+SSDG+I  W + K         + L  Q I +  +I+ P   +T         TC++        F+VG + G   Y L  +S++++ +  +M           F  + H   +Y +  S +H ++F S   D    +++  Q+ PL  L L    + SI W+P    V AA + D +V + DF+ +  +P +C
Sbjct:  127 QQLQVTSVSWNS-TGSIIACSYGRFGDGDWSTEKSYVCTWNLDRRGFNANNPDTVLDVPSSVMCLAWHPSQPSLIAGGLFNGDVLV--WDTSRTDDPLIGRTGHV-GDTHTDAVYQVGWMQEKSQGHRHQVFSVSSDGKILVWQMEKEGHLVLLDGFALVAQQIPSNTKIHKPGRGDTAVGV-----TCLSYSHFDPSLFIVGVEGG---YLLKCSSSVQTLAPINMGSSVPLRAPAQFTFSPHGGPVYSVTCSPFHRNLFLSAGTDGHAHLYSMLQAKPLVSLQLSQKYLFSIRWSPVRPLVFAAASGDGEVVLVDFAKSFQKPSLC 442          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 77.7962 bits (190), Expect = 3.571e-14
Identity = 72/294 (24.49%), Postives = 124/294 (42.18%), Query Frame = 2
Query: 1094 YSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIW--NCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEP-LVCQVVGSSKHKVSLTQIVFSDNYPIILIG 1966
            + ++ P+ PE TL   SP++ ++ N  D  ++  G  +G   I     +   NP   + S +    HRDP ++V WL  +       +S S+DG+I  W + K     + ++      L I  +   D  L     +   P     F+VGT+ G I   ++ N   K+  +  +      H   IY +  + ++P  F +   DWT  IW  +CR+S+ ++       +T   W+P   TV     +D  + V+D+   +  P L  +V G       L  I   DN   +  G
Sbjct:  233 WDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNG--QIAYWDTRKGGNP---MESTVIEHSHRDPVYKVIWL--QSKTGTECFSASTDGQILWWDIRKLSEPTEKLI------LDISKKENLDNAL-GAVSLEFEPTLPTKFMVGTEQGMI---VSCNRKAKTPPE-KIVCTYGGHHGPIYSIQRNPFYPKNFLTV-GDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLSVKVSGE-----PLYSIRMQDNGRFVACG 502          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Dnaic1 (dynein, axonemal, intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1916172])

HSP 1 Score: 409.453 bits (1051), Expect = 1.788e-132
Identity = 247/670 (36.87%), Postives = 361/670 (53.88%), Query Frame = 2
Query:   35 MPLKPFEKRK-SNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENL------EQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            MP K   K+  S     +R+D+D  T      +     +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YK + +++   +HFS   NL+           Y+D M A S  S+     +       E       E         Q +    ++T+    +E           K +NQF +  RA+QT NNPL+ +  Q E PPR  FS   +Q  IYD+Y +D   +    K +        K       R     E    DIT +    KI+ERM+N NT+D++AQDF YYED ADE+R D  GTLLPLWKF  DK ++L VT++ W+  YKDLF V HG Y+ +  + +G +  YS+KNPS+PEY   ++S ++ +D++++   L+  G  DG V I +L +K  S P  R +S   S KH DP WQVKW   + D+ + F+S+SSDGRI  W++ K EL   DI+ L+      ++ E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  ++W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT D K  V+D ++N+ E +  Q V  +K K  +T + F+  +PII++GD R +
Sbjct:    1 MPSKQIRKQSISVTRGARRRDEDSGTDVGEGTDEWSQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKLIGFVNQMAVHFSQVGNLIPKDSDEGRRQHYRDEMVAGSQESIKVVTSEAENLEEEEEPKEGEGEAEAEAEAGSQTDIPAAAETTEKVIEEELMAPVQPKERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAY-VDELEKQEKTKEKEKAKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDTADEYR-DQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMK-QSRGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNL-KKPHSQPCFRSTSK--SGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDIIKLKTEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYMFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPV-VAKKKNKITHVQFNPIHPIIIVGDDRGH 654          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 167.548 bits (423), Expect = 7.996e-43
Identity = 108/363 (29.75%), Postives = 177/363 (48.76%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEK-----DNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLES--------GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS D T+ L V+S+ W+    DL  V +G +    F EQ  G  C +S+KNP +PE    +   V ++D + +   L+  G  +G V I ++    SS+ +  L S+   +KH  P WQV+W+  ++     D      SIS+DGRI +W + K  L+C D++ L++       +                 G C A HPK  + +L GT++G I+       +   N  Y  T+    HK  +Y++ W+ + PD+F SCSADW + IW+     P        + V  ++W+P S+ + AA   +R V ++D  I+ L+PL+  V       +  T ++F+     +L+GDS     +Y
Sbjct:  434 LWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNF---GFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQ---SSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRK-GLDCHDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIH-----KCSCSYNEQYLETYRG--HKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAYIFAAANENR-VEIWDLQISTLDPLIVNVANPG---IKFTTVLFAKETDCLLVGDSDGQVAVY 778          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 85.8853 bits (211), Expect = 6.676e-17
Identity = 55/162 (33.95%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEK-----DNIMAFYSISSDGRICEWSVNKYELNC 1417
            LW FS D T+ L V+S+ W+    DL  V +G +    F EQ  G  C +S+KNP +PE    +   V ++D + +   L+  G  +G V I ++    SS+ +  L S+   +KH  P WQV+W+  ++     D      SIS+DGRI +W + K  L+C
Sbjct:  434 LWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNF---GFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQ---SSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRK-GLDC 588          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 85.8853 bits (211), Expect = 6.676e-17
Identity = 55/162 (33.95%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEK-----DNIMAFYSISSDGRICEWSVNKYELNC 1417
            LW FS D T+ L V+S+ W+    DL  V +G +    F EQ  G  C +S+KNP +PE    +   V ++D + +   L+  G  +G V I ++    SS+ +  L S+   +KH  P WQV+W+  ++     D      SIS+DGRI +W + K  L+C
Sbjct:  434 LWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNF---GFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQ---SSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRK-GLDC 588          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 71.633 bits (174), Expect = 5.187e-13
Identity = 57/217 (26.27%), Postives = 93/217 (42.86%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEK-----DNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLES--------GTCIALHPKKYHTFLVGTQDGNIY 1564
            LW FS D T+ L V+S+ W+                               NP +PE    +   V ++D + +   L+  G  +G V I ++    SS+ +  L S+   +KH  P WQV+W+  ++     D      SIS+DGRI +W + K  L+C D++ L++       +                 G C A HPK  + +L GT++G I+
Sbjct:  111 LWSFSCDLTKGLNVSSLSWNK-----------------------------ANP-WPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQ---SSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRK-GLDCHDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIH 293          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q16959|DYI2_HELCR (Dynein intermediate chain 2, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.197e-145
Identity = 256/642 (39.88%), Postives = 367/642 (57.17%), Query Frame = 2
Query:   83 KRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQE-----NSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENI--HKMIIYQLVWSNWHPDIFASCSADWTIGIWN-CRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            K+ DDD         E     ++L+KP DQL L +QEL+EE T++L A NP AP NIV+Y+FK+  +K   ++D   IHFS+D N+++KDS EA          +  S     E       E+ EQ+           + ST    EA ++       K +NQF +  RA+QT NNP + + TQ+E PPR  FS   +Q  IYD+Y  D ++Q +  + +                 +    E    D++ I    KI+ERM+N NTFD+++QDF YYED +DEFR D  GTLLPLWKFS+DK+++L VTS+ W+  YKDLF V+HG Y+ +  + +G I  Y+LKNPS+PE+   T S V+ ID+      LIC G  DG V + ++   + +NPV +  S   + KH DP WQV W   + DN + F+S+SSDGR+  W++ K EL   D++ L+  + P D  E      L  GTC   H +  + FLVGT++G I+         K +  YS  F +    H M +Y+++W+++HP IF SCSADW++ IW+   ++ P+F  DLG AV  +AWAPYSSTV AAVT D KV V+D ++N+ EP +C+     K K  LT I F+ N+PI+L+GD R Y
Sbjct:   37 KKDDDDATEAGEHGGEEWMQTKSLIKPDDQLELNDQELKEEFTRILTANNPHAPQNIVRYSFKDCSFKQTSHVDQLAIHFSLDGNMIHKDSDEARRQQQRHGASEAISEQAISEAGEEKKEEDGEQKTEEPKEGEKRDEESTPAPAEAKSDQ------KLTNQFNFSERASQTYNNPYRERGTQTEPPPRANFSSTANQWEIYDAYMEDLEKQEKAKEKKAAPSKKDDDKSKKKLTAL----ETQSDDMSRISHAAKIIERMVNQNTFDDVSQDFKYYEDMSDEFR-DQEGTLLPLWKFSYDKSKRLAVTSVCWNPKYKDLFAVAHGSYDFMK-QSRGMILFYTLKNPSFPEFVYPTDSGVMCIDIRPEHPYLICVGYCDGSVGVFNV-TSTDANPVFQ--STAKTGKHTDPVWQVAWQKDDLDNNLNFFSVSSDGRVVAWTLVKNELTYTDVIQLQLDSAPQDGPEGTQLTPLGCGTCFDFHKQTDYLFLVGTEEGKIH---------KCSKAYSSQFLDTFEAHHMAVYKVMWNHFHPKIFISCSADWSVKIWDHTYRNGPMFTFDLGSAVGDVAWAPYSSTVFAAVTADGKVHVFDLNLNKYEP-ICEQAVVQKKKTKLTHITFNPNFPIVLVGDDRGY 653          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q32KS2|DNAI1_BOVIN (Dynein intermediate chain 1, axonemal OS=Bos taurus OX=9913 GN=DNAI1 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.691e-132
Identity = 243/665 (36.54%), Postives = 372/665 (55.94%), Query Frame = 2
Query:   38 PLKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHY---QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALR-QINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            P  P ++  S     +++D+D  T+   + E  D +   +  VKPPDQL+LT+ EL+EE T++L A NP AP NIV+Y+FKE  YK + ++D   +HF+   NL+           Y+D + A S  S    +   S    +E +          +    + + S    +E           K +N+F +  RA+QT NNPL+ +  Q E PPR  FS   +Q  IYD+Y  + ++Q +  +   T    ++K+     ++++ + E    DIT +    KI+ERM+N NT+D++AQDF YYED ADE+R D  GTLLPLWKF  DK ++L VT++ W+  Y DLF V HG Y+ +  + +G +  YS+KNPS+PEY   ++S ++ +DM+++   L+  G  DG V I +L +K  S P  R  S+  S KH DP WQV+W   + D+ + F+S+SSDGRI  W++ K EL   D++ L+ + +    +E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  + W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT + K  V+D SIN+ E +  Q V  +K K  LT + F+  +PII++GD R +
Sbjct:   13 PPPPRKQSISMGRGARKRDEDSGTE---VGEGTDEWVQSKATVKPPDQLDLTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKLIGFVDQLAVHFTQVGNLIPKDSDEGRRQHYRDELAASSQESAKVVI---SETEILEEEEEPKEVEAGSQTDVPIVEASEKMAEEELMTPKQPKERKLTNKFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYMEELEKQEKTKEKEKTKTPVAKKMGKMAMRKMTSM-ESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYR-DQEGTLLPLWKFQNDKAKRLAVTALCWNPKYNDLFAVGHGSYDFMK-QSRGMLLLYSMKNPSFPEYIFSSESGIMCLDMHVDHPYLVVVGHYDGNVAIYNL-KKPHSQPSFR--SSAKSGKHTDPVWQVRWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHTDVIKLKVEGSTTEGLEGLQIHTVGCGTAFDFHREIDYLFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMAVDAVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTNGKTHVFDLSINKYEAICNQPV-VAKKKNKLTHVQFNPIHPIIIVGDDRGH 655          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q5XIL8|DNAI1_RAT (Dynein intermediate chain 1, axonemal OS=Rattus norvegicus OX=10116 GN=Dnai1 PE=1 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 8.848e-132
Identity = 250/676 (36.98%), Postives = 364/676 (53.85%), Query Frame = 2
Query:   35 MPLKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHY---QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSV----------HLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            MP K   K+        RK ++    D  + E  D +   +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YK + +++   IHFS   NL+           Y+D + A S  SV     D  +              E +A    E   Q +    ++T+    +E           K +NQF +  RA+QT NNPL+ +  Q E PPR  FS   +Q  IYD+Y +D   +    K +        K       R     E    DIT +    KI+ERM+N NT+D++AQDF YYED ADE+R D  GTLLPLWKF  DK ++L VT++ W+  YKDLF V HG Y+ +  + +G +  YS+KNPS+PEY   ++S ++ +DM+++   L+  G  DG V I +L +K  S P  R +S   S KH DP WQVKW   + D+ + F+S+SSDGRI  W++ K EL   D++ L+      ++ E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  ++W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT D K  V+D ++N+ E +  Q V  +K K  +T + F+  +PII++GD R +
Sbjct:    1 MPSKQIRKQSVILTRGARKREEDSGTD--VGEGADDWAQSKAAVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKERTYKLIGFVNQMAIHFSQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVVTSDTEILEEEEEPKEGEGEGEGEAEGEAEAGSQTDVPAAAETTEKVIEEELMAPVQPKERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAY-VDELEKLEKTKEKEKTKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYR-DQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMK-QSRGMLLLYSMKNPSFPEYMFSSESGIMCLDMHMDHPYLVVVGYYDGNVAIYNL-KKPHSQPCFRSTSK--SGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDVIKLKDEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYLFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMAVDAVLWNPYHARVFISCSSDWTVKIWDHAIKTPMFIYDLNAAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPV-VAKKKNKITHVQFNPIHPIIIVGDDRGH 658          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q8C0M8|DNAI1_MOUSE (Dynein intermediate chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnai1 PE=1 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 1.251e-131
Identity = 247/670 (36.87%), Postives = 361/670 (53.88%), Query Frame = 2
Query:   35 MPLKPFEKRK-SNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENL------EQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            MP K   K+  S     +R+D+D  T      +     +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YK + +++   +HFS   NL+           Y+D M A S  S+     +       E       E         Q +    ++T+    +E           K +NQF +  RA+QT NNPL+ +  Q E PPR  FS   +Q  IYD+Y +D   +    K +        K       R     E    DIT +    KI+ERM+N NT+D++AQDF YYED ADE+R D  GTLLPLWKF  DK ++L VT++ W+  YKDLF V HG Y+ +  + +G +  YS+KNPS+PEY   ++S ++ +D++++   L+  G  DG V I +L +K  S P  R +S   S KH DP WQVKW   + D+ + F+S+SSDGRI  W++ K EL   DI+ L+      ++ E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  ++W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT D K  V+D ++N+ E +  Q V  +K K  +T + F+  +PII++GD R +
Sbjct:    1 MPSKQIRKQSISVTRGARRRDEDSGTDVGEGTDEWSQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKLIGFVNQMAVHFSQVGNLIPKDSDEGRRQHYRDEMVAGSQESIKVVTSEAENLEEEEEPKEGEGEAEAEAEAGSQTDIPAAAETTEKVIEEELMAPVQPKERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAY-VDELEKQEKTKEKEKAKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDTADEYR-DQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMK-QSRGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNL-KKPHSQPCFRSTSK--SGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDIIKLKTEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYMFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPV-VAKKKNKITHVQFNPIHPIIIVGDDRGH 654          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q9UI46|DNAI1_HUMAN (Dynein intermediate chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 8.498e-126
Identity = 233/663 (35.14%), Postives = 370/663 (55.81%), Query Frame = 2
Query:   44 KPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHY---QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLV-----------YKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            +P ++  S     +++D+D  T+   + E  D +   +  V+PPDQL LT+ EL+EE T++L A NP AP NIV+Y+FKE  YKP+ +++   +H++   NL+           Y+D + A S  SV    +  + +L  + +   +      +     +  +    +E           K +NQF +  RA+QT NNP++ +  Q+E PPR  FS   +Q  IYD+Y  + ++Q +  +        ++K      ++++ + E    D+  +    KI+ERM+N NT+D+IAQDF YY+D ADE+R D  GTLLPLWKF  DK ++L VT++ W+  Y+DLF V +G Y+ +  + +G +  YSLKNPS+PEY   + S V+ +D++++   L+  G  DG V I +L +K  S P     S+  S KH DP WQVKW   + D  + F+S+SSDGRI  W++ K +L   D++ L+      ++ E +    +  GT    H +  + FLVGT++G IY         K +  YS  F +  + H M +  + W+ +H  +F SCS+DWT+ IW+     P+F+ DL  AV  +AWAPYSSTV AAVT D K  ++D +IN+ E +  Q V + K++  LT + F+  +PII++GD R +
Sbjct:   12 QPHKQSISIGRGTRKRDEDSGTE---VGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISE--TGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSM-ESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYR-DQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMK-QSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNL-KKPHSQP--SFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIY---------KCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNR--LTHVQFNLIHPIIIVGDDRGH 652          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A1I8GR10 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007387g1 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 2.209e-151
Identity = 254/612 (41.50%), Postives = 365/612 (59.64%), Query Frame = 2
Query:  158 KPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENS---NLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM-ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            KP DQL LT+QEL+EE T++L A NP AP NIV+Y+FK+ QYKP+P +D   +HF M+ NL++++S EA   L   +    ++   PI              +    +       +E  +E++        K +NQF +C RATQT NNPL+ +  Q+E PPR  FS   +Q +I+D+Y+ DF++ N+         G  +      +KR++++ +    D+  I   VK+LERM+N N+FDEIAQDF Y+EDP+DEFR D  GTLLPLWKF ++K RKL VTSI WS  Y DLF +++G Y+ +  + +G +C YSLKNPS+PEY   T S VL   ++     ++CAGL DG V + S  +K    P+ +  S+  + KH DP WQV W   + DN M FYS SSDGR+  W++ K +L  QD++ L     P++  + +    L SGT    H +  H FLVGT++G ++   T  S     S Y  T++   H M +Y++ W+ +HP IF +CSADWT+ IW+  ++ P+FV DL   V   AW+PYSSTV AAVT D KV V+D +IN+ E L  QVV + K K  LT I F+  +PI+++GD R +
Sbjct:   50 KPDDQLQLTDQELKEEFTRILTANNPHAPQNIVRYSFKDRQYKPIPQVDQLAVHFVMEGNLIHRESDEAKKQLEKKS---GDAAREPI--------------DEAAEASEGEAPPKEEGDEDAPAPAASGKKLTNQFNFCERATQTYNNPLRERENQTEPPPRVNFSQTANQWIIFDAYQADFEK-NQEKGKEKKGGGAGKGAEEKARKRLTVM-DTQADDLAKIEHAVKMLERMVNQNSFDEIAQDFKYWEDPSDEFR-DQQGTLLPLWKFGYEKARKLAVTSITWSPKYHDLFAIAYGSYDFMK-QTRGLLCFYSLKNPSHPEYVFETDSAVLTAALHPEYPHMLCAGLYDGSVAVYSAVQKKRG-PLYQ--SSARTGKHTDPVWQVCWAKDDLDNNMNFYSTSSDGRVTSWTLIKNDLVSQDVIKLELEGGPVEGPDGIKLENLASGTTFDFHREASHLFLVGTEEGKVFKCSTAYS-----SQYLQTYD--AHHMAVYKVTWNPFHPSIFMTCSADWTVKIWDHNKTEPVFVFDLNSPVGDAAWSPYSSTVFAAVTADGKVHVFDLNINKYEALCEQVV-AQKKKAKLTHIDFNPKHPILIVGDDRGH 629          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A5K4F0L6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 3.434e-151
Identity = 265/643 (41.21%), Postives = 376/643 (58.48%), Query Frame = 2
Query:   56 KRKSNAFYLKRKDDDFYTKDPTLNENEDHY--QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINK-SRLTNFGGSQKIIVPDKKRISLVHEKHFGD-ITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQI-NLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGD 1969
            KR+++    ++   D    + +L E  D Y  +  +KP DQL L+EQEL+EEIT+VLK+TNP AP NIV+YNFK+ QY  VP +D   IHF  +S ++  DS EA   +S                D  +  E+L+ E      + +T  K+     +  L   K +NQF +C R+TQT NNP + +   +E PPR  FS N+ Q  IYD Y  DF++Q   NK  +L   G  Q+     K   +++  +  GD ++     +KI+ERMIN NT DEIAQDF YYEDP+DEFR D+ GTLLPLW FSF+K RK+ VTS+ WSS Y DLF V +G Y+ +  +  G IC Y+LKNPSYPEY L T+S VL++D++ +   ++C G  DG V + S+ +  S    +   S   + KH DP W+V+W P + D  + F+SIS+DGR+  W++ K ++   D V L+ I N    +       L+ GT    H  + H FLV T++G ++       +    S Y  T+    H M +Y++ W+ +HPDIF +CSADWT+ IW+  +S P+F  DLG  V  +AWAPYSSTV AAVT D +V VYD SIN+ +PL  Q++ + K+   LT I F+  Y II++GD
Sbjct:    6 KRRTSKKQQRKSQQDAEEFESSLREETDDYGVRAALKPEDQLQLSEQELKEEITRVLKSTNPHAPQNIVRYNFKDGQYTQVPQVDQMAIHFWHESYMLPIDSDEARRQISR---------------DGTMQPEDLQTEEHN--KEPATAVKES----DLQLPQKKVTNQFNFCERSTQTYNNPQRDRGGMTEPPPRANFSANVTQWSIYDDYIEDFEKQQEKNKDKKLLGMGHKQET----KTHKNIISGETQGDELSRFAQPLKIVERMINQNTHDEIAQDFKYYEDPSDEFR-DNQGTLLPLWSFSFEKARKIAVTSLCWSSQYSDLFAVGYGSYDFLK-QSNGLICAYTLKNPSYPEYHLETESGVLSLDLHPSLPYILCVGFYDGAVGVYSILQHKSGPLYL---STARTGKHTDPVWEVRWQPNDLDANLNFFSISADGRVTSWTLIKNDIGKFDAVILKMIANSNEGIGHPRSITLDCGTAFDFHRTQNHIFLVATEEGMVF-----KCSKAYTSQYLATYE--AHHMAVYRVAWNLFHPDIFITCSADWTVKIWDQAKSTPMFTFDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSINKYDPLCNQLIVTKKN-TKLTHIAFNPQYSIIIVGD 610          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: C3Y1H7 (WD_REPEATS_REGION domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_242526 PE=4 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 1.051e-149
Identity = 258/620 (41.61%), Postives = 364/620 (58.71%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLE-----NLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRF-LESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            +T+VKP DQL LTEQE++EE T++L A NP AP NIV+++FKE  +K V  +D   IHFS+D N+++KDS EA   ++     +  +        A    E      ++ E     +QT+   K             K +NQF +  RA+QT NNP + + TQ+E PPR  FS   +Q  IYD+Y  D +RQ +  + +   F G Q+    ++K+IS + E    DIT I    KILERM+N NT+D+IAQDF Y+ED +DE+R +  GTLLPLWKFS++K+++L VTSI W   Y+DL  V HG Y+ +  + +G IC YSLKNPS+PE+   T++ V+ +D++     L+  G  DG V + SL EK    P+ + ++     KH DP W+VKW   + DN M F+SI  DGR+  W++ K EL C D++ L+    P D       F L  GT    H +  + FLVGT++G I+         K +  YS  F +  + H M ++ + W+ +HP IF SCSADWT+ IW    + PLF  DLG +V  +AWAPYSSTV AAVT D KV V+D ++N+ E L  QVV  +K K  LT I F+ NYP+I++GD R Y
Sbjct:   18 KTMVKPDDQLELTEQEMKEEFTRILTANNPHAPQNIVRFSFKEKVFKQVASVDQLAIHFSLDGNMLHKDSDEARRQMARGGLAEAVAEGEEKAEAAGEGGEGEAKPEVKAEKEEGATQTAPAAKG---------GDKKLTNQFNFSERASQTFNNPYRERGTQTEPPPRVNFSSTANQWEIYDAYVEDIQRQEKSKEKK--GFRGQQEST--NRKKISAI-ESQGDDITRIEKPAKILERMVNQNTYDDIAQDFKYWEDVSDEYR-EQEGTLLPLWKFSYEKSKRLAVTSICWDPKYRDLLAVGHGSYDFLK-QTRGLICLYSLKNPSFPEFIYNTETGVMCLDIHPAYPHLVAVGFYDGSVGVFSLTEKIQE-PMYKCTAK--GGKHTDPVWEVKWQKDDLDNNMNFFSIGGDGRVVSWTLVKNELLCTDVILLKLDESPADGAEGTQLFTLGCGTAFDFHKQTDYLFLVGTEEGKIH---------KCSKAYSSQFLDTFDAHHMAVHSVRWNTFHPKIFLSCSADWTVKIWEHTSNMPLFTFDLGSSVGDVAWAPYSSTVFAAVTSDGKVHVFDLNVNKYEALCEQVV-VTKKKTKLTHIEFNPNYPMIIVGDDRGY 608          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A4S2L493 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009831 PE=4 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 2.871e-146
Identity = 245/614 (39.90%), Postives = 362/614 (58.96%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENS-NLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRF-LESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTF--NENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            ++++KP DQL LTEQEL+EE+T+VL ATNP AP NIV++NFK+ QY+ +  +D  ++HF  + +++ KDS E    ++    L       P+E +AN                     K+ A+ E +  +   K +NQF +C R+TQT NNP + +   +E PPR  FS N+ Q +IYD Y+ D+++Q    K       G  K     KK+ S     +  D++     +KILERMIN NT DE+AQDF YYEDP+DE+R D +GTLLPLW F+F+K RKL VT++ WS  Y DLF V HG Y+ +  +  G IC Y++KNP YPEY   T S VL++D++     ++C G  DG V + ++++  S  P+    S   + KH DP W+V+W P + D  + F+S+S+DGR+  W++ K ++   D + L+ +    D    +    L+ GT    H    H FLV T++G +Y         K +  YS  +  +   H M +Y++ W+++HPDIF +CSADWT+ IW+  + +P+F+ DLG  V  +AWAPYSSTV AAVT D +V VYD S+N+ EPL  Q+V ++K K  LT + F+  Y II++GD R
Sbjct:   32 RSVIKPDDQLQLTEQELKEEVTRVLTATNPHAPQNIVRFNFKDCQYRQISQVDQASVHFWHEGHMLLKDSDEGRRQMARDGTLPTAG---PVEEEAN---------------------KEGAFVETAEGMQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYDADYQKQQEKTKE--KKVAGGPKYEGKQKKKSSHADTLN-DDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYR-DQNGTLLPLWNFTFEKARKLAVTALCWSPRYNDLFAVGHGSYDFMK-QSNGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKSG-PLYM--STAKTGKHTDPVWEVRWQPNDLDANLNFFSVSADGRVTSWTLVKNDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLSHLFLVATEEGMVY---------KCSKAYSSQYLGSYEAHHMSVYRVAWNHFHPDIFITCSADWTVKIWDHNKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPLCNQLV-TAKKKTKLTHLAFNPKYSIIIVGDDR 603          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A3M6TUP4 (WD_REPEATS_REGION domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00023966 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 3.159e-146
Identity = 257/625 (41.12%), Postives = 366/625 (58.56%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSN---KSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINK--SRLTNFGGSQKIIVPDKKRISLVH-EKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVI-RLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRF----LESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            + L+KP DQL LTE EL+EE T++L A NP AP NIV+Y+FKE  YKP   +D   IHF++D N+++KDS EA    +           L  E DA    E  ++EN  + +      ++   + ++++      K +NQF +  RA+QT NNP + + T +E PPR  FS   +Q  IYD+Y  D +RQ ++ +  SR T     Q     D K+  L+  E    DI+ I    KI+ERMIN NT+DEIAQDF Y+ED ADEF+ D  GTLLPLWKFSF+K++++ VTS+ WS  Y DLF V HG Y+ +  +  G +  Y+LKNPS+PEY   T+S V+ +D +      I  G  DG V + ++ ++++   ++ R ++ M   KH DP WQVKW   + DN M F+S+SSDGRI +W++ K EL   DI+ L+Q N P   E   D      L  GT    H    + FLVGT++G I+         K +  YS  F E  + H M +Y + W+++HP IF SCSADWT+ IW+     P+F  DL  +V  +AWAPY+STV AA T D +V VYD ++N+ EPL  Q V ++K +  LT + F+  YP++++GD R Y
Sbjct:   57 KQLIKPDDQLELTEAELKEEFTRILTANNPHAPSNIVRYSFKEKCYKPTSSVDQLAIHFALDGNMLHKDSDEARRQRARQG--------LEAEHDAGEAGEEEDKENKAVEAVEEKPAEEVRPDSSASVGGKSEAKLTNQFNFSERASQTYNNPYRERGTSTEPPPRANFSATANQWEIYDAYVEDLQRQEKMKEKESRKT-----QTFKKDDDKKKKLMQVEVQGDDISRISKPCKIVERMINQNTYDEIAQDFKYWEDAADEFK-DQEGTLLPLWKFSFEKSKRMAVTSLCWSPKYHDLFGVGHGSYDFLK-QSNGMVAMYTLKNPSFPEYICETESGVMCLDFHPEHPNYIAVGFYDGSVGVYTVVQQTNKIELMYRSTAKM--GKHTDPVWQVKWQKDDLDNNMNFFSVSSDGRITQWTIVKSELRHTDIITLKQGNTP---EGEGDNTQLPSLGCGTAFDFHKTMDYMFLVGTEEGKIH---------KCSKTYSSQFLETYDAHHMAVYSVKWNHFHPKIFISCSADWTVKIWDHHYQEPMFTFDLNNSVGDVAWAPYASTVFAACTTDGRVYVYDLNVNKYEPLSEQSV-ANKKRTKLTHLAFNPEYPVLIVGDDRGY 651          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 426.402 bits (1095), Expect = 6.701e-140
Identity = 251/619 (40.55%), Postives = 360/619 (58.16%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQ----ENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALR-QINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNEN--IHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            + LVKP DQL+L+E EL+EE T+VL A NP AP NIV+Y+FKE  YKP+  +D   IHF ++ NL++KDS EA    +           +P   +A+ VL  +EQ    E++    + +   + ++ +  S     K +NQF Y  RA+QTLNNP + +  Q+E PPR  FS   +Q  IYD+Y  + ++Q +  + + T    S+K     KK++++V E    DIT +  V KI+ERM+  NTFD+IAQDF Y+ED +DEFR +  GTLLPLWKF +DK + L VT++ W   YKDLF V  G Y+    + +G +  YSLKN +YPEY   T S V+ +D++     L+  G  DG V + +L E+    P+ + ++ M   KH DP WQVKW   + DN   F+SISSDGR+  W++ K EL   DI+ L  + ++    E +    +  GT    H +  + FL+GT++G I+         K +  YS  F E    H M +  + W+ +HP +F SCS+DWT+ IW+    +P+F  DL   V  +AW+PYSSTV AAVT D KV V+D SIN+ E +  Q V + K K  LT I F+  YPII++GD R Y
Sbjct:    4 KVLVKPADQLDLSEAELKEEFTRVLTANNPHAPQNIVRYSFKERSYKPISSVDQLAIHFVLEGNLLHKDSDEARRQRA--------KQEIP---EADGVLTCVEQADLTEDTGDAEEGAGEERPDSVDVKSGKMERKVTNQFNYSERASQTLNNPPRERGCQTEPPPRAKFSATANQWEIYDAYVEELQKQEQSKEKQKTLV--SKKEEDKGKKKMTVV-ENPSDDITKVAKVTKIIERMVTQNTFDDIAQDFKYFEDASDEFR-EQEGTLLPLWKFQYDKAKHLSVTALCWLCNYKDLFAVGLGSYKFTK-QGRGMLLFYSLKNSTYPEYIFTTLSGVMCLDIHKQLSSLVAVGFYDGSVGVYNLKEEGP-QPIYKSTAKMG--KHTDPVWQVKWQKDDIDNNHNFFSISSDGRVVSWTLVKNELVFTDIIRLSVEGSISNGQEGMQLPAMACGTSFDFHQQIDYLFLIGTEEGKIH---------KCSKCYSSQFLETYAAHNMAVDAVKWNQFHPKVFISCSSDWTVKIWDHTIKSPMFTFDLNAPVGDVAWSPYSSTVFAAVTTDGKVHVFDLSINKYEAICQQAVAAKKTK--LTHIEFNPVYPIIIVGDDRGY 592          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:103046564])

HSP 1 Score: 154.066 bits (388), Expect = 1.499e-38
Identity = 109/362 (30.11%), Postives = 179/362 (49.45%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMA-----FYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLES---GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNEN--IHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGF-----AVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS + T    V+ + W+    DL  V +   +I + ++ G +C +SLKNP +P+     +S V ++D + ++   +  G+ DG ++I ++ + +   PVI  SSN    KH  P WQVKW+  E+++  A       S+++DGR+C+W   +  L C D++ L        M   +   + S   G C   H    + +L GT +G+I+         K +  Y+  F +    HK  + ++ WS + PD+F SCSADWTI +W  RQ   LF   LGF     AV  + W+P  +TV   +  DR V +++   +  +P V  V       V LT ++F+     +L+GDS     +Y
Sbjct:  415 LWAFSCELTVAHDVSCMAWNKKNPDLLAVGYEQLDI-NDQKSGLVCCWSLKNPQWPDRIFQCESAVTSLDFSASNASQLAVGMHDGSIVIYNV-QFTKKTPVID-SSNC-DPKHTGPVWQVKWIDCEQNSAGASEAEMLISVAADGRVCKWFFREC-LTCIDLMKLTV------MRNDSGALISSQAPGLCFDFHRNNSNIYLTGTGEGHIH---------KCSCSYNEQFLDTYKAHKGPVRKVTWSPFCPDVFLSCSADWTIQLW--RQD--LFTPVLGFTSTQNAVHDVMWSPRWATVFGVINEDR-VEIWNLGASTQDPTVVSVANPG---VKLTSLLFASETDCVLVGDSEGRVSVY 748          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: wdr34 (WD repeat domain 34 [Source:NCBI gene;Acc:103022287])

HSP 1 Score: 87.0409 bits (214), Expect = 1.832e-17
Identity = 82/325 (25.23%), Postives = 140/325 (43.08%), Query Frame = 2
Query:  974 KTRKLPVTSIIWSSFYKDLFV----VSHGMYEIVSFEEQGAICGYSLK----NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYE--LNCQDIVALRQINLPIDMETVADRFLESGTCIA-----LHPKKYHTFLVGTQDGNI----YYHLTMNSNMKSNSDYSM----TFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFA-VTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEP 1876
            + R L VT + W+     +      V HG +      E+  +C ++L     NP  P+  + T +PV+ +  +     LI  GL  G V++      S+ +PV+   + +    HR+P ++VKW+P  +   +A  S  S GRI  WSV   E  L+     AL +  +P    +   R    GT I      L P    +FLVG++ G +    +   T+ +   +    ++     F+ +     ++ L +S +H ++F S   D    I +  Q   L  + +  + V  + W+P    V AAVT    V+V+D     L P
Sbjct:  121 QQRGLQVTGVSWNCTGSVIACAYGRVDHGDWST----EKSCVCTWNLDRSKLNPKQPDMVIDTATPVMCVSFHPLRPSLIAGGLYSGEVIV--WDTSSTQDPVL-AQTGISQDTHREPVYEVKWVPGARRGDLAVLSACSGGRILLWSVEAAEGRLSLTSGYALVRQQVPQSSSSNKSR---GGTNIGVTSLTLSPWDLDSFLVGSEGGLVLKCAFSSQTVAAVPPNGESVALRAPAQFSFSARAGPVHSLHFSPFHRNLFVSVGTDGLAQIHSMLQPRALLTMRVSDSYVFGVRWSPVRPLVFAAVTGQGLVQVFDLGRRSLRP 435          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1 [Source:NCBI gene;Acc:103027766])

HSP 1 Score: 73.559 bits (179), Expect = 3.719e-13
Identity = 77/397 (19.40%), Postives = 170/397 (42.82%), Query Frame = 2
Query:  833 VKILERMINLNT---FDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDK--TRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLK-NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNEN---IHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            ++++ER +  ++   FD   +D    ED   + +    G+ L   +  +D+  ++   +T + WS  Y +L V S+   E    E  G    +++K   + PEY    +SPV+++        L+  G   G +++   +      PV R  + + +  H  P + V  +  +  N +   ++S+DGR+C WS++      + +  +   + P+ +           T +A      + ++VG+++G +Y      S   S +     F  +   +  +  +  V       +F + S DWT+ +W+ + + PL+   D    V  + W+P    + AAV    ++ +++ + +   P     +  +    +L ++ ++     + +GDS    +IY
Sbjct:  201 IRVMERALAEDSNIFFDYSGRDL---EDKEGDLQ---GGSSLSFSRLFYDERWSKHRVITCLDWSPQYPELLVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYIYHCQSPVVSVGFARFHPNLLVGGTYSGQIVLWD-NRSHRRTPVQR--TPLSAAAHTHPVYCVNVVGTQNANNL--ITVSTDGRMCSWSLDMLSQPQESMELVYNKSKPVAV-----------TGMAFPAGDVNNYVVGSEEGTVY----TASRHGSKAGICEMFEGHQGPVTGISCHSAVGPVDFSHLFVTSSFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPALFAAVDGMGRLDLWNLNNDTEVPTASVTIEGAP---ALNRVRWASGGKEVAVGDSEGRVWIY 568          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dync1i2b (dynein, cytoplasmic 1, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-090121-1])

HSP 1 Score: 70.4774 bits (171), Expect = 3.773e-12
Identity = 99/475 (20.84%), Postives = 194/475 (40.84%), Query Frame = 2
Query:  605 TKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRL----TNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDK--TRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLK-NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHP----DIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
             K+TQ ++PP++M S + +        +   K ++   +  L    +     Q+    D +  +  HE    +   IL   +I+ER ++ +   ++  D+S   D  D+      GT L L +   D+  ++   VT + WS  Y +L V S+   E    E  G    +++K   + PEY    +S V++         L+  G   G +++   +  +   PV R  + + +  H  P + V    +   N     SIS+DG++C WS++        +  + + + P+ +           T ++      + F+VG++DG +Y      S     +  S  F E  H  +          P     +F + S DWT+ +W+ R + PL+   D    V  + W+P    + A V     + +++ +     P     V   +   +L ++ ++++   + +GDS     IY
Sbjct:  112 AKVTQVDFPPKEMVSYSKETQT---PTQTQIKHEDENEEEDLAVVQSALEAPQENESQDTEEEAPPHELTEEEKQQIL--SRIVERALSEHV--DVCFDYSG-RDLQDKEGDTQGGTKLSLNRQFMDERWSKHRVVTCLDWSLQYPELLVASYSSNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWD-NRSNKRTPVQR--TPLSASAHTHPVYCVSL--VGSQNAHNLISISTDGKMCSWSLDMLSTPQDSLELVFKQSKPVAV-----------TSMSFPLGDVNNFVVGSEDGTVYTACRHGSK----AGISEMF-EGHHGPVTGLDCHMAAGPVDFSHLFVTSSFDWTVKLWSTRNTKPLYSFEDNSDYVYDVMWSPAHPALFACVDGVGHLDLWNLNNETEVPTASVTV---EGNPALNRVRWANSGREVAVGDSEGQVHIY 554          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004773.1 (pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 gene:ENSPMAG00000004320.1 transcript:ENSPMAT00000004773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 368.237 bits (944), Expect = 1.072e-119
Identity = 206/490 (42.04%), Postives = 293/490 (59.80%), Query Frame = 2
Query:  539 NKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPD---KKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQG--AICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVAL---RQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIW-NCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
             K +NQF +  RA+QT NNPL+ K +Q+E PPR  FS  ++Q  +YD+Y  + KRQ +  + +    GG  +         K+ +LV E    DIT +    KI+ERM+N NTFD+IAQDF Y+ED +DE+R +  GTLLPLW+F  ++ R+L VT++ W+  Y DLFVV  G YE   F++QG  A+  ++LKNPS+PE+   T+S V+ +D++     L+ AGL DG V + +L     + P  R  S+  S KH DP WQVKW   + DN + F+S+SSDGR+  W++ K EL C D+V L        P+  E  A   L SGT    H +  H FLVGT+DG I         +K +  YS  F +  + H M +  + W+ +H  +FASCSADW++ IW +  +  P+F  DLG AV  +AWAPYSSTV AAVT D KV V+D ++N+ E L  Q V + KH   LT + F+ + P++++GD R
Sbjct:    2 QKLTNQFNFSERASQTFNNPLREKSSQTEPPPRANFSATVNQWEVYDAYGEELKRQEKAKEKQQQKGGGGGRRDEGGPRATKKFTLV-ETQGDDITKVAKAAKIIERMVNQNTFDDIAQDFRYFEDASDEYR-EQDGTLLPLWRFQCEQARRLTVTALCWNPCYHDLFVVGFGSYE---FQKQGRGALVVFTLKNPSFPEFVFATESGVMGVDVHDARPHLVAAGLYDGTVAVYNLAAPVDAQPSHR--SSARSGKHTDPVWQVKWQRDDLDNNLNFFSVSSDGRVASWTLIKNELLCMDVVKLSVEEGQAAPLG-EDPALETLSSGTSFDFHRQIDHMFLVGTEDGTI---------LKCSKAYSSQFLDTYDAHHMAVEAVRWNPFHTRVFASCSADWSLKIWEHTAKWAPVFTFDLGAAVGDVAWAPYSSTVFAAVTADGKVHVFDVNVNKYEALCTQSVSTKKH-TKLTHVAFNPSQPVLIVGDDR 473          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000105.1 (pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 gene:ENSPMAG00000000091.1 transcript:ENSPMAT00000000105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.099e-28
Identity = 79/257 (30.74%), Postives = 139/257 (54.09%), Query Frame = 2
Query: 1289 KHRDPCWQVKWLPIEK-----DNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQIN-----LPIDMETVADR-------FLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNEN--IHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGF-AVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYP--IILIGDSRFYYFIY 1993
            KH    WQV+W+ +E+     D      SIS+DGR+  W+V K  L+CQD++ L++           +E   +R        L  GTC+  HP+  + +L GT++G I+         + +  YS    ++   H+  +Y+++WS + P++F SCS+DW++ +W    ++P+  L  G  AV  +AW+P+S T+LAA+T +  + V+D S + L+P+   +V   +  V +T++ FS   P   +L+GDS  +  +Y
Sbjct:    1 KHMGAVWQVQWVRLEQGGGGEDRGETLTSISADGRVTRWAVRK-GLDCQDLMRLKRTGEGRTRRTAGVEGQRERKNEALIWRLACGTCVDFHPQDSNVYLAGTEEGFIH---------RCSCSYSEQHLQSYSAHQGPVYRVLWSPFEPEVFLSCSSDWSVRLWRVDLTSPVLTLQCGSQAVLDVAWSPHSPTLLAALTAE-ALHVWDLSSSTLDPV---LVSPGRRGVHMTRVAFS-RAPGHCLLVGDSDGHVTLY 242          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009966.1 (pep scaffold:Pmarinus_7.0:GL490051:1079:6069:1 gene:ENSPMAG00000009021.1 transcript:ENSPMAT00000009966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 3.238e-23
Identity = 42/73 (57.53%), Postives = 56/73 (76.71%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEA 364
            +TLVKP DQL LTE EL+EE T++L A NP AP NIV+Y+FKE  YKPV  +D   +HF++D NL++++S EA
Sbjct:   19 RTLVKPEDQLELTEAELKEEFTRILTANNPHAPQNIVRYSFKERVYKPVGTLDQLAVHFAVDGNLLHRESDEA 91          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: dync1i2a (dynein, cytoplasmic 1, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-060929-1086])

HSP 1 Score: 69.707 bits (169), Expect = 1.101e-12
Identity = 79/367 (21.53%), Postives = 155/367 (42.23%), Query Frame = 2
Query:  938 GTLLPLWKFSFDK-------TRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLK-NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPID-METVADRFLE-SGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHP----DIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            G +L   K S ++       +++  +TS+ WS+ Y +L V ++   E    E  G    ++ K   + PEY    +S V++         L+  G   G +++   +  +   PV R  + + +  H  P + V  +  +  N     S+S+DGR+C WS             L  ++ P D ME V  +    + TC+       + F+VG+++G++Y          S +  S  F E     +      S   P     +F + S DWTI +W  + + PL+   D    V  + W+P   ++ A+V    ++ +++ + +   P     +       +L ++ ++ +   + +GDS  + +IY
Sbjct:  220 GEVLAGAKLSLNRQFYDERWSKRRVITSLDWSAQYPELLVATYNNNEDSPHEPDGVALVWNTKFKKTTPEYVFHCQSAVMSASFARFHPNLVVGGTYSGQIVLWD-NRSNRMTPVQR--TPLSAAAHTHPVYCVNVVGTQ--NAHNLISVSTDGRMCSWS-------------LDMLSQPQDSMELVHKQSKSIAVTCMTFPVGDVNNFVVGSEEGSVY----TACRHGSKAGISEVF-EGHQGPVTGIHSHSAAGPIDFSHLFLTSSFDWTIKLWTTKNNKPLYSFEDNSDYVYDVMWSPVHPSLFASVDGMGRLDLWNLNSDTEVPAASVTIDGCP---ALNRVRWTHSGRELAVGDSEGHLWIY 560          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 50.447 bits (119), Expect = 7.796e-7
Identity = 35/114 (30.70%), Postives = 56/114 (49.12%), Query Frame = 2
Query: 1634 HKMIIYQLVWSNWHP--DIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRL-EPLVCQVVGSSKHKVSLTQIVFSDNYPIILIG 1966
            H+  IY L   ++ P  D   S S D T+ IW+ R       L +   VT++A +P     +AA ++DR VRV+D     L E L  +    + HK S+  +VF+ +   ++ G
Sbjct:  484 HEQDIYSL---DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSG 594          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO36198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC7])

HSP 1 Score: 441.425 bits (1134), Expect = 7.139e-146
Identity = 251/626 (40.10%), Postives = 367/626 (58.63%), Query Frame = 2
Query:  146 QTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAV-----SNLSVPAFLDDNSVHLPIEFDANIVLE---NLEQENSTMLSQTSTTFKQEAW-NENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINK--SRLTNFGGSQKIIVPDKKRISLVH-EKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFY 1981
            + L+KP DQL L+E EL+EE T++L A NP AP NIV+Y+FKE  YK    +D   IHF++D N+++KDS EA        LS+       S+ LP E + +   E   + E +            + E+     S+    K +NQF +  RA+QT NNP + + T +E PPR  FS + +Q  IYD+Y  D +RQ +I +  SR T     Q +   + K+  L   E    DIT I    +I+ERM+N NT+D+IAQDF Y+EDP+DEFR +  GTLLPLWKFS++K+++L VTS+ W+  Y DLF V+HG Y+ +  +  GA+  +SLKNPSYPEY + T+S V+ +D++     ++ AG  DG V + S+ EK  + P+ +  S   + KH DP WQVKW   + DN + F+S+SSDGR+ +W++ K EL+  DI+ L         E    + L  GT    H    + FLVGT++G I+         K +  Y+ T+ +  + H M +Y + W+ +HP  F SCSADWT+ IW+     P+F  DL  +V  + WAPY+STV AA T D K+ VYD ++N+ EPL C+    +K K  LT + F+ ++PI+++GDSR Y
Sbjct:   15 KQLIKPDDQLELSEAELKEEFTRILTANNPHAPSNIVRYSFKERCYKQTSSVDQLAIHFALDGNMLHKDSDEARRQRTRQGLSLVLIYSFISLFLPYEAETSEAGEEDADKENKPEEEKKTDEEKPRSESIIGTGSSKKEQKLTNQFNFSERASQTYNNPYRERGTATEPPPRANFSASANQWEIYDAYVEDLERQEKIKEKESRKT-----QTLKKEEDKKKKLTQVEMQGDDITRISKPAQIVERMVNQNTYDDIAQDFKYWEDPSDEFR-EPDGTLLPLWKFSWEKSKRLAVTSLCWNPIYNDLFSVAHGSYDFLKQDGGGAMSFFSLKNPSYPEYGIKTESGVMCLDIHPEHPHMLAAGFYDGSVAVYSISEK-MNKPLHQ--STAKTGKHTDPVWQVKWQKDDLDNNLNFFSVSSDGRVVQWTIVKSELSHTDIINLELPEKSEGPEGTQIKSLGCGTSFDFHKTINYLFLVGTEEGKIH---------KCSKTYTSTYLDTFDAHHMSVYSVRWNPFHPKTFISCSADWTVKIWDHTHLEPMFTFDLNSSVGDVQWAPYASTVFAACTADGKIHVYDLNVNKYEPL-CEQSVVAKKKSKLTHLAFNPDHPILIVGDSRGY 621          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO34474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP67])

HSP 1 Score: 134.035 bits (336), Expect = 1.048e-34
Identity = 92/313 (29.39%), Postives = 154/313 (49.20%), Query Frame = 2
Query: 1115 YPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEK-------DNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDM----------ETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMI--IYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLF-VLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            YPE      + V A+D +     L+  GL DG + I ++     S     L S+    KH  P WQ++W+  E+       D I+   SIS+DGR+ +WS+ K      D++ L++IN+              + +  RF  +G C    P   + +L GT++G+++         K +  Y+  + E+ H     IYQ+ W+  +P+ F +CSADW++ +W+C +  P+   L    +V  I+W+P  +T+ A V  DR V ++D S+N L+P+V  V         LT ++F+ N   IL+GDS     +Y
Sbjct:    9 YPERVFHLNTGVTALDFSGAHPNLLAVGLYDGTIAIYNIRCTDDSPA---LDSSESVGKHTSPVWQLQWVDREQGGNGDEHDEILV--SISADGRVTKWSIRK-GFESADLMKLKRINVTKQKAGGGGSERKSDALISRF-AAGFCFDFSPNDANIYLAGTEEGHVH---------KCSCSYNEQYLESFHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLWHCDRQFPVMSFLSSTKSVNDISWSPDCATLFACVN-DRAVEIWDLSLNTLDPVVSFV---PVQDCKLTTVLFALNTATILVGDSEGQVTVY 301          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO43231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ65])

HSP 1 Score: 77.411 bits (189), Expect = 5.974e-15
Identity = 76/320 (23.75%), Postives = 147/320 (45.94%), Query Frame = 2
Query:  983 KLPVTSIIWSSFYKDLFVVSHGMYEIVSF-EEQGAICGYSLK----NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWL--PIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVA---LRQINLPIDMETV-ADRFLESG-TCIALHPKKYHTFLVGTQDGNIYYHLTMNS------NMKSNSDYS--MTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFA-VTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPL 1879
            +L +TS+ W+S    +   ++G  +   +   + ++C ++L     N +  + T+   S +L++  +     LI  G  +G V +  L   S  + ++  SS M +  HR+P  ++ WL  P  K       S S DG++  W V   E     +V    L+   +P  + T  A   +E G T ++   +    F++G++ G I+   ++NS      N+ S+      +TF    H   ++ +  S +H ++F +C  D TI ++   Q+ PL  L+     + +I W+P    V +  T D ++ +YD  +N + P+
Sbjct:  121 QLQITSLSWNS-TGSVIAAAYGRLDHEDWCTHKSSLCTWNLDRRGINVNKADTTVDLSSCLLSLAFHPKSPALIAGGTFNGEVHLWDL---SCEDEMLVASSGMGNDSHREPVNKIMWLLDPDSKGKKYQILSASGDGKVLLWQVPPIESQDLRLVGGYILQTGAVPRSLRTSKAKGDMEMGVTTLSFSHEDKTLFVLGSEAGGIF-KCSVNSRGPPVGNVTSSVPLGSPVTFAFAPHVGPVFSVNCSPYHRNLFLTCGTDGTIRLYTMLQAKPLLSLEPAAGYLFAIRWSPVRPLVFSVATGDGRLLIYDMKVNHINPV 435          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO49079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI29])

HSP 1 Score: 72.7886 bits (177), Expect = 1.982e-13
Identity = 81/393 (20.61%), Postives = 163/393 (41.48%), Query Frame = 2
Query:  830 VVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTL-LPLWKFSFDK--TRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLK-NPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
             V+++ER +  +   +I  D+S  E   D+    S     L L +  +D+  +R   VT + WS+ Y +L V S+   E    E  G    ++LK   + PEY    +S V++         LI  G   G +++   +  S   PV R   +  +  H   C  V    +   N     S+S+DG++C WS+        D+++  Q ++ +  +      +   TC++      + F+VG+++G +Y      S    +  +   +   +  +  +          +F + S DWT+ +W+ +   P +   D G  +  + W+P    + A V    ++ +++ + +   P+      S     +L  + ++ +   I +GD     +IY
Sbjct:   82 AVRLVERALTEDL--DITIDYSGAE--GDDLEGGSQAARELTLSRDFYDERWSRHRTVTCLDWSNQYPELLVASYNNNEDAPHEPDGVALIWNLKFAKTTPEYIFHCQSAVMSATFAKFHPNLIIGGTYSGQIVLWD-NRSSKRTPVQRTPLSATAHTHPVYCVNV----VGTQNAHNLISVSTDGKMCSWSL--------DMLSQPQDSMELQYKQSKSVAV---TCMSFLAGDVNNFVVGSEEGTVYTACRHGSKAGISDVFEGHYGP-VTGIDTHSASGPIDFSHLFLTSSFDWTLKLWSHKSPRPYYSFEDNGDYIYDVKWSPIHPALFATVDGTGRLDLWNLNSDTEVPIASTATES---LTALNNVQWTQSGQQISVGDDDGRVYIY 450          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO40075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B8])

HSP 1 Score: 62.3882 bits (150), Expect = 3.983e-10
Identity = 66/296 (22.30%), Postives = 122/296 (41.22%), Query Frame = 2
Query:  983 KLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICG----YSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIW--NCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYD 1852
            K   TSI W   Y D        Y ++ F++   IC     + + NP+ P+  L   SP++ ++ N  D  L+  G  +G +       +  S+PV         K HRDP ++  +L  +  +    +S S+DG++  W + K     + ++       P  +          G  +   P     F+VGT+ G++   L+ N   K+ +D  +  +   H   +Y +  + + P  F +   DW   IW  + R+S+ ++       +T   W+P    V     +D  + V+D
Sbjct:  161 KRTATSISW---YPDGTQKLAVAYSVLEFQKSTDICMDSYIWDIDNPTKPDMVLKPVSPLICLEYNPKDPHLLIGGCYNGQLGFWDT--RKGSHPV---EMTPIEKSHRDPIYKTIFL--QSKSGTDCFSTSTDGQVLWWDIRKLGEPTESLLLCPNKKDPRPL---------GGVSLEFEPTMPTKFMVGTEQGSV---LSCNRKAKTPAD-KIVASYAGHYGPVYSVQRNPFFPKNFLTI-GDWQARIWSEDLRESSIMWTKCGMSYLTDGCWSPSRPGVFFTTKMDGTLDVWD 432          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 187.963 bits (476), Expect = 4.715e-52
Identity = 124/401 (30.92%), Postives = 205/401 (51.12%), Query Frame = 2
Query:  773 KRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            ++ +L+ E    +++ I    K++ER +  N+  +IA DF +YEDP+DEF     GTL+PLW F +  T+ L V+++ W+  Y D+F V  G  +    +  G +  YSLKNP+YPEY   T S V  +D++ +   L+ AG  DG V + +L +     PV   +S+  + KH DP  Q+ W   + +N   FYS+S DG+I  W++ K  ++   +    Q    + +  + +   +           Y   LV       ++  +M         Y      + H + +  + W+ +HP +F SCS D T+ IW+   + P+  +DL   V  +A++P++STV AAVT    V  YD SI+  E  +CQ    +K K  LT++ F+  + II+IGD +
Sbjct:   21 RKKTLLMETKIDELSKIRESCKLMERAVVQNSLCDIAIDFKFYEDPSDEF-IGHEGTLMPLWNFRYKGTKHLTVSALCWNRRYLDMFAVGMGTEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNL-KVEKLKPV--CASSPETGKHMDPVIQLCWQKDDINNNHNFYSVSLDGQIVSWTLVKVNMH---VYVFSQYLEVLQLYLLLNLSFDP---------LYGQILVFF----FFFQCSMTYTGHPMEVY------DAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDHTVTTPISNIDLKEPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSISIYEA-ICQQEVVNKRKGQLTKLEFNPIHLIIIIGDGK 394          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 159.073 bits (401), Expect = 6.519e-42
Identity = 135/453 (29.80%), Postives = 206/453 (45.47%), Query Frame = 2
Query:  662 QSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIW-----------SSFYKDLFVVSHGMYEIVSFEEQ--GAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNE--NIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            Q VIYD+Y+ + K++       L                  L      G    +L   KIL  +     FD +  DF +YEDP+DEF     GTL+PLW F +  T+ L V+++ W            + +  +FV S  ++    F++Q  G +  YSLKNP+YPEY   T S V  +D++ +   L+ AG  DG V + +L +     PV   +S+  + KH DP  Q+ W   + +N   FYS+S D                                       S T I  H    + FLVGT +G I         +K +  Y+    E  + H + +  + W+ +HP +F SCS D T+ IW+   + P+  +DL   V  +A++P++STV AAVT    V  YD SI+  E  +CQ    +K K  LT++ F+  + II+IGD +
Sbjct:    6 QWVIYDAYKKELKKRQEQEGGHL------------------LKENSDTGRKKTLLMETKIL--LFFFFYFDSLI-DFKFYEDPSDEF-IGHEGTLMPLWNFRYKGTKHLTVSALCWMQSIHTCTNLKKNVFICVFVSSVLLFPEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNL-KVEKLKPVC--ASSPETGKHMDPVIQLCWQKDDINNNHNFYSVSLD--------------------------------------VSCTSIDFHKDIPNLFLVGTLEGMI---------LKCSMTYTGHPMEVYDAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDHTVTTPISNIDLKEPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSISIYEA-ICQQEVVNKRKGQLTKLEFNPIHLIIIIGDGK 385          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:101174321])

HSP 1 Score: 148.288 bits (373), Expect = 1.059e-36
Identity = 104/361 (28.81%), Postives = 171/361 (47.37%), Query Frame = 2
Query:  953 LWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKW------LPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVAL-RQINLPIDMETVADRFLES------GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVT-SIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            LW FS + TR   V+S+ W+    DL  V +G ++  + E  G +C +SLKNP++PE  +  +S V ++D +      +  GL DG + I  +    S +  + L S+    +H  P WQ++W      LP E + +    S+ +DGRI +W V    L   +++ L R I    D +T                C+  HP +   +L GT +G I+       +  +N  Y  T+ +  H   +  + W     DIF SCSAD TI +W   Q NP+        V   I W+P  +TV AAV  D ++ V+D +++ L P++ Q    +   V L  ++F+ +   +++GDS     +Y
Sbjct:  381 LWAFSCELTRGFSVSSMAWNKKNPDLLAVGYGEFDSTN-ERAGLVCCWSLKNPTWPERVVRCESAVTSLDFSATRPSHLAVGLFDGSIAIYDIQNPDSIS--LFLDSSKCPSRHLGPVWQLRWNQQEFGLPAE-ERLEVLISVGADGRIIKWVVCTGNLGHTELMKLKRTIYKNPDAKTTESISQSLISSLIPALCLDFHPTEPGIYLTGTWEGLIH-----KCSCSNNQQYLDTYRK--HYCAVNYVAWCPLSDDIFLSCSADCTIQLWTQNQHNPMLSFSTTRKVVHDIKWSPKWATVFAAV-YDEQLEVWDLNLSCLSPVIVQ---PALPGVRLASLLFASHTDCVVVGDSCGQVTVY 726          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: ENSORLT00000002152.2 (WD repeat-containing protein 78 [Source:NCBI gene;Acc:101160807])

HSP 1 Score: 146.747 bits (369), Expect = 3.940e-36
Identity = 106/369 (28.73%), Postives = 179/369 (48.51%), Query Frame = 2
Query:  932 SHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKW-------LPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLES-------GTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVL-DLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYYFIY 1993
            S  T+ PLW F  + T    +TS+ W+    ++  VS+   +  S      IC +SL NP +P+      S V ++D + +DH  +  G+ DG V I ++  +     V   +S+    +H  P WQV W         +E + ++   S+S+DGRI  W      L C D++ +R+I+       V+    E+       G C+  HPK+   +LVG+ DG + +  ++N+N +    Y        H + +  + WS + PD+F SCS+D TI +W     +PL     +   V ++ W+P  STV AA+   ++V V++ S N L P+   VV  +   V+LT ++F+     +L+GDS     +Y
Sbjct:  381 SSPTIKPLWTFDSELTTGRMITSMTWNKKNLNILAVSYSDCD-PSSSRASFICCWSLNNPLWPQRIFSCPSRVASMDFSSSDHGHLAVGMYDGSVAIYNVQIQDRGACVA--TSSKCPNRHLRPVWQVAWNKQESKFSGLEAEEVLV--SMSADGRISMWQRCNNHLECIDLMKIRRIHDDKRGNGVSKMVGETILSEVSPGHCLDFHPKESDIYLVGSWDG-LIHKCSLNNNQQFLDSYQK------HLLAVNDIQWSPFSPDLFLSCSSDCTIQLWRHTCLSPLLSFKSVHSQVCAVRWSPERSTVFAAI-YRQQVEVWELSSNILSPV---VVHHAAAGVTLTALLFARGTDCVLVGDSEGKVTVY 733          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: wdr34 (WD repeat domain 34 [Source:NCBI gene;Acc:101171758])

HSP 1 Score: 84.3445 bits (207), Expect = 1.065e-16
Identity = 85/345 (24.64%), Postives = 148/345 (42.90%), Query Frame = 2
Query:  992 VTSIIWSSFYKDLFVVSHGMYEIVSFE-EQGAICGYSLKN----PSYPEYTLFTKSPVLAIDMNINDHR-----LICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKY--ELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNS---------DYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFA-VTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIIL 1960
            VTS+ WS     +   ++G  +   +  E+  +C ++L+      + P   +   S V A+  + N        L+  GL +G V++ +  +  + +PV    + M S  HR+P +QV W+P++K       S  S GR+  W V+ Y   L   D  AL +  +P  +       +   T +AL P    TFLVG+ +G +    + +S M +                F    H   +Y L  S +H ++F S   D    I +  Q++PL  L +  + V  + W+P    V AA +    V+++D     L P      G + H  + T + F+ + P +L
Sbjct:  129 VTSVSWSC-TGSVVACAYGRTDDGDWSTERSCVCLWNLEQRGLQSNQPNLIIDAPSAVTALCCHPNHPSELWDVLVAGGLYNGEVVVWNTSQ--TQDPVW-AQTGMSSDSHREPVYQVAWVPLQKKGDFGILSACSGGRVLLWLVDSYRTRLVLNDGYALAKQQIPHSISGRGSNTVGV-TSLALSPWDSDTFLVGS-EGGLQLKCSFSSRMLAAVPSEGLSVALKAPAVFAFRPHSGPVYSLHCSPFHRNLFVSAGTDGLAHIHSLLQADPLLSLRVSDSYVFQVQWSPTRPLVFAAASGQGDVQIFDLGRRSLRPAASIQDGGADH--AATCLDFNRHRPRVL 465          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000066594.1 (SMESG000066594.1)

HSP 1 Score: 1348.57 bits (3489), Expect = 0.000e+0
Identity = 647/647 (100.00%), Postives = 647/647 (100.00%), Query Frame = 2
Query:   35 MPLKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 1975
            MPLKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR
Sbjct:    1 MPLKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSR 647          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001839.1 (SMESG000001839.1)

HSP 1 Score: 337.806 bits (865), Expect = 1.384e-108
Identity = 182/454 (40.09%), Postives = 274/454 (60.35%), Query Frame = 2
Query:   41 LKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNK 1402
            +K  + +K+      + ++D     P  +  +  +  +VKP DQ+ LTEQEL+EE T++L ATNP AP NIV++NFKEM YKP+  +D   +HFS++ NL+++DS E    ++    L D+          +      E E   + SQ  T  + E       +   K +NQF +C RA+QT NNP + +   +E PPR  FSDN+ Q VIYD+Y  DF++Q + +K +   FG   K+    KK+++ + E    +++ I   +KI+ERM+N NTFDEI+QDF YYEDP+DE+R D  GTLLPLW+F+FDK +K+ VT++ WS  Y DLF V HG Y+ +  +  G IC Y+LKNPSYPEY   T+S VL++D++ +   ++C G  DG V + ++ ++ S    +   S   + KH DP W+VKW   + DN + FYS+S+DGR+  W++ K
Sbjct:    1 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDD-------LKEDKEPGEGETETEDLSSQKETPVEPE-------VSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQ-SKEKKATFG--TKVEEKSKKKLTSI-ETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYR-DQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMK-QSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYL---STAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 431          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001839.1 (SMESG000001839.1)

HSP 1 Score: 336.265 bits (861), Expect = 8.873e-108
Identity = 178/420 (42.38%), Postives = 261/420 (62.14%), Query Frame = 2
Query:  143 YQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNK 1402
            +  +VKP DQ+ LTEQEL+EE T++L ATNP AP NIV++NFKEM YKP+  +D   +HFS++ NL+++DS E    ++    L D+          +      E E   + SQ  T  + E       +   K +NQF +C RA+QT NNP + +   +E PPR  FSDN+ Q VIYD+Y  DF++Q + +K +   FG   K+    KK+++ + E    +++ I   +KI+ERM+N NTFDEI+QDF YYEDP+DE+R D  GTLLPLW+F+FDK +K+ VT++ WS  Y DLF V HG Y+ +  +  G IC Y+LKNPSYPEY   T+S VL++D++ +   ++C G  DG V + ++ ++ S    +   S   + KH DP W+VKW   + DN + FYS+S+DGR+  W++ K
Sbjct:   57 HSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDD-------LKEDKEPGEGETETEDLSSQKETPVEPE-------VSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQ-SKEKKATFG--TKVEEKSKKKLTSI-ETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYR-DQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMK-QSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYL---STAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 453          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001830.1 (SMESG000001830.1)

HSP 1 Score: 258.84 bits (660), Expect = 3.278e-79
Identity = 138/323 (42.72%), Postives = 203/323 (62.85%), Query Frame = 2
Query:  434 NIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRICEWSVNK 1402
            NIV  N + E+  + SQ  T  + E       +   K +NQF +C RA+QT NNP + +   +E PPR  FSDN+ Q VIYD+Y  DF++Q + +K +   FG   K+    KK+++ + E    +++ I   +KI+ERM+N NTFDEI+QDF YYEDP+DE+R D  GTLLPLW+F+FDK +K+ VT++ WS  Y DLF V HG Y+ +  +  G IC Y+LKNPSYPEY   T+S VL++D++ +   ++C G  DG V + ++ ++ S    +   S   + KH DP W+VKW   + DN + FYS+S+DGR+  W++ K
Sbjct:   70 NIVRFNFKTED--LSSQKETPVEPE-------VSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQ-SKEKKATFG--TKVEEKSKKKLTSI-ETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYR-DQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHGSYDFMK-QSNGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKSGPLYL---STAQTGKHTDPVWEVKWQREDFDNNLNFYSVSADGRVTSWTLIK 374          

HSP 2 Score: 63.5438 bits (153), Expect = 2.539e-10
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:   41 LKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFK 271
            +K  + +K+      + ++D     P  +  +  +  +VKP DQ+ LTEQEL+EE T++L ATNP AP NIV++NFK
Sbjct:    1 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFK 77          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001830.1 (SMESG000001830.1)

HSP 1 Score: 232.646 bits (592), Expect = 2.099e-70
Identity = 131/336 (38.99%), Postives = 186/336 (55.36%), Query Frame = 2
Query:   41 LKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLTEQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDSNLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQTSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHG 1048
            +K  + +K+      + ++D     P  +  +  +  +VKP DQ+ LTEQEL+EE T++L ATNP AP NIV++NFKEM YKP+  +D   +HFS++ NL+++DS E    ++    L D+          +      E E   + SQ  T  + E       +   K +NQF +C RA+QT NNP + +   +E PPR  FSDN+ Q VIYD+Y  DF                                EK   +++ I   +KI+ERM+N NTFDEI+QDF YYEDP+DE+R D  GTLLPLW+F+FDK +K+ VT++ WS  Y DLF V HG
Sbjct:    1 MKGAKDKKTKGRRRSKIEEDIPEAGPQDDLGDFMHSKIVKPEDQMQLTEQELKEEFTRILTATNPHAPQNIVRFNFKEMCYKPIAQVDQLAVHFSVEGNLLHRDSDEGRRQMAKQGKLIDD-------LKEDKEPGEGETETEDLSSQKETPVEPE-------VSEKKLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDF--------------------------------EKQADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYR-DQQGTLLPLWRFTFDKAKKIAVTALSWSPKYHDLFAVGHG 289          
The following BLAST results are available for this feature:
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAI11.649e-12635.79dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
DNAI11.769e-12635.14dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
WDR783.265e-4332.60WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR781.765e-3429.86WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DNAI13.517e-3029.89dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dyci-15.070e-1622.27DYnein Chain, light Intermediate [Source:UniProtK... [more]
lin-532.983e-623.73Probable histone-binding protein lin-53 [Source:U... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93139.836e-9537.81gene:FBgn0034566 transcript:FBtr0071521[more]
CG93139.836e-9537.81gene:FBgn0034566 transcript:FBtr0345666[more]
CG93131.017e-9437.81gene:FBgn0034566 transcript:FBtr0342788[more]
Dic61B6.856e-1626.33gene:FBgn0263988 transcript:FBtr0072538[more]
Dic61B1.152e-1526.67gene:FBgn0263988 transcript:FBtr0072539[more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.25.939e-13338.76dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.11.478e-7630.86dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
dnai1.12.671e-7533.74dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
wdr781.005e-4029.97WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
wdr781.005e-4029.97WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb55.542e-4329.78cAMP responsive element binding protein 5 [Source:... [more]
creb53.764e-4229.30cAMP responsive element binding protein 5 [Source:... [more]
creb54.419e-4229.30cAMP responsive element binding protein 5 [Source:... [more]
rwdd2b1.343e-1424.09RWD domain containing 2B [Source:Xenbase;Acc:XB-GE... [more]
ogfod33.571e-1424.492-oxoglutarate and iron-dependent oxygenase domain... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnaic11.788e-13236.87dynein, axonemal, intermediate chain 1 [Source:MGI... [more]
Wdr787.996e-4329.75WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr786.676e-1733.95WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr786.676e-1733.95WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr785.187e-1326.27WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16959|DYI2_HELCR1.197e-14539.88Dynein intermediate chain 2, ciliary OS=Heliocidar... [more]
sp|Q32KS2|DNAI1_BOVIN1.691e-13236.54Dynein intermediate chain 1, axonemal OS=Bos tauru... [more]
sp|Q5XIL8|DNAI1_RAT8.848e-13236.98Dynein intermediate chain 1, axonemal OS=Rattus no... [more]
sp|Q8C0M8|DNAI1_MOUSE1.251e-13136.87Dynein intermediate chain 1, axonemal OS=Mus muscu... [more]
sp|Q9UI46|DNAI1_HUMAN8.498e-12635.14Dynein intermediate chain 1, axonemal OS=Homo sapi... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GR102.209e-15141.50WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
A0A5K4F0L63.434e-15141.21Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
C3Y1H71.051e-14941.61WD_REPEATS_REGION domain-containing protein OS=Bra... [more]
A0A4S2L4932.871e-14639.90WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A3M6TUP43.159e-14641.12WD_REPEATS_REGION domain-containing protein OS=Poc... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.26.701e-14040.55dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
wdr781.499e-3830.11WD repeat domain 78 [Source:NCBI gene;Acc:10304656... [more]
wdr341.832e-1725.23WD repeat domain 34 [Source:NCBI gene;Acc:10302228... [more]
DYNC1I13.719e-1319.40dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
dync1i2b3.773e-1220.84dynein, cytoplasmic 1, intermediate chain 2b [Sour... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004773.11.072e-11942.04pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 g... [more]
ENSPMAT00000000105.11.099e-2830.74pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 ... [more]
ENSPMAT00000009966.13.238e-2357.53pep scaffold:Pmarinus_7.0:GL490051:1079:6069:1 gen... [more]
dync1i2a1.101e-1221.53dynein, cytoplasmic 1, intermediate chain 2a [Sour... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TUP17.796e-730.70General repressor of transcription; forms complex ... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361987.139e-14640.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344741.048e-3429.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432315.974e-1523.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490791.982e-1320.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400753.983e-1022.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.24.715e-5230.92dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.26.519e-4229.80dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
wdr781.059e-3628.81WD repeat domain 78 [Source:NCBI gene;Acc:10117432... [more]
ENSORLT00000002152.23.940e-3628.73WD repeat-containing protein 78 [Source:NCBI gene;... [more]
wdr341.065e-1624.64WD repeat domain 34 [Source:NCBI gene;Acc:10117175... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066594.10.000e+0100.00SMESG000066594.1[more]
SMESG000001839.11.384e-10840.09SMESG000001839.1[more]
SMESG000001839.18.873e-10842.38SMESG000001839.1[more]
SMESG000001830.13.278e-7942.72SMESG000001830.1[more]
SMESG000001830.12.099e-7038.99SMESG000001830.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018869 ID=SMED30018869|Name=Dynein intermediate chain 2, ciliary|organism=Schmidtea mediterranea sexual|type=transcript|length=2209bp
TTATATGAAATTTAATTGTATATAACACAATTAAATGCCATTGAAACCAT
TTGAAAAAAGAAAAAGTAATGCGTTCTATTTGAAACGCAAAGATGATGAC
TTTTACACTAAAGATCCAACATTAAACGAAAATGAGGACCATTATCAAAC
TTTAGTTAAACCACCCGATCAGCTAAATTTAACTGAACAAGAACTTCGGG
AAGAAATTACTAAAGTTTTAAAAGCCACCAACCCAGCTGCTCCTGATAAT
ATCGTTAAATATAATTTTAAAGAAATGCAGTACAAACCAGTCCCATACAT
TGACCATACTACAATTCATTTCTCAATGGACAGTAATCTTGTATATAAAG
ATTCAATGGAAGCTGTGTCTAATCTGTCAGTTCCAGCATTTTTAGATGAT
AACAGCGTTCATCTTCCAATAGAATTCGATGCAAATATAGTATTGGAGAA
CTTAGAACAAGAAAACAGTACGATGCTCAGTCAAACGAGTACAACGTTTA
AACAGGAAGCATGGAATGAAAACTCCAATTTAGATAGTAATAAGTCTTCT
AATCAATTTCTTTACTGCCATAGAGCTACTCAGACGTTGAACAATCCGTT
ACAAACCAAGATAACTCAGAGCGAATATCCGCCAAGAAAGATGTTTTCTG
ATAACTTGGATCAATCAGTTATATATGATAGTTATGAGATTGACTTTAAA
AGACAAAATAGAATAAATAAGTCAAGGCTCACAAATTTTGGAGGAAGTCA
GAAAATAATTGTACCAGACAAAAAACGTATTTCGTTAGTCCATGAAAAAC
ATTTTGGTGATATTACGCCGATTTTACCAGTTGTGAAAATTTTGGAAAGA
ATGATAAATCTTAATACGTTTGACGAAATCGCTCAAGATTTTTCATACTA
TGAAGACCCTGCTGATGAATTTAGATTTGATTCTCATGGAACTTTATTAC
CTTTATGGAAATTTTCTTTTGATAAAACACGGAAATTACCAGTTACGTCT
ATTATTTGGAGTTCATTTTACAAGGATCTTTTTGTTGTTAGTCATGGAAT
GTATGAAATTGTATCTTTTGAAGAGCAAGGAGCAATTTGTGGCTACTCCT
TGAAAAATCCCAGTTATCCGGAGTACACGCTATTTACCAAGAGCCCGGTT
CTAGCCATAGATATGAATATAAACGATCACCGACTAATTTGCGCAGGGCT
TCTTGATGGAGGAGTAATGATAATATCGCTTCATGAAAAATCCTCAAGTA
ATCCAGTCATTCGTCTTTCTAGTAATATGCACAGTAAAAAGCATAGAGAT
CCATGTTGGCAAGTGAAATGGCTACCGATCGAGAAAGACAATATCATGGC
ATTTTACTCTATAAGTAGTGATGGTAGAATATGTGAATGGTCAGTCAACA
AATACGAACTAAATTGTCAAGATATTGTAGCATTGCGTCAAATAAATTTA
CCAATAGATATGGAGACCGTGGCAGATAGATTTTTAGAATCAGGAACTTG
CATAGCATTACATCCTAAAAAGTATCACACGTTTTTGGTTGGCACTCAAG
ATGGAAATATTTATTATCATTTGACAATGAATTCTAACATGAAATCCAAC
TCAGATTATTCTATGACATTCAATGAAAATATTCATAAAATGATAATATA
TCAATTAGTTTGGTCGAATTGGCACCCTGATATTTTTGCCAGTTGTTCAG
CAGATTGGACAATAGGAATATGGAATTGTAGACAAAGCAACCCATTATTT
GTATTGGATCTTGGATTCGCGGTTACAAGCATTGCCTGGGCACCTTATTC
AAGTACAGTTTTAGCAGCCGTTACAGTCGATAGAAAAGTGCGAGTTTATG
ATTTTTCAATAAATCGTTTAGAGCCTTTAGTTTGCCAAGTGGTTGGATCA
AGCAAACATAAAGTATCATTAACACAAATTGTTTTCAGTGACAATTATCC
CATCATTTTGATTGGTGATTCCAGGTTTTATTATTTTATTTATTTTTCCA
AAATCACTTTCCTACATGAATACATTGTTAAGCAATATTTATTTAAGATA
TTCCAAGCCAGAATATGCAATTTTAATACTTTTTATACTGCTTCATATCG
CATAATCTGTAAAAGGGATCTTATTAGTTTAAACGATATTATAGATACAG
ATCATATACATTGATACTTGATACTTGTTGATAATTGTGGATAATTGATA
ATTGCGAGG
back to top

protein sequence of SMED30018869-orf-1

>SMED30018869-orf-1 ID=SMED30018869-orf-1|Name=SMED30018869-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=710bp
MPLKPFEKRKSNAFYLKRKDDDFYTKDPTLNENEDHYQTLVKPPDQLNLT
EQELREEITKVLKATNPAAPDNIVKYNFKEMQYKPVPYIDHTTIHFSMDS
NLVYKDSMEAVSNLSVPAFLDDNSVHLPIEFDANIVLENLEQENSTMLSQ
TSTTFKQEAWNENSNLDSNKSSNQFLYCHRATQTLNNPLQTKITQSEYPP
RKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFGGSQKIIVPDKKRIS
LVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDS
HGTLLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGA
ICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLH
EKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNIMAFYSISSDGRIC
EWSVNKYELNCQDIVALRQINLPIDMETVADRFLESGTCIALHPKKYHTF
LVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDI
FASCSADWTIGIWNCRQSNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDR
KVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRFYY
FIYFSKITFLHEYIVKQYLFKIFQARICNFNTFYTASYRIICKRDLISLN
DIIDTDHIH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0003351epithelial cilium movement
GO:0007368determination of left/right symmetry
GO:0007507heart development
GO:0030317flagellated sperm motility
GO:0036158outer dynein arm assembly
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0030286dynein complex
GO:0036157outer dynein arm
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 522..564
e-value: 0.02
score: 24.1
coord: 404..453
e-value: 28.0
score: 7.9
coord: 359..398
e-value: 43.0
score: 6.7
coord: 567..606
e-value: 0.027
score: 23.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 477..650
e-value: 1.8E-19
score: 72.1
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 299..467
e-value: 8.8E-11
score: 43.4
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 35..647
NoneNo IPR availablePANTHERPTHR12442:SF11DYNEIN INTERMEDIATE CHAIN 1, AXONEMALcoord: 35..647
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 319..653