Diacylglycerol kinase

Overview
NameDiacylglycerol kinase
Smed IDSMED30018866
Length (bp)3964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diacylglycerol kinase (SMED30018866) t-SNE clustered cells

Violin plots show distribution of expression levels for Diacylglycerol kinase (SMED30018866) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diacylglycerol kinase (SMED30018866) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diacylglycerol kinase (SMED30018866) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018866

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018866SMESG000051710.1 SmedASXL_016792SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018866SMESG000051710.1 dd_Smed_v4_12579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018866SMESG000051710.1 dd_Smed_v4_12579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018866SMESG000051710.1 dd_Smed_v4_12579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018866SMESG000051710.1 dd_Smed_v4_12579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018866SMESG000051710.1 dd_Smed_v4_12579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018866SMESG000051710.1 dd_Smed_v6_12579_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30018866SMESG000051710.1 SMED30018866smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
enteric muscle cellSMED30018866SMESG000051710.1 dd_Smed_v4_12579_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKI (diacylglycerol kinase iota [Source:HGNC Symbol;Acc:HGNC:2855])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 331/772 (42.88%), Postives = 450/772 (58.29%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEE--------DFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++  + Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G +  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++  +                   Q     L++ V  I L DYE    +K+K+ EA+    ++   G  +L   R  I ++  D                            L   + F+D+ ++DRF+RI + +E +HF+M+I  +++++LDP +
Sbjct:  164 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDIHQVQTADLRRVSAPPGSFTIPQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDATSADRFYRIDRSQEHLHFVMEISQDEIFILDPDM 870          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKI (diacylglycerol kinase iota [Source:HGNC Symbol;Acc:HGNC:2855])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 327/754 (43.37%), Postives = 444/754 (58.89%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----------DKSFTFIDSATSDRF-----FRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++  + Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G +  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++              Q     L++ V  I L DYE    +K+K+ EA+    ++   G  +L   R  I ++  D   +          D   +F  + ++ R      F   + +E +HF+M+I  +++++LDP +
Sbjct:  164 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLND-------------PQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILDPDM 839          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKI (diacylglycerol kinase iota [Source:HGNC Symbol;Acc:HGNC:2855])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 332/773 (42.95%), Postives = 447/773 (57.83%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGS--SNLSAVRDNILKMTSDTCMLDKSFTFID---------SATSDRF-----------------------FRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++  + Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G +  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++              Q     L++ V  I L DYE    +K+K+ EA+    + T +G    +  A+   IL +  D C L+    +ID         S+ S R                        F   + +E +HF+M+I  +++++LDP +
Sbjct:   31 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLND-------------PQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGD-CDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILDPDM 724          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKI (diacylglycerol kinase iota [Source:HGNC Symbol;Acc:HGNC:2855])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 332/773 (42.95%), Postives = 447/773 (57.83%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGS--SNLSAVRDNILKMTSDTCMLDKSFTFID---------SATSDRF-----------------------FRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++  + Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G +  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++              Q     L++ V  I L DYE    +K+K+ EA+    + T +G    +  A+   IL +  D C L+    +ID         S+ S R                        F   + +E +HF+M+I  +++++LDP +
Sbjct:  164 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLND-------------PQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGD-CDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILDPDM 857          
BLAST of Diacylglycerol kinase vs. Ensembl Human
Match: DGKZ (diacylglycerol kinase zeta [Source:HGNC Symbol;Acc:HGNC:2857])

HSP 1 Score: 456.833 bits (1174), Expect = 2.141e-144
Identity = 227/485 (46.80%), Postives = 310/485 (63.92%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMT---------SDTCM-LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            VF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE +SKI+S VEEG +  LDRW+L + P               N +   E  +  A  + PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG+D TP+I+++KP  ++FLNI RY  GT PWG+P     F PQ  +DG LEV+G T  SLA LQVGGH +R+ QC+  V+TT K IP+QVDGEPC+L  S I I+    A ++ K KRRS+ PL S+              Q   + L++ V  + + DYE    +K+++ EA+     +   G S+L   R +I ++          S TC  L   + F+D+ T+ RF+RI + +E ++++ +I  +++Y+LDP+L
Sbjct:   77 VFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEP---------------NPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSD-------------QQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPEL 533          

HSP 2 Score: 53.9138 bits (128), Expect = 2.168e-6
Identity = 41/137 (29.93%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 3503 KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            + +EA K      +Q     G D +  D++  + LH+AV  G+  VV YL++ AP  +L+  +  +G+T +H+AAA+G ++IC  ++ AGASL+  D    TP Q  +   D +L  +L+  +    I+ + ++  +
Sbjct:  572 ELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEE-NGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV 707          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-5 (Putative diacylglycerol kinase K06A1.6 [Source:UniProtKB/Swiss-Prot;Acc:Q10024])

HSP 1 Score: 494.582 bits (1272), Expect = 7.417e-157
Identity = 285/737 (38.67%), Postives = 398/737 (54.00%), Query Frame = 2
Query: 1034 HLWVDTN-----SSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLC---IPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKE---IVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITD-RGPRLGLELFGKIAN-VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCV-EEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFN-QDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----DKSFTFID--SATSDRFFRIAKDKESVHFLMDICLED--LYVLDPKLPS 3175
            H+W+ ++     S+   CY+ E  C + G KR+C++C ++ H  C   +  L L C+ TFR+   +    ++  +    HHWVH+ R +G+C  C KSFQ K     KE    +AV CSWCK  YH K  CFA   L E C+RG   + I+PP+WI+++A +       R SR+P +  R        F+ KP +  + S PS+                             P +              VF+NPKSGGN G K +    WLLNPRQVFDIT  +GP+ GLE+F K+   +RILVCGGDGTVGWV+S +D+L     PP+AI+PLGTGNDLAR   WG  ++DE +S+++  +  E  +  LDRW +   PN       +D+  MQ              S  PL V  NYFS+GADA  AL+FH SR ANP+  NSRLKN+I Y G+G  D+ KRSWKDLC+YITL CDG+D TPRIKE+K H +LF NI  Y+GGT PWG  +      S  DGK+EV+G T A+LA LQ+GG  +RI QC    V T K IPMQVDGEPC L PS I++  H    ++   KR    P      ++  R  ++D   Q    +++L V V+   DY+      +++ + A    ++     + L + R  I ++  +   L    DK++ F+D  S   +  FR+++ +E V  + D+C  D  L +LD   PS
Sbjct:  161 HVWLPSSTGSSASADSECYVGEKDCRRSGEKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHEGRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKN-CFARDKLEERCNRGALKEMIVPPTWILRLANRK------RSSRTP-SHPRKHKKSHRQFVVKPTDLWS-SGPSQ-----------------------------PLL--------------VFVNPKSGGNKGSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDNLNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEPNTSCNLEEEDD-GMQ--------------SALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYGGLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD--NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPSIITLGFHSKVPML---KREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDNYKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNAEEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPS 825          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-5 (Putative diacylglycerol kinase K06A1.6 [Source:UniProtKB/Swiss-Prot;Acc:Q10024])

HSP 1 Score: 495.352 bits (1274), Expect = 2.262e-156
Identity = 285/737 (38.67%), Postives = 398/737 (54.00%), Query Frame = 2
Query: 1034 HLWVDTN-----SSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLC---IPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKE---IVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITD-RGPRLGLELFGKIAN-VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCV-EEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFN-QDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----DKSFTFID--SATSDRFFRIAKDKESVHFLMDICLED--LYVLDPKLPS 3175
            H+W+ ++     S+   CY+ E  C + G KR+C++C ++ H  C   +  L L C+ TFR+   +    ++  +    HHWVH+ R +G+C  C KSFQ K     KE    +AV CSWCK  YH K  CFA   L E C+RG   + I+PP+WI+++A +       R SR+P +  R        F+ KP +  + S PS+                             P +              VF+NPKSGGN G K +    WLLNPRQVFDIT  +GP+ GLE+F K+   +RILVCGGDGTVGWV+S +D+L     PP+AI+PLGTGNDLAR   WG  ++DE +S+++  +  E  +  LDRW +   PN       +D+  MQ              S  PL V  NYFS+GADA  AL+FH SR ANP+  NSRLKN+I Y G+G  D+ KRSWKDLC+YITL CDG+D TPRIKE+K H +LF NI  Y+GGT PWG  +      S  DGK+EV+G T A+LA LQ+GG  +RI QC    V T K IPMQVDGEPC L PS I++  H    ++   KR    P      ++  R  ++D   Q    +++L V V+   DY+      +++ + A    ++     + L + R  I ++  +   L    DK++ F+D  S   +  FR+++ +E V  + D+C  D  L +LD   PS
Sbjct:  223 HVWLPSSTGSSASADSECYVGEKDCRRSGEKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHEGRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKN-CFARDKLEERCNRGALKEMIVPPTWILRLANRK------RSSRTP-SHPRKHKKSHRQFVVKPTDLWS-SGPSQ-----------------------------PLL--------------VFVNPKSGGNKGSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDNLNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEPNTSCNLEEEDD-GMQ--------------SALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYGGLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD--NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPSIITLGFHSKVPML---KREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDNYKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNAEEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPS 887          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-5 (Putative diacylglycerol kinase K06A1.6 [Source:UniProtKB/Swiss-Prot;Acc:Q10024])

HSP 1 Score: 494.197 bits (1271), Expect = 5.987e-156
Identity = 285/737 (38.67%), Postives = 398/737 (54.00%), Query Frame = 2
Query: 1034 HLWVDTN-----SSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLC---IPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKE---IVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITD-RGPRLGLELFGKIAN-VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCV-EEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFN-QDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----DKSFTFID--SATSDRFFRIAKDKESVHFLMDICLED--LYVLDPKLPS 3175
            H+W+ ++     S+   CY+ E  C + G KR+C++C ++ H  C   +  L L C+ TFR+   +    ++  +    HHWVH+ R +G+C  C KSFQ K     KE    +AV CSWCK  YH K  CFA   L E C+RG   + I+PP+WI+++A +       R SR+P +  R        F+ KP +  + S PS+                             P +              VF+NPKSGGN G K +    WLLNPRQVFDIT  +GP+ GLE+F K+   +RILVCGGDGTVGWV+S +D+L     PP+AI+PLGTGNDLAR   WG  ++DE +S+++  +  E  +  LDRW +   PN       +D+  MQ              S  PL V  NYFS+GADA  AL+FH SR ANP+  NSRLKN+I Y G+G  D+ KRSWKDLC+YITL CDG+D TPRIKE+K H +LF NI  Y+GGT PWG  +      S  DGK+EV+G T A+LA LQ+GG  +RI QC    V T K IPMQVDGEPC L PS I++  H    ++   KR    P      ++  R  ++D   Q    +++L V V+   DY+      +++ + A    ++     + L + R  I ++  +   L    DK++ F+D  S   +  FR+++ +E V  + D+C  D  L +LD   PS
Sbjct:  227 HVWLPSSTGSSASADSECYVGEKDCRRSGEKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHEGRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKN-CFARDKLEERCNRGALKEMIVPPTWILRLANRK------RSSRTP-SHPRKHKKSHRQFVVKPTDLWS-SGPSQ-----------------------------PLL--------------VFVNPKSGGNKGSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDNLNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEPNTSCNLEEEDD-GMQ--------------SALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYGGLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD--NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPSIITLGFHSKVPML---KREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDNYKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNAEEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPS 891          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-5 (Putative diacylglycerol kinase K06A1.6 [Source:UniProtKB/Swiss-Prot;Acc:Q10024])

HSP 1 Score: 494.582 bits (1272), Expect = 1.365e-155
Identity = 285/737 (38.67%), Postives = 398/737 (54.00%), Query Frame = 2
Query: 1034 HLWVDTN-----SSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLC---IPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKE---IVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITD-RGPRLGLELFGKIAN-VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCV-EEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFN-QDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----DKSFTFID--SATSDRFFRIAKDKESVHFLMDICLED--LYVLDPKLPS 3175
            H+W+ ++     S+   CY+ E  C + G KR+C++C ++ H  C   +  L L C+ TFR+   +    ++  +    HHWVH+ R +G+C  C KSFQ K     KE    +AV CSWCK  YH K  CFA   L E C+RG   + I+PP+WI+++A +       R SR+P +  R        F+ KP +  + S PS+                             P +              VF+NPKSGGN G K +    WLLNPRQVFDIT  +GP+ GLE+F K+   +RILVCGGDGTVGWV+S +D+L     PP+AI+PLGTGNDLAR   WG  ++DE +S+++  +  E  +  LDRW +   PN       +D+  MQ              S  PL V  NYFS+GADA  AL+FH SR ANP+  NSRLKN+I Y G+G  D+ KRSWKDLC+YITL CDG+D TPRIKE+K H +LF NI  Y+GGT PWG  +      S  DGK+EV+G T A+LA LQ+GG  +RI QC    V T K IPMQVDGEPC L PS I++  H    ++   KR    P      ++  R  ++D   Q    +++L V V+   DY+      +++ + A    ++     + L + R  I ++  +   L    DK++ F+D  S   +  FR+++ +E V  + D+C  D  L +LD   PS
Sbjct:  272 HVWLPSSTGSSASADSECYVGEKDCRRSGEKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHEGRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKN-CFARDKLEERCNRGALKEMIVPPTWILRLANRK------RSSRTP-SHPRKHKKSHRQFVVKPTDLWS-SGPSQ-----------------------------PLL--------------VFVNPKSGGNKGSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDNLNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEPNTSCNLEEEDD-GMQ--------------SALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYGGLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD--NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPSIITLGFHSKVPML---KREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDNYKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNAEEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPS 936          
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Match: dgk-5 (Putative diacylglycerol kinase K06A1.6 [Source:UniProtKB/Swiss-Prot;Acc:Q10024])

HSP 1 Score: 495.352 bits (1274), Expect = 3.522e-154
Identity = 285/738 (38.62%), Postives = 400/738 (54.20%), Query Frame = 2
Query: 1034 HLWVDTN-----SSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLC---IPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKE---IVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITD-RGPRLGLELFGKIAN-VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCV-EEGQIKPLDRWNLASTPN-QCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFN-QDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----DKSFTFID--SATSDRFFRIAKDKESVHFLMDICLED--LYVLDPKLPS 3175
            H+W+ ++     S+   CY+ E  C + G KR+C++C ++ H  C   +  L L C+ TFR+   +    ++  +    HHWVH+ R +G+C  C KSFQ K     KE    +AV CSWCK  YH K  CFA   L E C+RG   + I+PP+WI+++A +       R SR+P +  R        F+ KP +  + S PS+                             P +              VF+NPKSGGN G K +    WLLNPRQVFDIT  +GP+ GLE+F K+   +RILVCGGDGTVGWV+S +D+L     PP+AI+PLGTGNDLAR   WG  ++DE +S+++  +  E  +  LDRW +   PN  C   + +++  MQ              S  PL V  NYFS+GADA  AL+FH SR ANP+  NSRLKN+I Y G+G  D+ KRSWKDLC+YITL CDG+D TPRIKE+K H +LF NI  Y+GGT PWG  +      S  DGK+EV+G T A+LA LQ+GG  +RI QC    V T K IPMQVDGEPC L PS I++  H    ++   KR    P      ++  R  ++D   Q    +++L V V+   DY+      +++ + A    ++     + L + R  I ++  +   L    DK++ F+D  S   +  FR+++ +E V  + D+C  D  L +LD   PS
Sbjct:  436 HVWLPSSTGSSASADSECYVGEKDCRRSGEKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHEGRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKN-CFARDKLEERCNRGALKEMIVPPTWILRLANRK------RSSRTP-SHPRKHKKSHRQFVVKPTDLWS-SGPSQ-----------------------------PLL--------------VFVNPKSGGNKGSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDNLNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEPNTSC--NLEEEDDGMQ--------------SALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYGGLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD--NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPSIITLGFHSKVPML---KREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDNYKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNAEEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPS 1100          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: rdgA (gene:FBgn0261549 transcript:FBtr0302662)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 354/974 (36.34%), Postives = 512/974 (52.57%), Query Frame = 2
Query:  863 AVSIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ----LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSF------QSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISE-HITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLA--IFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCM----LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRS--LEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAA 3727
            ++ +     FR RK   SLG   R+      R  +A  ++ P + VP+W+ +A    H W  T++SGD C LNE  C K G + KCS+C+L+ H  CIP +     L C+PT+R+ G+R YR++     T  HHWVHRK + GKCKQCGK F      QSK    SKEIVA+ C+WC   YHNK  CF  + + EEC  G +   I+PPSWI+K+ TK NFKSS+R S   +  + S                   +  + +  +   E    ++K I           IP +              VF+NPKSGGN G KL+ KFQ LLNPRQVFD+T  GP++GL++F K  N+R+L CGGDGTVGWV+S +D +   + P+P + +LPLGTGNDLARA  WG GYTDE + KI+  +   Q   +DRW +  TPN        D+++    D   ++S P      PLNV NNYFS G DA  ALEFHE+REA+PE+FNSRL+NK++Y  +GGKD++ R +++L  ++TL CDG DFT ++++   H +LFLNI  Y GGT PW +  G   P S +DG +EVVGLT   L  LQ G H   ICQC+ A + T +TIPMQVDGE CR+ PS I I     A ++ K              +K GR    D   +  + ++L +  + +  YE+   +K+ + + A     +      +L  VR N+L    +  +    + + + FIDS T++ +FRI + +E +H++ DI +++LY+LD               E   +  + D           Q  S  A         FS+ + Q       +E +  D +             + +K       P +VMK++S  LE  +   L A +S  +  +++    G    +V+K G + LH+A    +  +V Y+I  A   L+ + D   GQTA+H AA
Sbjct:  107 SIGMQRKSAFRQRK-LDSLGAWRRKR-----RTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEE-CIKSGQRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQT----TTHHHWVHRKLEKGKCKQCGKFFPMKQAVQSKL-FGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPIIVPPSWIVKLPTKGNFKSSIRVSNKNNAASGSGGGGAGGGAGGGGGKSKKQTQRRQKGKEEKKEPRAFIVKPIPSPEV------IPVI--------------VFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMGLDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGGGYTDEPIGKILREIGMSQCVLMDRWRVKVTPN--------DDVT----DDHVDRSKP----NVPLNVINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTGKLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKP-SIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSK--------------RKHGRG---DVQVNPLEKMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVR-NMLNTKFEESISYPKVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILD--------------HEAATMPQTPD-----------QERSFAA---------FSQRQAQ-------NERRQMDQAQGRGPGSTDEDLQIGSK-------PIKVMKWKSPILEQTSDAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELGQTALHIAA 965          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: rdgA (gene:FBgn0261549 transcript:FBtr0302664)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 361/1001 (36.06%), Postives = 528/1001 (52.75%), Query Frame = 2
Query:  956 RVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ----LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSF------QSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISE-HITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLA--IFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCM----LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRS--LEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLT---DDLQLMQFLQKEEIIMKIENDPR 3892
            R  +A  ++ P + VP+W+ +A    H W  T++SGD C LNE  C K G + KCS+C+L+ H  CIP +     L C+PT+R+ G+R YR++     T  HHWVHRK + GKCKQCGK F      QSK    SKEIVA+ C+WC   YHNK  CF  + + EEC  G +   I+PPSWI+K+ TK NFKSS+R S   +  + S                   +  + +  +   E    ++K I           IP +              VF+NPKSGGN G KL+ KFQ LLNPRQVFD+T  GP++GL++F K  N+R+L CGGDGTVGWV+S +D +   + P+P + +LPLGTGNDLARA  WG GYTDE + KI+  +   Q   +DRW +  TPN        D+++    D   ++S P      PLNV NNYFS G DA  ALEFHE+REA+PE+FNSRL+NK++Y  +GGKD++ R +++L  ++TL CDG DFT ++++   H +LFLNI  Y GGT PW +  G   P S +DG +EVVGLT   L  LQ G H   ICQC+ A + T +TIPMQVDGE CR+ PS I I     A ++ K              +K GR    D   +  + ++L +  + +  YE+   +K+ + + A     +      +L  VR N+L    +  +    + + + FIDS T++ +FRI + +E +H++ DI +++LY+LD               E   +  + D           Q  S  A         FS+ + Q       +E +  D +             + +K       P +VMK++S  LE  +   L A +S  +  +++    G    +V+K G + LH+A    +  +V Y+I  A   L+ + D   GQTA+H AA    + IC +L++AGA L   D+   TP  +    +  ++  +L+ +E  M +E   R
Sbjct:   99 RTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEE-CIKSGQRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQT----TTHHHWVHRKLEKGKCKQCGKFFPMKQAVQSKL-FGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPIIVPPSWIVKLPTKGNFKSSIRVSNKNNAASGSGGGGAGGGAGGGGGKSKKQTQRRQKGKEEKKEPRAFIVKPIPSPEV------IPVI--------------VFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMGLDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGGGYTDEPIGKILREIGMSQCVLMDRWRVKVTPN--------DDVT----DDHVDRSKP----NVPLNVINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTGKLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKP-SIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSK--------------RKHGRG---DVQVNPLEKMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVR-NMLNTKFEESISYPKVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILD--------------HEAATMPQTPD-----------QERSFAA---------FSQRQAQ-------NERRQMDQAQGRGPGSTDEDLQIGSK-------PIKVMKWKSPILEQTSDAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELGQTALHIAAEQNRRDICVMLVAAGAHLDTLDSGGNTPMMVAFNKNANEIATYLESQERFMHLEKQTR 990          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: rdgA (gene:FBgn0261549 transcript:FBtr0302661)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 342/944 (36.23%), Postives = 502/944 (53.18%), Query Frame = 2
Query:  956 RVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ----LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSF------QSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISE-HITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLA--IFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCM----LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYR---SLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAA 3727
            R  +A  ++ P + VP+W+ +A    H W  T++SGD C LNE  C K G + KCS+C+L+ H  CIP +     L C+PT+R+ G+R YR++     T  HHWVHRK + GKCKQCGK F      QSK    SKEIVA+ C+WC   YHNK  CF  + + EEC  G +   I+PPSWI+K+ TK NFKSS+R S   +  + S                   +  + +  +   E    ++K I           IP +              VF+NPKSGGN G KL+ KFQ LLNPRQVFD+T  GP++GL++F K  N+R+L CGGDGTVGWV+S +D +   + P+P + +LPLGTGNDLARA  WG GYTDE + KI+  +   Q   +DRW +  TPN        D+++    D   ++S P      PLNV NNYFS G DA  ALEFHE+REA+PE+FNSRL+NK++Y  +GGKD++ R +++L  ++TL CDG DFT ++++   H +LFLNI  Y GGT PW +  G   P S +DG +EVVGLT   L  LQ G H   ICQC+ A + T +TIPMQVDGE CR+ PS I I     A ++ K              +K GR    D   +  + ++L +  + +  YE+   +K+ + + A     +      +L  VR N+L    +  +    + + + FIDS T++ +FRI + +E +H++ DI +++LY+LD                        ++     T D+ + ++        F++  ++N+++   +       S D      S  +   K   NK+ +   F + V        LE  +   L A +S  +  +++    G    +V+K G + LH+A    +  +V Y+I  A   L+ + D   GQTA+H AA
Sbjct:  117 RTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEE-CIKSGQRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQT----TTHHHWVHRKLEKGKCKQCGKFFPMKQAVQSKL-FGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPIIVPPSWIVKLPTKGNFKSSIRVSNKNNAASGSGGGGAGGGAGGGGGKSKKQTQRRQKGKEEKKEPRAFIVKPIPSPEV------IPVI--------------VFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMGLDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGGGYTDEPIGKILREIGMSQCVLMDRWRVKVTPN--------DDVT----DDHVDRSKP----NVPLNVINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTGKLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKP-SIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSK--------------RKHGRG---DVQVNPLEKMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVR-NMLNTKFEESISYPKVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILD-----------------------HEAATMPQTPDQERSFA-------AFSQRQAQNERRQMDQAQGRGPGSTDEDLQIGSKPIKVMKWKSNKD-RLFSFNEDVFGCGFSPILEQTSDAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELGQTALHIAA 968          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: rdgA (gene:FBgn0261549 transcript:FBtr0302663)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 342/944 (36.23%), Postives = 502/944 (53.18%), Query Frame = 2
Query:  956 RVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ----LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSF------QSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISE-HITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLA--IFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCM----LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYR---SLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAA 3727
            R  +A  ++ P + VP+W+ +A    H W  T++SGD C LNE  C K G + KCS+C+L+ H  CIP +     L C+PT+R+ G+R YR++     T  HHWVHRK + GKCKQCGK F      QSK    SKEIVA+ C+WC   YHNK  CF  + + EEC  G +   I+PPSWI+K+ TK NFKSS+R S   +  + S                   +  + +  +   E    ++K I           IP +              VF+NPKSGGN G KL+ KFQ LLNPRQVFD+T  GP++GL++F K  N+R+L CGGDGTVGWV+S +D +   + P+P + +LPLGTGNDLARA  WG GYTDE + KI+  +   Q   +DRW +  TPN        D+++    D   ++S P      PLNV NNYFS G DA  ALEFHE+REA+PE+FNSRL+NK++Y  +GGKD++ R +++L  ++TL CDG DFT ++++   H +LFLNI  Y GGT PW +  G   P S +DG +EVVGLT   L  LQ G H   ICQC+ A + T +TIPMQVDGE CR+ PS I I     A ++ K              +K GR    D   +  + ++L +  + +  YE+   +K+ + + A     +      +L  VR N+L    +  +    + + + FIDS T++ +FRI + +E +H++ DI +++LY+LD                        ++     T D+ + ++        F++  ++N+++   +       S D      S  +   K   NK+ +   F + V        LE  +   L A +S  +  +++    G    +V+K G + LH+A    +  +V Y+I  A   L+ + D   GQTA+H AA
Sbjct:   99 RTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEE-CIKSGQRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQT----TTHHHWVHRKLEKGKCKQCGKFFPMKQAVQSKL-FGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPIIVPPSWIVKLPTKGNFKSSIRVSNKNNAASGSGGGGAGGGAGGGGGKSKKQTQRRQKGKEEKKEPRAFIVKPIPSPEV------IPVI--------------VFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMGLDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGGGYTDEPIGKILREIGMSQCVLMDRWRVKVTPN--------DDVT----DDHVDRSKP----NVPLNVINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTGKLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKP-SIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSK--------------RKHGRG---DVQVNPLEKMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVR-NMLNTKFEESISYPKVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILD-----------------------HEAATMPQTPDQERSFA-------AFSQRQAQNERRQMDQAQGRGPGSTDEDLQIGSKPIKVMKWKSNKD-RLFSFNEDVFGCGFSPILEQTSDAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELGQTALHIAA 950          
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Match: rdgA (gene:FBgn0261549 transcript:FBtr0333602)

HSP 1 Score: 417.542 bits (1072), Expect = 4.007e-123
Identity = 247/667 (37.03%), Postives = 362/667 (54.27%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLA--IFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCM----LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRS--LEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAA 3727
            VF+NPKSGGN G KL+ KFQ LLNPRQVFD+T  GP++GL++F K  N+R+L CGGDGTVGWV+S +D +   + P+P + +LPLGTGNDLARA  WG GYTDE + KI+  +   Q   +DRW +  TPN        D+++    D   ++S P      PLNV NNYFS G DA  ALEFHE+REA+PE+FNSRL+NK++Y  +GGKD++ R +++L  ++TL CDG DFT ++++   H +LFLNI  Y GGT PW +  G   P S +DG +EVVGLT   L  LQ G H   ICQC+ A + T +TIPMQVDGE CR+ PS I I     A ++ K              +K GR    D   +  + ++L +  + +  YE+   +K+ + + A     +      +L  VR N+L    +  +    + + + FIDS T++ +FRI + +E +H++ DI +++LY+LD               E   +  + D           Q  S  A         FS+ + Q       +E +  D +             + +K       P +VMK++S  LE  +   L A +S  +  +++    G    +V+K G + LH+A    +  +V Y+I  A   L+ + D   GQTA+H AA
Sbjct:  818 VFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMGLDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGGGYTDEPIGKILREIGMSQCVLMDRWRVKVTPN--------DDVT----DDHVDRSKP----NVPLNVINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTGKLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKP-SIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSK--------------RKHGRG---DVQVNPLEKMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVR-NMLNTKFEESISYPKVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILD--------------HEAATMPQTPD-----------QERSFAA---------FSQRQAQ-------NERRQMDQAQGRGPGSTDEDLQIGSK-------PIKVMKWKSPILEQTSDAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELGQTALHIAA 1401          

HSP 2 Score: 209.149 bits (531), Expect = 3.099e-54
Identity = 114/283 (40.28%), Postives = 159/283 (56.18%), Query Frame = 2
Query:  719 FLQVPEQKDANINSKPRSQSIDQIIDYLSLDKQNLSVE------FLMTSN-NKPRAVSIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ----LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSF------QSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKS 1516
            +L VP+ K      + R+ S+D     LS + +   ++      FL   N N  R+ S+D  +P   +   K+L +T    T    R  +A  ++ P + VP+W+ +A    H W  T++SGD C LNE  C K G + KCS+C+L+ H  CIP +     L C+PT+R+ G+R YR++     T  HHWVHRK + GKCKQCGK F      QSK    SKEIVA+ C+WC   YHNK  CF  + + EEC  G +   I+PPSWI+K+ TK NFKSS+R S
Sbjct:  488 YLMVPDLK------RDRAASVDSCFSKLSSNAKTEELQPSADGCFLTVPNINATRSRSVDIVLPTDEQARYKALSMTGSTVTYADGRTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEE-CIKSGQRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQT----TTHHHWVHRKLEKGKCKQCGKFFPMKQAVQSKL-FGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPIIVPPSWIVKLPTKGNFKSSIRVS 758          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkzb (diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB-GENE-111104-4])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 396/1046 (37.86%), Postives = 582/1046 (55.64%), Query Frame = 2
Query:  983 SPQKSVPN--------WSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHL---QLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKN-NFKSSVRKSRSPDTMTRSALPQDS---NFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILK-------MTSDTCMLDK---SFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL------------PSNLSPIEGRI--SEKGDIYS--------SADSIYNEATADRVQPYSLNAPPD-NVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHL-----------VNQKHLDNK-ETKEIVFPDQVMKYRSLEVLNAK--------FLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIEND 3886
            +P KS PN        W+ +AQ   H+W +T+ +GDFCY+ E+ C     +K   + KC++CK+ +H  C+  L      C+PTF++ G ++ R+       + HHWVHR+RQDGKC+QCGK FQ KF+ +SK+IVA+ CSWCK  YHNK  CF    + E CS G H   IIPP+WII+M  +  + KSS R+ R+      S   +D    NF+ + A P               S+H+                  P +              VF+NPKSGGN G K++R F W LNPRQVFD+T  GPR GLE++ K+ N+RILVCGGDGTVGW++S +D L + P P +A+LPLGTGNDLAR  +WG GYTDE +SKI+S VE+G I  LDRWNL+   N          L   ++D   +Q++     K P++VFNNYFSLG DA   LEFHESREA PE+FNSRL+NK+FYAG    D L  S KDL  +I +VCDG D T +I++MK   LLFLNI RY  GT PWGNP+    FGPQ  +DG +EV+G T  S+ATLQVGGH +R+ QC+   +TT K IP+QVDGEPCRL PS I I+    A ++ K KRR S+P L +              Q   + +++ V  I + DYE    +K+++ EAA    ++T  G+S+L   R +I +       M +DT  + K    + F+D  T+DRF+RI + +E ++++ +I  ++L++LDP+L            P  +  + G    S   D ++        S     NE  A+  QP S++   D +V ++  S     + + ++ H     ++ S ES +H+           + ++   NK  ++     +  +  + L+ +  K          +A KS ++  ++    +GAD    D  G + LH AV+ G+  +V ++  +AP  +L++ +  +G+TA+HKAAA+ H++IC  L+ AGASL+  D    TP   ++ T D +L ++L+ ++    I+ D
Sbjct:   86 TPAKSEPNKKICNTVDWTENAQLGQHVWFETSPAGDFCYVGESNCIAKSQQKSLPRHKCAACKISVHTECMNQLDKINFRCKPTFKDPGTKNVRETP----NMNHHWVHRRRQDGKCRQCGKGFQQKFSFHSKDIVAISCSWCKQAYHNKVNCFMMQRIDEPCSLGAHAAVIIPPTWIIRMRRQQASLKSSKRRKRTSLKAKPSKKLEDGKWRNFVVR-AIP---------------SQHMK-----------------PLL--------------VFVNPKSGGNQGTKIIRTFMWYLNPRQVFDLTQGGPREGLEMYSKVPNLRILVCGGDGTVGWILSVLDELQLNPQPAVAVLPLGTGNDLARTLNWGGGYTDEPVSKILSHVEDGIIVQLDRWNLSVEAN----------LEASDEDKDEQQTD-----KLPIDVFNNYFSLGFDAHVTLEFHESREAKPERFNSRLRNKMFYAGTAFSDFLMGSSKDLSKHIKVVCDGTDLTSKIQDMKVLCLLFLNIPRYCAGTMPWGNPSENNDFGPQKHDDGLIEVIGFTMTSMATLQVGGHGERLHQCKEVTLTTFKPIPVQVDGEPCRLAPSVIHITRRNQANMLQKTKRRISLPQLYD-------------QQPIAETVQIQVNRISMHDYEALHYDKEQLKEAAIPMGIITVPGNSDLETCRQHIERLHEEGDGMNTDTLHMPKLSPKWCFLDCTTADRFYRIDRGQEHLNYVSEISQDELFILDPELVTKETVGTSPGMPGAMETVVGGCGCSNSTDQFAFPACSPGPSPLCRVNETHAES-QPESVSEEIDMHVQSDPESPTNLGVYRVHDTHAESQLESLSPESDSHVQSDPGSPTKSGLYRRGAKNKISSRSNTLEEDSVNVQRLDTVWNKSDQDSTNLLFDAVKSGNLEKLEQMHEEGADLSVQDHLGCTILHQAVILGHKEIVKFITENAPACILDVTEKSTGETALHKAAALCHRTICCYLVDAGASLMKTDLQGETPKMYAERTRDYELAEYLENQQHHQMIQRD 1051          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: DGKI (diacylglycerol kinase, iota [Source:NCBI gene;Acc:100331649])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 308/695 (44.32%), Postives = 414/695 (59.57%), Query Frame = 2
Query:  974 INQSPQKSVPN---WSIDAQNKTHLWVDTNSSGDFCYLNENVC----EKGGAKRKCSSCKLIIHQLCIPHL---QLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKM 3019
            ++  P K + N   WS +A N  HLW++TN SG+ CYL E  C     K   +RKC++CK+++H  CI  L      C+PTFRE   R  RD     + LRHHWVHR+RQ+GKC+QCGKSF  KF  +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PPSWIIK+   +++FK+S R+ +      R++         +P     + SP              ++K +                            LVF+NPKSGGN G KL++ F W+LNPRQVFD++  GPR  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+A+LPLGTGNDLAR  +WG GYTDE +SK++  VE+G +  LDRWNL     Q  R++      +Q+++GT          K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D T +I+E+K   ++FLNI RY  GT PWGN      F PQ  +DG +EV+G T ASLA LQVGGH DR+ QC+  ++TT KT+P+QVDGEPCRL PS + IS    A ++ K KRR+S+PLL++                  + L+L V  I L DY+    +K+++ + +    ++   G  +L   R  I ++
Sbjct:   92 LSNGPAKELRNTVDWSENAVNGDHLWLETNCSGELCYLGEETCVAKIAKSAPRRKCAACKIVVHTACIEELDKINFRCKPTFREGSSRCLRD-----NVLRHHWVHRRRQEGKCRQCGKSFPQKF-FHSKEIVAISCSWCKQAFHNKVTCFMLHQIEEPCSLGAHAGVIVPPSWIIKVRKPQSSFKNSTRRKKRTSFKRRASKKGTDESKWRPFMLKPLPSP--------------LMKPV----------------------------LVFVNPKSGGNQGTKLLQMFMWILNPRQVFDLSQGGPRDALELYRKVPNLRILACGGDGTVGWILSALDELQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKVLCHVEDGSVVQLDRWNL-----QVERSV------VQHEEGT---------QKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVRVVCDGTDLTAKIQELKFQCIVFLNIPRYCAGTMPWGNTGDHRDFEPQRHDDGCIEVIGFTMASLAALQVGGHGDRLHQCREVLITTFKTLPVQVDGEPCRLAPSTLRISLRNQANMVQKSKRRTSVPLLND-------------PHAVPERLRLRVNRIGLQDYDSMQFDKERLRDISTAVGIVVVRGDCDLETCRLYIDRL 705          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkza (diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB-GENE-111104-3])

HSP 1 Score: 493.426 bits (1269), Expect = 2.484e-154
Identity = 294/751 (39.15%), Postives = 421/751 (56.06%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD----------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENK--SNDASSAESSAH----------LVNQKHLDNKETKEIVFPDQVMKYRSLEVLNA------KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN G K+++ F W LNPRQVFD++  GP+ GLE++ K+ N+RIL CGGDGTVGW++S +D L + PSP +A+LPLGTGNDLAR  +WG GYTDE LSKI+S VE+G I  LDRWNL   P               N +   E+ +     K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG D T +++++K   L+FLNI RY  GT PWGNP+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+   +TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+SIPLL++              Q   + L++ V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++  +          +  L   + F+DS T+DRF+RI + +E ++++ +I  ++L+VLDP+L               +  S++  + +   +  VQ    + P    F    S             + K  S+D+S AE+ AH          L     +    T    F     ++    V NA        +E  K      ++     GAD    D  G + LHYAV  G+  +V Y+I++AP ++L++ +  +G+T +HKAA++ H++IC  L+ AGASL+  D    TP    +   D +L  +L+  +    I+ + ++  +
Sbjct:  333 VFVNPKSGGNQGAKIIQTFLWYLNPRQVFDLSQGGPQEGLEMYRKVHNLRILACGGDGTVGWILSALDQLQLNPSPAVAVLPLGTGNDLARTLNWGGGYTDEPLSKILSHVEDGNIVQLDRWNLVVKP---------------NPEAGPEERDEQVTDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIKVVCDGTDLTSKVQDLKLQCLVFLNIPRYCAGTMPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLNQCREVTLTTFKSIPMQVDGEPCKLAPSVIHISLRNQANMVQKTKRRTSIPLLND-------------QQPFPERLRIRVSRISMHDYEALHYDKEKLKEASIPLGLIVVPGDSDLETCRAHIERLQEEGDGSKSKALSSQRLSPKWCFLDSTTADRFYRIDRAQEHLNYVTEISQDELFVLDPELVVT------------ETVSTSPGMPDLVDSGEVQ----SDPHKFAFPSSSSSPPNTPGPRVAELQRKRVSSDSSVAEALAHSDSLRSAKPALCRAGGVHRSNTTAADF-KPTSRFEKSAVNNANSVSVDSLIECVKKKDHQKLKELHKKGADLCVQDPAGRTLLHYAVEVGSKEIVKYIIDNAPTDILDVTEKENGETVLHKAASLCHRTICHYLVEAGASLMKTDLQGDTPKHRAEKAKDAELAAYLENRQHYQMIQREDQETAV 1038          

HSP 2 Score: 183.726 bits (465), Expect = 1.414e-46
Identity = 83/190 (43.68%), Postives = 113/190 (59.47%), Query Frame = 2
Query: 1004 NWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ----------------LP-----------CRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            +WS  A    H+W +TN SGDFCY+ E  C     +K  A++KC++CK+++H +CI  L+                +P           C+P+FRE+G R+ R+       +RHHWVHR+RQ+GKCKQCGK FQ KF  +SKEIVA+ CSWCK  YHNK  CF    + E CS G H   I+PP+WII++
Sbjct:   98 DWSESAVYGEHIWFETNVSGDFCYVGEQHCYAKSLQKSVARKKCAACKIVVHSICIEQLEKLLDWNAPPQGEGLDEMPLKEPSFRINFRCKPSFRESGSRNIREPA----IVRHHWVHRRRQEGKCKQCGKGFQQKFAFHSKEIVAISCSWCKQAYHNKVTCFMLQQIEEPCSLGAHAAVIVPPTWIIRV 283          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkza (diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB-GENE-111104-3])

HSP 1 Score: 489.96 bits (1260), Expect = 3.146e-153
Identity = 296/766 (38.64%), Postives = 422/766 (55.09%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD--TC-----------------------MLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENK--SNDASSAESSAH----------LVNQKHLDNKETKEIVFPDQVMKYRSLEVLNA------KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN G K+++ F W LNPRQVFD++  GP+ GLE++ K+ N+RIL CGGDGTVGW++S +D L + PSP +A+LPLGTGNDLAR  +WG GYTDE LSKI+S VE+G I  LDRWNL   P               N +   E+ +     K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG D T +++++K   L+FLNI RY  GT PWGNP+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+   +TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+SIPLL++              Q   + L++ V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++  D  +C                        L   + F+DS T+DRF+RI + +E ++++ +I  ++L+VLDP+L               +  S++  + +   +  VQ    + P    F    S             + K  S+D+S AE+ AH          L     +    T    F     ++    V NA        +E  K      ++     GAD    D  G + LHYAV  G+  +V Y+I++AP ++L++ +  +G+T +HKAA++ H++IC  L+ AGASL+  D    TP    +   D +L  +L+  +    I+ + ++  +
Sbjct:  307 VFVNPKSGGNQGAKIIQTFLWYLNPRQVFDLSQGGPQEGLEMYRKVHNLRILACGGDGTVGWILSALDQLQLNPSPAVAVLPLGTGNDLARTLNWGGGYTDEPLSKILSHVEDGNIVQLDRWNLVVKP---------------NPEAGPEERDEQVTDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIKVVCDGTDLTSKVQDLKLQCLVFLNIPRYCAGTMPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLNQCREVTLTTFKSIPMQVDGEPCKLAPSVIHISLRNQANMVQKTKRRTSIPLLND-------------QQPFPERLRIRVSRISMHDYEALHYDKEKLKEASIPLGLIVVPGDSDLETCRAHIERLQEDFVSCNPSLQRLVLQEGDGSKSKALSSQRLSPKWCFLDSTTADRFYRIDRAQEHLNYVTEISQDELFVLDPELVVT------------ETVSTSPGMPDLVDSGEVQ----SDPHKFAFPSSSSSPPNTPGPRVAELQRKRVSSDSSVAEALAHSDSLRSAKPALCRAGGVHRSNTTAADF-KPTSRFEKSAVNNANSVSVDSLIECVKKKDHQKLKELHKKGADLCVQDPAGRTLLHYAVEVGSKEIVKYIIDNAPTDILDVTEKENGETVLHKAASLCHRTICHYLVEAGASLMKTDLQGDTPKHRAEKAKDAELAAYLENRQHYQMIQREDQETAV 1027          

HSP 2 Score: 192.971 bits (489), Expect = 1.778e-49
Identity = 82/166 (49.40%), Postives = 111/166 (66.87%), Query Frame = 2
Query: 1004 NWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            +WS  A    H+W +TN SGDFCY+ E  C     +K  A++KC++CK+++H +CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQ+GKCKQCGK FQ KF  +SKEIVA+ CSWCK  YHNK  CF    + E CS G H   I+PP+WII++
Sbjct:   96 DWSESAVYGEHIWFETNVSGDFCYVGEQHCYAKSLQKSVARKKCAACKIVVHSICIEQLEKINFRCKPSFRESGSRNIREPA----IVRHHWVHRRRQEGKCKQCGKGFQQKFAFHSKEIVAISCSWCKQAYHNKVTCFMLQQIEEPCSLGAHAAVIVPPTWIIRV 257          
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Match: dgkza (diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB-GENE-111104-3])

HSP 1 Score: 489.96 bits (1260), Expect = 6.759e-153
Identity = 296/766 (38.64%), Postives = 422/766 (55.09%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD--TC-----------------------MLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENK--SNDASSAESSAH----------LVNQKHLDNKETKEIVFPDQVMKYRSLEVLNA------KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN G K+++ F W LNPRQVFD++  GP+ GLE++ K+ N+RIL CGGDGTVGW++S +D L + PSP +A+LPLGTGNDLAR  +WG GYTDE LSKI+S VE+G I  LDRWNL   P               N +   E+ +     K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG D T +++++K   L+FLNI RY  GT PWGNP+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+   +TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+SIPLL++              Q   + L++ V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++  D  +C                        L   + F+DS T+DRF+RI + +E ++++ +I  ++L+VLDP+L               +  S++  + +   +  VQ    + P    F    S             + K  S+D+S AE+ AH          L     +    T    F     ++    V NA        +E  K      ++     GAD    D  G + LHYAV  G+  +V Y+I++AP ++L++ +  +G+T +HKAA++ H++IC  L+ AGASL+  D    TP    +   D +L  +L+  +    I+ + ++  +
Sbjct:  331 VFVNPKSGGNQGAKIIQTFLWYLNPRQVFDLSQGGPQEGLEMYRKVHNLRILACGGDGTVGWILSALDQLQLNPSPAVAVLPLGTGNDLARTLNWGGGYTDEPLSKILSHVEDGNIVQLDRWNLVVKP---------------NPEAGPEERDEQVTDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIKVVCDGTDLTSKVQDLKLQCLVFLNIPRYCAGTMPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLNQCREVTLTTFKSIPMQVDGEPCKLAPSVIHISLRNQANMVQKTKRRTSIPLLND-------------QQPFPERLRIRVSRISMHDYEALHYDKEKLKEASIPLGLIVVPGDSDLETCRAHIERLQEDFVSCNPSLQRLVLQEGDGSKSKALSSQRLSPKWCFLDSTTADRFYRIDRAQEHLNYVTEISQDELFVLDPELVVT------------ETVSTSPGMPDLVDSGEVQ----SDPHKFAFPSSSSSPPNTPGPRVAELQRKRVSSDSSVAEALAHSDSLRSAKPALCRAGGVHRSNTTAADF-KPTSRFEKSAVNNANSVSVDSLIECVKKKDHQKLKELHKKGADLCVQDPAGRTLLHYAVEVGSKEIVKYIIDNAPTDILDVTEKENGETVLHKAASLCHRTICHYLVEAGASLMKTDLQGDTPKHRAEKAKDAELAAYLENRQHYQMIQREDQETAV 1051          

HSP 2 Score: 183.726 bits (465), Expect = 1.437e-46
Identity = 83/190 (43.68%), Postives = 113/190 (59.47%), Query Frame = 2
Query: 1004 NWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ----------------LP-----------CRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            +WS  A    H+W +TN SGDFCY+ E  C     +K  A++KC++CK+++H +CI  L+                +P           C+P+FRE+G R+ R+       +RHHWVHR+RQ+GKCKQCGK FQ KF  +SKEIVA+ CSWCK  YHNK  CF    + E CS G H   I+PP+WII++
Sbjct:   96 DWSESAVYGEHIWFETNVSGDFCYVGEQHCYAKSLQKSVARKKCAACKIVVHSICIEQLEKLLDWNAPPQGEGLDEMPLKEPSFRINFRCKPSFRESGSRNIREPA----IVRHHWVHRRRQEGKCKQCGKGFQQKFAFHSKEIVAISCSWCKQAYHNKVTCFMLQQIEEPCSLGAHAAVIVPPTWIIRV 281          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKZ (diacylglycerol kinase, zeta [Source:NCBI gene;Acc:100496839])

HSP 1 Score: 496.893 bits (1278), Expect = 1.324e-155
Identity = 292/733 (39.84%), Postives = 418/733 (57.03%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKM----------TSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN GVK+++ F W LNPRQVFD++  GP+  LE++ K+ ++RIL CGGDGTVGW++S +D L +FP PP+AILPLGTGNDLAR  +WG GYTDE LSKI+S VEEG +  LDRWNL    N  P     D+      DG        A  K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D    S +DL  +I +VCDG+D T +I+++K   L+FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+S+PLL++              Q     L+L V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++          T  +  L   + F+DS T+DRF+RI + +E ++F+++IC ++LYVLDP+L    S              ++ ++ +  T+D+       A P+N   +            + +   +S  AS              D   TK +   +++ +  S    N   LEA K+  +   +     G      D +G + LH+AV +G+  +V Y+I  AP  +L++ +   G+T +H AA+   ++IC  ++ AGASL+  D    TP   ++   DL+L  +L+  +    I+ + ++  +
Sbjct:  363 VFVNPKSGGNQGVKILQSFMWYLNPRQVFDLSQGGPKEALEMYRKVPSLRILACGGDGTVGWILSALDQLRLFPPPPVAILPLGTGNDLARTLNWGGGYTDEPLSKILSHVEEGIVVQLDRWNLVVERN--PEAWEDDK-----GDG--------ATDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAVSDFFTGSSRDLAKHIRVVCDGVDLTAKIQDLKLQCLVFLNIPRYCAGTMPWGNPGEHHDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVLLTTSKSIPMQVDGEPCKLGPSVIKISLRNQANLVQKTKRRTSVPLLND-------------QQPVPDRLRLRVNRISMHDYEALHYDKEKLREASLPLGVIVVPGDSDLETCRTHIERLQEEDGTARPQTVSSQKLSPKWCFLDSTTADRFYRIDRAQEHLNFVLEICQDELYVLDPELIITQS------------VGTSPALLD--TSDKA------ASPNNRLFQFPPPPISPPLTGSPDGSQRSRSAS--------------DTFLTKPVCSHNRMEEGFSESQSNEILLEASKNGDLERFREAHRAGGTLTLRDAQGCTLLHHAVTSGSKEIVKYIIEHAPAEILDVAELKRGETCLHLAASFRQRTICHYIVEAGASLMKTDLQGDTPKNKAEKAKDLELAAYLENRQHYQMIQREDQETAV 1033          

HSP 2 Score: 186.422 bits (472), Expect = 2.589e-47
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 2
Query:  911 KSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC---EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            K++  +  Q  + T  V  +E +   + +V +W+  A    HLW +TN SGDFCYL E  C   +K  ++RKC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQ GKC+QCGK FQ KF  +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   I+PP+WII++
Sbjct:  124 KAIAKSGAQHLVATPSVLPSEPDTQVRNTV-DWTDAAVYGDHLWFETNVSGDFCYLGEQNCTSKQKSASRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNIREPV----IVRHHWVHRRRQAGKCRQCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMFHHIEEPCSLGVHAAVIVPPTWIIRV 313          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKZ (diacylglycerol kinase, zeta [Source:NCBI gene;Acc:100496839])

HSP 1 Score: 497.664 bits (1280), Expect = 3.525e-155
Identity = 292/733 (39.84%), Postives = 418/733 (57.03%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKM----------TSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN GVK+++ F W LNPRQVFD++  GP+  LE++ K+ ++RIL CGGDGTVGW++S +D L +FP PP+AILPLGTGNDLAR  +WG GYTDE LSKI+S VEEG +  LDRWNL    N  P     D+      DG        A  K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D    S +DL  +I +VCDG+D T +I+++K   L+FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+S+PLL++              Q     L+L V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++          T  +  L   + F+DS T+DRF+RI + +E ++F+++IC ++LYVLDP+L    S              ++ ++ +  T+D+       A P+N   +            + +   +S  AS              D   TK +   +++ +  S    N   LEA K+  +   +     G      D +G + LH+AV +G+  +V Y+I  AP  +L++ +   G+T +H AA+   ++IC  ++ AGASL+  D    TP   ++   DL+L  +L+  +    I+ + ++  +
Sbjct:  420 VFVNPKSGGNQGVKILQSFMWYLNPRQVFDLSQGGPKEALEMYRKVPSLRILACGGDGTVGWILSALDQLRLFPPPPVAILPLGTGNDLARTLNWGGGYTDEPLSKILSHVEEGIVVQLDRWNLVVERN--PEAWEDDK-----GDG--------ATDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAVSDFFTGSSRDLAKHIRVVCDGVDLTAKIQDLKLQCLVFLNIPRYCAGTMPWGNPGEHHDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVLLTTSKSIPMQVDGEPCKLGPSVIKISLRNQANLVQKTKRRTSVPLLND-------------QQPVPDRLRLRVNRISMHDYEALHYDKEKLREASLPLGVIVVPGDSDLETCRTHIERLQEEDGTARPQTVSSQKLSPKWCFLDSTTADRFYRIDRAQEHLNFVLEICQDELYVLDPELIITQS------------VGTSPALLD--TSDKA------ASPNNRLFQFPPPPISPPLTGSPDGSQRSRSAS--------------DTFLTKPVCSHNRMEEGFSESQSNEILLEASKNGDLERFREAHRAGGTLTLRDAQGCTLLHHAVTSGSKEIVKYIIEHAPAEILDVAELKRGETCLHLAASFRQRTICHYIVEAGASLMKTDLQGDTPKNKAEKAKDLELAAYLENRQHYQMIQREDQETAV 1090          

HSP 2 Score: 187.193 bits (474), Expect = 1.827e-47
Identity = 87/195 (44.62%), Postives = 123/195 (63.08%), Query Frame = 2
Query:  911 KSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC---EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            K++  +  Q  + T  V  +E +   + +V +W+  A    HLW +TN SGDFCYL E  C   +K  ++RKC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQ GKC+QCGK FQ KF  +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   I+PP+WII++
Sbjct:  181 KAIAKSGAQHLVATPSVLPSEPDTQVRNTV-DWTDAAVYGDHLWFETNVSGDFCYLGEQNCTSKQKSASRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNIREPV----IVRHHWVHRRRQAGKCRQCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMFHHIEEPCSLGVHAAVIVPPTWIIRV 370          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKZ (diacylglycerol kinase, zeta [Source:NCBI gene;Acc:100496839])

HSP 1 Score: 491.5 bits (1264), Expect = 1.392e-154
Identity = 292/748 (39.04%), Postives = 418/748 (55.88%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN GVK+++ F W LNPRQVFD++  GP+  LE++ K+ ++RIL CGGDGTVGW++S +D L +FP PP+AILPLGTGNDLAR  +WG GYTDE LSKI+S VEEG +  LDRWNL    N  P     D+      DG        A  K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D    S +DL  +I +VCDG+D T +I+++K   L+FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+S+PLL++              Q     L+L V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++  D                         +  L   + F+DS T+DRF+RI + +E ++F+++IC ++LYVLDP+L    S              ++ ++ +  T+D+       A P+N   +            + +   +S  AS              D   TK +   +++ +  S    N   LEA K+  +   +     G      D +G + LH+AV +G+  +V Y+I  AP  +L++ +   G+T +H AA+   ++IC  ++ AGASL+  D    TP   ++   DL+L  +L+  +    I+ + ++  +
Sbjct:  259 VFVNPKSGGNQGVKILQSFMWYLNPRQVFDLSQGGPKEALEMYRKVPSLRILACGGDGTVGWILSALDQLRLFPPPPVAILPLGTGNDLARTLNWGGGYTDEPLSKILSHVEEGIVVQLDRWNLVVERN--PEAWEDDK-----GDG--------ATDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAVSDFFTGSSRDLAKHIRVVCDGVDLTAKIQDLKLQCLVFLNIPRYCAGTMPWGNPGEHHDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVLLTTSKSIPMQVDGEPCKLGPSVIKISLRNQANLVQKTKRRTSVPLLND-------------QQPVPDRLRLRVNRISMHDYEALHYDKEKLREASLPLGVIVVPGDSDLETCRTHIERLQEDFPAYPTILQRLDLKEDGTARPQTVSSQKLSPKWCFLDSTTADRFYRIDRAQEHLNFVLEICQDELYVLDPELIITQS------------VGTSPALLD--TSDKA------ASPNNRLFQFPPPPISPPLTGSPDGSQRSRSAS--------------DTFLTKPVCSHNRMEEGFSESQSNEILLEASKNGDLERFREAHRAGGTLTLRDAQGCTLLHHAVTSGSKEIVKYIIEHAPAEILDVAELKRGETCLHLAASFRQRTICHYIVEAGASLMKTDLQGDTPKNKAEKAKDLELAAYLENRQHYQMIQREDQETAV 944          

HSP 2 Score: 187.193 bits (474), Expect = 1.187e-47
Identity = 87/198 (43.94%), Postives = 125/198 (63.13%), Query Frame = 2
Query:  902 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC---EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            ++ K++  +  Q  + T  V  +E +   + +V +W+  A    HLW +TN SGDFCYL E  C   +K  ++RKC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQ GKC+QCGK FQ KF  +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   I+PP+WII++
Sbjct:   17 ETRKAIAKSGAQHLVATPSVLPSEPDTQVRNTV-DWTDAAVYGDHLWFETNVSGDFCYLGEQNCTSKQKSASRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNIREPV----IVRHHWVHRRRQAGKCRQCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMFHHIEEPCSLGVHAAVIVPPTWIIRV 209          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKZ (diacylglycerol kinase, zeta [Source:NCBI gene;Acc:100496839])

HSP 1 Score: 491.5 bits (1264), Expect = 3.136e-154
Identity = 292/748 (39.04%), Postives = 418/748 (55.88%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN GVK+++ F W LNPRQVFD++  GP+  LE++ K+ ++RIL CGGDGTVGW++S +D L +FP PP+AILPLGTGNDLAR  +WG GYTDE LSKI+S VEEG +  LDRWNL    N  P     D+      DG        A  K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D    S +DL  +I +VCDG+D T +I+++K   L+FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+S+PLL++              Q     L+L V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++  D                         +  L   + F+DS T+DRF+RI + +E ++F+++IC ++LYVLDP+L    S              ++ ++ +  T+D+       A P+N   +            + +   +S  AS              D   TK +   +++ +  S    N   LEA K+  +   +     G      D +G + LH+AV +G+  +V Y+I  AP  +L++ +   G+T +H AA+   ++IC  ++ AGASL+  D    TP   ++   DL+L  +L+  +    I+ + ++  +
Sbjct:  285 VFVNPKSGGNQGVKILQSFMWYLNPRQVFDLSQGGPKEALEMYRKVPSLRILACGGDGTVGWILSALDQLRLFPPPPVAILPLGTGNDLARTLNWGGGYTDEPLSKILSHVEEGIVVQLDRWNLVVERN--PEAWEDDK-----GDG--------ATDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAVSDFFTGSSRDLAKHIRVVCDGVDLTAKIQDLKLQCLVFLNIPRYCAGTMPWGNPGEHHDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVLLTTSKSIPMQVDGEPCKLGPSVIKISLRNQANLVQKTKRRTSVPLLND-------------QQPVPDRLRLRVNRISMHDYEALHYDKEKLREASLPLGVIVVPGDSDLETCRTHIERLQEDFPAYPTILQRLDLKEDGTARPQTVSSQKLSPKWCFLDSTTADRFYRIDRAQEHLNFVLEICQDELYVLDPELIITQS------------VGTSPALLD--TSDKA------ASPNNRLFQFPPPPISPPLTGSPDGSQRSRSAS--------------DTFLTKPVCSHNRMEEGFSESQSNEILLEASKNGDLERFREAHRAGGTLTLRDAQGCTLLHHAVTSGSKEIVKYIIEHAPAEILDVAELKRGETCLHLAASFRQRTICHYIVEAGASLMKTDLQGDTPKNKAEKAKDLELAAYLENRQHYQMIQREDQETAV 970          

HSP 2 Score: 189.119 bits (479), Expect = 2.886e-48
Identity = 91/202 (45.05%), Postives = 125/202 (61.88%), Query Frame = 2
Query:  890 FRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC---EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            FR RK+    G    Q  + T  V  +E +   + +V +W+  A    HLW +TN SGDFCYL E  C   +K  ++RKC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQ GKC+QCGK FQ KF  +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   I+PP+WII++
Sbjct:   42 FRRRKAIAKSGA---QHLVATPSVLPSEPDTQVRNTV-DWTDAAVYGDHLWFETNVSGDFCYLGEQNCTSKQKSASRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNIREPV----IVRHHWVHRRRQAGKCRQCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMFHHIEEPCSLGVHAAVIVPPTWIIRV 235          
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Match: DGKZ (diacylglycerol kinase, zeta [Source:NCBI gene;Acc:100496839])

HSP 1 Score: 490.73 bits (1262), Expect = 3.819e-154
Identity = 292/748 (39.04%), Postives = 418/748 (55.88%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            VF+NPKSGGN GVK+++ F W LNPRQVFD++  GP+  LE++ K+ ++RIL CGGDGTVGW++S +D L +FP PP+AILPLGTGNDLAR  +WG GYTDE LSKI+S VEEG +  LDRWNL    N  P     D+      DG        A  K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D    S +DL  +I +VCDG+D T +I+++K   L+FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+S+PLL++              Q     L+L V  I + DYE    +K+K+ EA+    ++   G S+L   R +I ++  D                         +  L   + F+DS T+DRF+RI + +E ++F+++IC ++LYVLDP+L    S              ++ ++ +  T+D+       A P+N   +            + +   +S  AS              D   TK +   +++ +  S    N   LEA K+  +   +     G      D +G + LH+AV +G+  +V Y+I  AP  +L++ +   G+T +H AA+   ++IC  ++ AGASL+  D    TP   ++   DL+L  +L+  +    I+ + ++  +
Sbjct:  266 VFVNPKSGGNQGVKILQSFMWYLNPRQVFDLSQGGPKEALEMYRKVPSLRILACGGDGTVGWILSALDQLRLFPPPPVAILPLGTGNDLARTLNWGGGYTDEPLSKILSHVEEGIVVQLDRWNLVVERN--PEAWEDDK-----GDG--------ATDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAVSDFFTGSSRDLAKHIRVVCDGVDLTAKIQDLKLQCLVFLNIPRYCAGTMPWGNPGEHHDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVLLTTSKSIPMQVDGEPCKLGPSVIKISLRNQANLVQKTKRRTSVPLLND-------------QQPVPDRLRLRVNRISMHDYEALHYDKEKLREASLPLGVIVVPGDSDLETCRTHIERLQEDFPAYPTILQRLDLKEDGTARPQTVSSQKLSPKWCFLDSTTADRFYRIDRAQEHLNFVLEICQDELYVLDPELIITQS------------VGTSPALLD--TSDKA------ASPNNRLFQFPPPPISPPLTGSPDGSQRSRSAS--------------DTFLTKPVCSHNRMEEGFSESQSNEILLEASKNGDLERFREAHRAGGTLTLRDAQGCTLLHHAVTSGSKEIVKYIIEHAPAEILDVAELKRGETCLHLAASFRQRTICHYIVEAGASLMKTDLQGDTPKNKAEKAKDLELAAYLENRQHYQMIQREDQETAV 951          

HSP 2 Score: 171.014 bits (432), Expect = 1.350e-42
Identity = 84/199 (42.21%), Postives = 113/199 (56.78%), Query Frame = 2
Query:  890 FRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC---EKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            FR RK+    G    Q  + T  V  +E +   + +V +W+  A    HLW +TN SGDFCYL E  C   +K  ++RKC++CK+++H  CI  L+ P                      +RHHWVHR+RQ GKC+QCGK FQ KF  +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   I+PP+WII++
Sbjct:   42 FRRRKAIAKSGA---QHLVATPSVLPSEPDTQVRNTV-DWTDAAVYGDHLWFETNVSGDFCYLGEQNCTSKQKSASRRKCAACKIVVHTPCIEQLEKPV--------------------IVRHHWVHRRRQAGKCRQCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMFHHIEEPCSLGVHAAVIVPPTWIIRV 216          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgki (diacylglycerol kinase, iota [Source:MGI Symbol;Acc:MGI:2443430])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 331/764 (43.32%), Postives = 448/764 (58.64%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++    Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G I  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+++K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++              Q     L++ V  I L DYE    +KDK+ EA+    ++   G  +L   R  I ++  D                            L   + F+D+ ++DRF+RI + +E +HF+M+I  +++++LDP +
Sbjct:  159 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGTEQETKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEMYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTIVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQDLKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLND-------------PQSVPDRLRIRVNKISLQDYEGLHYDKDKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDQETSFPRALSAQRLSPRWCFLDATSADRFYRIDRSQEHLHFVMEISHDEIFILDPDM 844          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgki (diacylglycerol kinase, iota [Source:MGI Symbol;Acc:MGI:2443430])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 331/772 (42.88%), Postives = 449/772 (58.16%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEE--------DFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++    Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G I  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+++K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++  +                   Q     L++ V  I L DYE    +KDK+ EA+    ++   G  +L   R  I ++  D                            L   + F+D+ ++DRF+RI + +E +HF+M+I  +++++LDP +
Sbjct:  159 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGTEQETKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEMYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTIVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQDLKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDIHQVQAADLRRVSAPPGSFTIPQSVPDRLRIRVNKISLQDYEGLHYDKDKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDQETSFPRALSAQRLSPRWCFLDATSADRFYRIDRSQEHLHFVMEISHDEIFILDPDM 865          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgki (diacylglycerol kinase, iota [Source:MGI Symbol;Acc:MGI:2443430])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 329/756 (43.52%), Postives = 443/756 (58.60%), Query Frame = 2
Query: 1016 DAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-------------------------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++    Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G I  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+++K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++              Q     L++ V  I L DYE    +KDK+ EA+    ++   G  +L   R  I ++  D                            L   + F+D+ ++DRF+RI + +E +HF+M+I  +++++LDP +
Sbjct:   16 NAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGTEQETKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEMYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTIVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQDLKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLND-------------PQSVPDRLRIRVNKISLQDYEGLHYDKDKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDQETSFPRALSAQRLSPRWCFLDATSADRFYRIDRSQEHLHFVMEISHDEIFILDPDM 693          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkz (diacylglycerol kinase zeta [Source:MGI Symbol;Acc:MGI:1278339])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 318/748 (42.51%), Postives = 441/748 (58.96%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSAL--PQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMT---------SDTC-MLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            +S  +WS  A    H+W +TN SGDFCY+ E  C      K   ++KC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQDGKC+ CGK FQ KFT +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   +IPP+WI++     N   + +K +      RS+   P++  + P    P    +PS L            +K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GPR  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE +SKI+S VEEG +  LDRW+L + P               N +   E+ +  A  + PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG+D TP+I+++KP  ++FLNI RY  GT PWG+P     F PQ  +DG LEV+G T  SLA LQVGGH +R+ QC+  ++TT K IP+QVDGEPC+L  S I I+    A ++ K KRRS+ PL S+              Q   + L++ V  + + DYE    +K+++ EA+     +   G S+L   R +I ++          S  C  L   + F+D+ T+ RF+RI + +E ++++ +I  +++Y+LDP+L
Sbjct:  101 QSTVDWSESAVYGEHIWFETNVSGDFCYVGEQHCVAKMLPKSAPRKKCAACKIVVHTQCIKQLEKINFRCKPSFRESGSRNVREPT----FVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMMQQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFIIRP----TPSPL------------MKPL----------------------------LVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLRAEP---------------NPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQVDGEPCKLSASRIRIALRNQATMVQKAKRRSTAPLHSD-------------QQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQREPDGAGAKSPMCHQLSSKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPEL 772          

HSP 2 Score: 53.1434 bits (126), Expect = 2.542e-6
Identity = 41/137 (29.93%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 3503 KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            + +EA K      +Q     G D +  D++  + LH+AV  G+  VV YL++ AP  +L+  +  +G+T +H+AAA+G ++IC  ++ AGASL+  D    TP Q  +   D +L  +L+  +    I+ + ++  +
Sbjct:  811 ELIEAAKRNDCCKLQELHRAGGDLMHRDQKSRTLLHHAVSTGSKEVVRYLLDHAPPEILDAVEE-NGETCLHQAAALGQRTICHYIVEAGASLMKTDLQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV 946          
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Match: Dgkz (diacylglycerol kinase zeta [Source:MGI Symbol;Acc:MGI:1278339])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 318/748 (42.51%), Postives = 441/748 (58.96%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSAL--PQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMT---------SDTC-MLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            +S  +WS  A    H+W +TN SGDFCY+ E  C      K   ++KC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQDGKC+ CGK FQ KFT +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   +IPP+WI++     N   + +K +      RS+   P++  + P    P    +PS L            +K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GPR  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE +SKI+S VEEG +  LDRW+L + P               N +   E+ +  A  + PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG+D TP+I+++KP  ++FLNI RY  GT PWG+P     F PQ  +DG LEV+G T  SLA LQVGGH +R+ QC+  ++TT K IP+QVDGEPC+L  S I I+    A ++ K KRRS+ PL S+              Q   + L++ V  + + DYE    +K+++ EA+     +   G S+L   R +I ++          S  C  L   + F+D+ T+ RF+RI + +E ++++ +I  +++Y+LDP+L
Sbjct:   84 QSTVDWSESAVYGEHIWFETNVSGDFCYVGEQHCVAKMLPKSAPRKKCAACKIVVHTQCIKQLEKINFRCKPSFRESGSRNVREPT----FVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMMQQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFIIRP----TPSPL------------MKPL----------------------------LVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLRAEP---------------NPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQVDGEPCKLSASRIRIALRNQATMVQKAKRRSTAPLHSD-------------QQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQREPDGAGAKSPMCHQLSSKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPEL 755          

HSP 2 Score: 53.5286 bits (127), Expect = 2.171e-6
Identity = 41/137 (29.93%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 3503 KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            + +EA K      +Q     G D +  D++  + LH+AV  G+  VV YL++ AP  +L+  +  +G+T +H+AAA+G ++IC  ++ AGASL+  D    TP Q  +   D +L  +L+  +    I+ + ++  +
Sbjct:  794 ELIEAAKRNDCCKLQELHRAGGDLMHRDQKSRTLLHHAVSTGSKEVVRYLLDHAPPEILDAVEE-NGETCLHQAAALGQRTICHYIVEAGASLMKTDLQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV 929          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|O08560|DGKZ_RAT (Diacylglycerol kinase zeta OS=Rattus norvegicus OX=10116 GN=Dgkz PE=1 SV=1)

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 319/748 (42.65%), Postives = 441/748 (58.96%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSAL--PQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMT---------SDTCM-LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            +S  +WS  A    H+W +TN SGDFCY+ E  C      K   +RKC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQDGKC+ CGK FQ KFT +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   +IPP+WI++     N   + +K +      RS+   P++  + P    P    +PS L            +K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GPR  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE +SKI+S VEEG +  LDRW+L + P               N +   E+ +  A  + PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG+D TP+I+++KP  ++FLNI RY  GT PWG+P     F PQ  +DG LEV+G T  SLA LQVGGH +R+ QC+  ++TT K IP+QVDGEPC+L  S I I+    A ++ K KRRS+ PL S+              Q   + L++ V  + + DYE    +K+++ EA+     +   G S+L   R +I ++          S  C  L   + F+D+ T+ RF+RI + +E ++++ +I  +++Y+LDP+L
Sbjct:   84 RSTVDWSESAAYGEHIWFETNVSGDFCYVGEQYCVAKMLPKSAPRRKCAACKIVVHTPCIGQLEKINFRCKPSFRESGSRNVREPT----FVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFIIRP----TPSPL------------MKPL----------------------------LVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLRAEP---------------NPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSTAPLHSD-------------QQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPMCHPLSSKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPEL 755          

HSP 2 Score: 54.6842 bits (130), Expect = 7.325e-6
Identity = 41/137 (29.93%), Postives = 74/137 (54.01%), Query Frame = 2
Query: 3503 KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            + +EA K      +Q     G D +  D +  + LH+AV  G+  VV YL++ AP  +L+  +  +G+T +H+AAA+G ++IC  ++ AGASL+  D    TP Q  +   D +L  +L+  +    I+ + ++  +
Sbjct:  794 ELIEAAKRNDFCKLQELHRAGGDLMHRDHQSRTLLHHAVSTGSKEVVRYLLDHAPPEILDAVEE-NGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV 929          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q80UP3|DGKZ_MOUSE (Diacylglycerol kinase zeta OS=Mus musculus OX=10090 GN=Dgkz PE=1 SV=2)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 318/748 (42.51%), Postives = 441/748 (58.96%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSAL--PQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMT---------SDTC-MLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            +S  +WS  A    H+W +TN SGDFCY+ E  C      K   ++KC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQDGKC+ CGK FQ KFT +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   +IPP+WI++     N   + +K +      RS+   P++  + P    P    +PS L            +K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GPR  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE +SKI+S VEEG +  LDRW+L + P               N +   E+ +  A  + PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG+D TP+I+++KP  ++FLNI RY  GT PWG+P     F PQ  +DG LEV+G T  SLA LQVGGH +R+ QC+  ++TT K IP+QVDGEPC+L  S I I+    A ++ K KRRS+ PL S+              Q   + L++ V  + + DYE    +K+++ EA+     +   G S+L   R +I ++          S  C  L   + F+D+ T+ RF+RI + +E ++++ +I  +++Y+LDP+L
Sbjct:   84 QSTVDWSESAVYGEHIWFETNVSGDFCYVGEQHCVAKMLPKSAPRKKCAACKIVVHTQCIKQLEKINFRCKPSFRESGSRNVREPT----FVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMMQQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRRSSKKGPEEGRWRPFIIRP----TPSPL------------MKPL----------------------------LVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPREALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLRAEP---------------NPEAGPEERDDGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQVDGEPCKLSASRIRIALRNQATMVQKAKRRSTAPLHSD-------------QQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQREPDGAGAKSPMCHQLSSKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPEL 755          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|O75912|DGKI_HUMAN (Diacylglycerol kinase iota OS=Homo sapiens OX=9606 GN=DGKI PE=1 SV=1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 332/773 (42.95%), Postives = 447/773 (57.83%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPD---TMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGS--SNLSAVRDNILKMTSDTCMLDKSFTFID---------SATSDRF-----------------------FRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            ++  +WS +A N  HLW++TN SGD CYL E  C+    K   +RKC+ CK+++H  CI  L+     C+PTFRE G R  R     E+ +RHHWVHR+RQ+GKCKQCGK FQ KF+ +SKEIVA+ CSWCK  +HNK  CF    + E CS G H   I+PP+WIIK+   +N+ K+S RK +        ++  + Q++   P    P  ISSP              ++K +                            LVF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+ +LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G +  LDRWNL    N     +  +EL    +DG         V K PLNVFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGNP     F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++ T K+IPMQVDGEPCRL P+ I IS    A ++ K KRR+S+PLL++              Q     L++ V  I L DYE    +K+K+ EA+    + T +G    +  A+   IL +  D C L+    +ID         S+ S R                        F   + +E +HF+M+I  +++++LDP +
Sbjct:  164 RATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPR-----ENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKP--ISSP--------------LMKPL----------------------------LVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNP---DLPPEEL----EDG---------VCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLND-------------PQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGD-CDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILDPDM 857          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q10024|DGK5_CAEEL (Putative diacylglycerol kinase K06A1.6 OS=Caenorhabditis elegans OX=6239 GN=dgk-5 PE=3 SV=2)

HSP 1 Score: 495.352 bits (1274), Expect = 2.877e-155
Identity = 285/737 (38.67%), Postives = 398/737 (54.00%), Query Frame = 2
Query: 1034 HLWVDTN-----SSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLC---IPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKE---IVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITD-RGPRLGLELFGKIAN-VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCV-EEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFN-QDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCML----DKSFTFID--SATSDRFFRIAKDKESVHFLMDICLED--LYVLDPKLPS 3175
            H+W+ ++     S+   CY+ E  C + G KR+C++C ++ H  C   +  L L C+ TFR+   +    ++  +    HHWVH+ R +G+C  C KSFQ K     KE    +AV CSWCK  YH K  CFA   L E C+RG   + I+PP+WI+++A +       R SR+P +  R        F+ KP +  + S PS+                             P +              VF+NPKSGGN G K +    WLLNPRQVFDIT  +GP+ GLE+F K+   +RILVCGGDGTVGWV+S +D+L     PP+AI+PLGTGNDLAR   WG  ++DE +S+++  +  E  +  LDRW +   PN       +D+  MQ              S  PL V  NYFS+GADA  AL+FH SR ANP+  NSRLKN+I Y G+G  D+ KRSWKDLC+YITL CDG+D TPRIKE+K H +LF NI  Y+GGT PWG  +      S  DGK+EV+G T A+LA LQ+GG  +RI QC    V T K IPMQVDGEPC L PS I++  H    ++   KR    P      ++  R  ++D   Q    +++L V V+   DY+      +++ + A    ++     + L + R  I ++  +   L    DK++ F+D  S   +  FR+++ +E V  + D+C  D  L +LD   PS
Sbjct:  223 HVWLPSSTGSSASADSECYVGEKDCRRSGEKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHEGRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKN-CFARDKLEERCNRGALKEMIVPPTWILRLANRK------RSSRTP-SHPRKHKKSHRQFVVKPTDLWS-SGPSQ-----------------------------PLL--------------VFVNPKSGGNKGSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDNLNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEPNTSCNLEEEDD-GMQ--------------SALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYGGLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD--NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPSIITLGFHSKVPML---KREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDNYKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNAEEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPS 887          
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Match: sp|Q13574|DGKZ_HUMAN (Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=3)

HSP 1 Score: 457.218 bits (1175), Expect = 3.625e-139
Identity = 227/485 (46.80%), Postives = 310/485 (63.92%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMT---------SDTCM-LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL 3169
            VF+NPKSGGN G K+++ F W LNPRQVFD++  GP+  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE +SKI+S VEEG +  LDRW+L + P               N +   E  +  A  + PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG+D TP+I+++KP  ++FLNI RY  GT PWG+P     F PQ  +DG LEV+G T  SLA LQVGGH +R+ QC+  V+TT K IP+QVDGEPC+L  S I I+    A ++ K KRRS+ PL S+              Q   + L++ V  + + DYE    +K+++ EA+     +   G S+L   R +I ++          S TC  L   + F+D+ T+ RF+RI + +E ++++ +I  +++Y+LDP+L
Sbjct:  487 VFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEP---------------NPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSD-------------QQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPEL 943          

HSP 2 Score: 187.963 bits (476), Expect = 5.878e-47
Identity = 82/174 (47.13%), Postives = 111/174 (63.79%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCE----KGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNN 1492
            +S  +WS  A    H+W +TN SGDFCY+ E  C     K  ++RKC++CK+++H  CI  L+     C+P+FRE+G R+ R+       +RHHWVHR+RQDGKC+ CGK FQ KFT +SKEIVA+ CSWCK  YH+K  CF    + E CS G H   +IPP+WI++     N
Sbjct:  273 RSTVDWSESATYGEHIWFETNVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPT----FVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVVIPPTWILRARRPQN 442          

HSP 3 Score: 54.6842 bits (130), Expect = 6.779e-6
Identity = 41/137 (29.93%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 3503 KFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTD---DLQLMQFLQKEEIIMKIENDPRKINI 3904
            + +EA K      +Q     G D +  D++  + LH+AV  G+  VV YL++ AP  +L+  +  +G+T +H+AAA+G ++IC  ++ AGASL+  D    TP Q  +   D +L  +L+  +    I+ + ++  +
Sbjct:  982 ELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEE-NGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV 1117          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A1S3K574 (Diacylglycerol kinase OS=Lingula unguis OX=7574 GN=LOC106178934 PE=3 SV=1)

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 411/931 (44.15%), Postives = 552/931 (59.29%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSN-FIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD---------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL--PSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDN---VFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFL-EACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAA 3727
            +S  +W+ +A    HLW++TN+SGD+CY+ E  C+K G ++KC++CK+++H  C+ HL+     C+PTFREAGVR+YRD+      +RHHWVHR+RQ+GKCKQCGKSFQ+KF  +SKEI+A+ CSWCK+ YHNK  CF    L E+C+ G H   IIPPSWIIK+  K +FKSS++K R      R +   DS  FI KP     I SP           H+                  P +              VF+NPKSGGN G K+M K  WLLNPRQVFD++  GPR+GLELF K+ N+RIL CGGDGT GWV+S +D+L I P PP+AILPLGTGNDLAR   WG GYTDE LSKI+S VEEGQ+  LDRWNL               L++     T ++         PL+V N+YFSLGADA  ALEFHESREANPEKFN+R KNK+FYAG GG+D+L+RSWKDL +++ +  DGID T +IKEM+ H LLFLNI +Y  GT PWG+    F PQ  +DG LEV+G T ASLA LQVGGH +RI QC+   +TT KTIPMQVDGEPCRLLPS I IS    A +I KPKRR S+P+L++     G +    F+    Q L+L    I + DYE    +K+K+  A+    ++     S+L  VR+ I  +  D         T  L  ++ F+DS T++RFFRI + +E +H++ DI  EDLY+LDP L  PS L+P +        + +S +  Y  A  D V   +     D+   VF+   +  +    +    + +     SS ++ A + +   L          P  V   +++ V   K L ++ K   +  +      GA+ L  D+ G++ LH+A   G+  VV +LI +AP  +L++ D   GQTA+HKAA
Sbjct:  186 RSTVDWTENAIKGDHLWIETNASGDYCYIGEAECQKAGPRKKCAACKIVVHTGCMTHLERIHFGCKPTFREAGVRNYRDQT----FVRHHWVHRRRQEGKCKQCGKSFQNKFGFHSKEIIAISCSWCKAAYHNKITCFMMQQLEEQCTLGSHAGIIIPPSWIIKIPKKGSFKSSIKKKRRGSAKRRKSKEADSKPFIVKP-----IPSP-----------HMK-----------------PLL--------------VFINPKSGGNQGAKIMHKLYWLLNPRQVFDLSRGGPRMGLELFKKVPNLRILACGGDGTAGWVLSALDTLGINPLPPVAILPLGTGNDLARTLGWGGGYTDEPLSKILSAVEEGQVVELDRWNLKV-----------QNLAVSEPVDTLDEKEEKGEPTLPLDVMNSYFSLGADAHVALEFHESREANPEKFNNRFKNKMFYAGAGGRDLLRRSWKDLAEHVKVEGDGIDLTSKIKEMRLHCLLFLNIPKYGAGTSPWGSSGSTFDPQRHDDGYLEVIGFTTASLAALQVGGHGERIAQCKEVHLTTYKTIPMQVDGEPCRLLPSVIEISLRNQANMIQKPKRRGSVPILND----PGLAI---FSPPSAQRLRLQASRISMADYEALHYDKEKLKAASIPLGIIVVENDSDLEVVRNRINHLQEDNLGVSNSAITQKLSPNWCFLDSTTAERFFRIDRSQEHLHYITDISSEDLYILDPDLLVPSGLNPQD----SPWQMVASREKGYEAAVTD-VPDGAAEGKLDHLNLVFSMPVTPPRSPGSEPGTPNSSAEERKSSFQAVAPVTSDASL--------TIP--VAAKQTVTVPTDKMLIDSSKRGDLVRIMELHRGGANLLATDQYGMTALHHASRFGHKEVVKFLIENAPPVILDIVDLEKGQTALHKAA 1032          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A1S3K5J5 (Diacylglycerol kinase OS=Lingula unguis OX=7574 GN=LOC106178934 PE=3 SV=1)

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 419/975 (42.97%), Postives = 562/975 (57.64%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSN-FIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD---------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL--PSNLSP--------------------------IEGRISEKGDIYS----------------SADSI---YNEATADRVQPYSLNAP--PDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFL-EACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAA 3727
            +S  +W+ +A    HLW++TN+SGD+CY+ E  C+K G ++KC++CK+++H  C+ HL+     C+PTFREAGVR+YRD+      +RHHWVHR+RQ+GKCKQCGKSFQ+KF  +SKEI+A+ CSWCK+ YHNK  CF    L E+C+ G H   IIPPSWIIK+  K +FKSS++K R      R +   DS  FI KP     I SP           H+                  P +              VF+NPKSGGN G K+M K  WLLNPRQVFD++  GPR+GLELF K+ N+RIL CGGDGT GWV+S +D+L I P PP+AILPLGTGNDLAR   WG GYTDE LSKI+S VEEGQ+  LDRWNL               L++     T ++         PL+V N+YFSLGADA  ALEFHESREANPEKFN+R KNK+FYAG GG+D+L+RSWKDL +++ +  DGID T +IKEM+ H LLFLNI +Y  GT PWG+    F PQ  +DG LEV+G T ASLA LQVGGH +RI QC+   +TT KTIPMQVDGEPCRLLPS I IS    A +I KPKRR S+P+L++     G +    F+    Q L+L    I + DYE    +K+K+  A+    ++     S+L  VR+ I  +  D         T  L  ++ F+DS T++RFFRI + +E +H++ DI  EDLY+LDP L  PS L+P                           EG++     ++S                S D+    ++  +++R  P +   P   + +F +EF    +Q R+      N S  A   +SS   V     D      +  P  V   +++ V   K L ++ K   +  +      GA+ L  D+ G++ LH+A   G+  VV +LI +AP  +L++ D   GQTA+HKAA
Sbjct:  186 RSTVDWTENAIKGDHLWIETNASGDYCYIGEAECQKAGPRKKCAACKIVVHTGCMTHLERIHFGCKPTFREAGVRNYRDQT----FVRHHWVHRRRQEGKCKQCGKSFQNKFGFHSKEIIAISCSWCKAAYHNKITCFMMQQLEEQCTLGSHAGIIIPPSWIIKIPKKGSFKSSIKKKRRGSAKRRKSKEADSKPFIVKP-----IPSP-----------HMK-----------------PLL--------------VFINPKSGGNQGAKIMHKLYWLLNPRQVFDLSRGGPRMGLELFKKVPNLRILACGGDGTAGWVLSALDTLGINPLPPVAILPLGTGNDLARTLGWGGGYTDEPLSKILSAVEEGQVVELDRWNLKV-----------QNLAVSEPVDTLDEKEEKGEPTLPLDVMNSYFSLGADAHVALEFHESREANPEKFNNRFKNKMFYAGAGGRDLLRRSWKDLAEHVKVEGDGIDLTSKIKEMRLHCLLFLNIPKYGAGTSPWGSSGSTFDPQRHDDGYLEVIGFTTASLAALQVGGHGERIAQCKEVHLTTYKTIPMQVDGEPCRLLPSVIEISLRNQANMIQKPKRRGSVPILND----PGLAI---FSPPSAQRLRLQASRISMADYEALHYDKEKLKAASIPLGIIVVENDSDLEVVRNRINHLQEDNLGVSNSAITQKLSPNWCFLDSTTAERFFRIDRSQEHLHYITDISSEDLYILDPDLLVPSGLNPQDSPWQMVASREKGYEAAVTDVPDGAAEGKLDHLNLVFSMPVTPPRSPGCMLGPESRDNSLLPHSPTSSNRSFPTTPITPVSSNELFLKEFMSKIQQRRRSEPGTPNSS--AEERKSSFQAVAPVTSD----ASLTIP--VAAKQTVTVPTDKMLIDSSKRGDLVRIMELHRGGANLLATDQYGMTALHHASRFGHKEVVKFLIENAPPVILDIVDLEKGQTALHKAA 1083          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A1S3K569 (Diacylglycerol kinase OS=Lingula unguis OX=7574 GN=LOC106178934 PE=3 SV=1)

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 368/747 (49.26%), Postives = 474/747 (63.45%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSN-FIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD---------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL--PSNLSP 3187
            +S  +W+ +A    HLW++TN+SGD+CY+ E  C+K G ++KC++CK+++H  C+ HL+     C+PTFREAGVR+YRD+      +RHHWVHR+RQ+GKCKQCGKSFQ+KF  +SKEI+A+ CSWCK+ YHNK  CF    L E+C+ G H   IIPPSWIIK+  K +FKSS++K R      R +   DS  FI KP     I SP           H+                  P +              VF+NPKSGGN G K+M K  WLLNPRQVFD++  GPR+GLELF K+ N+RIL CGGDGT GWV+S +D+L I P PP+AILPLGTGNDLAR   WG GYTDE LSKI+S VEEGQ+  LDRWNL               L++     T ++         PL+V N+YFSLGADA  ALEFHESREANPEKFN+R KNK+FYAG GG+D+L+RSWKDL +++ +  DGID T +IKEM+ H LLFLNI +Y  GT PWG+    F PQ  +DG LEV+G T ASLA LQVGGH +RI QC+   +TT KTIPMQVDGEPCRLLPS I IS    A +I KPKRR S+P+L++     G +    F+    Q L+L    I + DYE    +K+K+  A+    ++     S+L  VR+ I  +  D         T  L  ++ F+DS T++RFFRI + +E +H++ DI  EDLY+LDP L  PS L+P
Sbjct:  128 RSTVDWTENAIKGDHLWIETNASGDYCYIGEAECQKAGPRKKCAACKIVVHTGCMTHLERIHFGCKPTFREAGVRNYRDQT----FVRHHWVHRRRQEGKCKQCGKSFQNKFGFHSKEIIAISCSWCKAAYHNKITCFMMQQLEEQCTLGSHAGIIIPPSWIIKIPKKGSFKSSIKKKRRGSAKRRKSKEADSKPFIVKP-----IPSP-----------HMK-----------------PLL--------------VFINPKSGGNQGAKIMHKLYWLLNPRQVFDLSRGGPRMGLELFKKVPNLRILACGGDGTAGWVLSALDTLGINPLPPVAILPLGTGNDLARTLGWGGGYTDEPLSKILSAVEEGQVVELDRWNLKV-----------QNLAVSEPVDTLDEKEEKGEPTLPLDVMNSYFSLGADAHVALEFHESREANPEKFNNRFKNKMFYAGAGGRDLLRRSWKDLAEHVKVEGDGIDLTSKIKEMRLHCLLFLNIPKYGAGTSPWGSSGSTFDPQRHDDGYLEVIGFTTASLAALQVGGHGERIAQCKEVHLTTYKTIPMQVDGEPCRLLPSVIEISLRNQANMIQKPKRRGSVPILND----PGLAI---FSPPSAQRLRLQASRISMADYEALHYDKEKLKAASIPLGIIVVENDSDLEVVRNRINHLQEDNLGVSNSAITQKLSPNWCFLDSTTAERFFRIDRSQEHLHYITDISSEDLYILDPDLLVPSGLNP 805          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A1S3K575 (Diacylglycerol kinase OS=Lingula unguis OX=7574 GN=LOC106178934 PE=3 SV=1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 368/747 (49.26%), Postives = 474/747 (63.45%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSN-FIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD---------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL--PSNLSP 3187
            +S  +W+ +A    HLW++TN+SGD+CY+ E  C+K G ++KC++CK+++H  C+ HL+     C+PTFREAGVR+YRD+      +RHHWVHR+RQ+GKCKQCGKSFQ+KF  +SKEI+A+ CSWCK+ YHNK  CF    L E+C+ G H   IIPPSWIIK+  K +FKSS++K R      R +   DS  FI KP     I SP           H+                  P +              VF+NPKSGGN G K+M K  WLLNPRQVFD++  GPR+GLELF K+ N+RIL CGGDGT GWV+S +D+L I P PP+AILPLGTGNDLAR   WG GYTDE LSKI+S VEEGQ+  LDRWNL               L++     T ++         PL+V N+YFSLGADA  ALEFHESREANPEKFN+R KNK+FYAG GG+D+L+RSWKDL +++ +  DGID T +IKEM+ H LLFLNI +Y  GT PWG+    F PQ  +DG LEV+G T ASLA LQVGGH +RI QC+   +TT KTIPMQVDGEPCRLLPS I IS    A +I KPKRR S+P+L++     G +    F+    Q L+L    I + DYE    +K+K+  A+    ++     S+L  VR+ I  +  D         T  L  ++ F+DS T++RFFRI + +E +H++ DI  EDLY+LDP L  PS L+P
Sbjct:  186 RSTVDWTENAIKGDHLWIETNASGDYCYIGEAECQKAGPRKKCAACKIVVHTGCMTHLERIHFGCKPTFREAGVRNYRDQT----FVRHHWVHRRRQEGKCKQCGKSFQNKFGFHSKEIIAISCSWCKAAYHNKITCFMMQQLEEQCTLGSHAGIIIPPSWIIKIPKKGSFKSSIKKKRRGSAKRRKSKEADSKPFIVKP-----IPSP-----------HMK-----------------PLL--------------VFINPKSGGNQGAKIMHKLYWLLNPRQVFDLSRGGPRMGLELFKKVPNLRILACGGDGTAGWVLSALDTLGINPLPPVAILPLGTGNDLARTLGWGGGYTDEPLSKILSAVEEGQVVELDRWNLKV-----------QNLAVSEPVDTLDEKEEKGEPTLPLDVMNSYFSLGADAHVALEFHESREANPEKFNNRFKNKMFYAGAGGRDLLRRSWKDLAEHVKVEGDGIDLTSKIKEMRLHCLLFLNIPKYGAGTSPWGSSGSTFDPQRHDDGYLEVIGFTTASLAALQVGGHGERIAQCKEVHLTTYKTIPMQVDGEPCRLLPSVIEISLRNQANMIQKPKRRGSVPILND----PGLAI---FSPPSAQRLRLQASRISMADYEALHYDKEKLKAASIPLGIIVVENDSDLEVVRNRINHLQEDNLGVSNSAITQKLSPNWCFLDSTTAERFFRIDRSQEHLHYITDISSEDLYILDPDLLVPSGLNP 863          
BLAST of Diacylglycerol kinase vs. TrEMBL
Match: A0A1S3K5S6 (Diacylglycerol kinase OS=Lingula unguis OX=7574 GN=LOC106178934 PE=3 SV=1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 368/747 (49.26%), Postives = 474/747 (63.45%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSN-FIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD---------TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKL--PSNLSP 3187
            +S  +W+ +A    HLW++TN+SGD+CY+ E  C+K G ++KC++CK+++H  C+ HL+     C+PTFREAGVR+YRD+      +RHHWVHR+RQ+GKCKQCGKSFQ+KF  +SKEI+A+ CSWCK+ YHNK  CF    L E+C+ G H   IIPPSWIIK+  K +FKSS++K R      R +   DS  FI KP     I SP           H+                  P +              VF+NPKSGGN G K+M K  WLLNPRQVFD++  GPR+GLELF K+ N+RIL CGGDGT GWV+S +D+L I P PP+AILPLGTGNDLAR   WG GYTDE LSKI+S VEEGQ+  LDRWNL               L++     T ++         PL+V N+YFSLGADA  ALEFHESREANPEKFN+R KNK+FYAG GG+D+L+RSWKDL +++ +  DGID T +IKEM+ H LLFLNI +Y  GT PWG+    F PQ  +DG LEV+G T ASLA LQVGGH +RI QC+   +TT KTIPMQVDGEPCRLLPS I IS    A +I KPKRR S+P+L++     G +    F+    Q L+L    I + DYE    +K+K+  A+    ++     S+L  VR+ I  +  D         T  L  ++ F+DS T++RFFRI + +E +H++ DI  EDLY+LDP L  PS L+P
Sbjct:  102 RSTVDWTENAIKGDHLWIETNASGDYCYIGEAECQKAGPRKKCAACKIVVHTGCMTHLERIHFGCKPTFREAGVRNYRDQT----FVRHHWVHRRRQEGKCKQCGKSFQNKFGFHSKEIIAISCSWCKAAYHNKITCFMMQQLEEQCTLGSHAGIIIPPSWIIKIPKKGSFKSSIKKKRRGSAKRRKSKEADSKPFIVKP-----IPSP-----------HMK-----------------PLL--------------VFINPKSGGNQGAKIMHKLYWLLNPRQVFDLSRGGPRMGLELFKKVPNLRILACGGDGTAGWVLSALDTLGINPLPPVAILPLGTGNDLARTLGWGGGYTDEPLSKILSAVEEGQVVELDRWNLKV-----------QNLAVSEPVDTLDEKEEKGEPTLPLDVMNSYFSLGADAHVALEFHESREANPEKFNNRFKNKMFYAGAGGRDLLRRSWKDLAEHVKVEGDGIDLTSKIKEMRLHCLLFLNIPKYGAGTSPWGSSGSTFDPQRHDDGYLEVIGFTTASLAALQVGGHGERIAQCKEVHLTTYKTIPMQVDGEPCRLLPSVIEISLRNQANMIQKPKRRGSVPILND----PGLAI---FSPPSAQRLRLQASRISMADYEALHYDKEKLKAASIPLGIIVVENDSDLEVVRNRINHLQEDNLGVSNSAITQKLSPNWCFLDSTTAERFFRIDRSQEHLHYITDISSEDLYILDPDLLVPSGLNP 779          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkzb (diacylglycerol kinase zeta [Source:NCBI gene;Acc:103036104])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 405/1049 (38.61%), Postives = 589/1049 (56.15%), Query Frame = 2
Query:  836 LMTSNNKPRAVSIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKN-NFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKM----TSDTCMLDK---SFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPS----NLSP-IEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            LM ++  PR  S    +   + KS       +  +T+      N EI+Q+      +W+ +A    H+W +T+ SGDFCY+ E+ C     +K   + KC++CK+ +H  C+  L+     C+P+FRE G R+ R+      ++RHHWVHR+RQDGKC+QCGK FQ KF+ ++K+IVA+ CSWCK  YHNK  CF    + E CS G H   I+PPSWII++  +  + KSS R+ ++       +L                   SK   +D   +H  ++K I  Q                      KPLLVF+NPKSGGN G K++R F W LNPRQVFD++  GP+ GLE++ K+ N+RILVCGGDGTVGW++S +D L + P P +A+LPLGTGNDLAR  +WG+GYTDE +SKI+S VE+G I  LDRWNL+  P               N + T ++ +     K P+NVFNNYFSLG DA   LEFHESREA PEKFNSRL+NK+FYAG    D L RS KDL  +I +VCDG+D T +++E+K   LLFLNI RY  GT PWGNP+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+  ++TT K IP+QVDGEPCRL PS I I+    A ++ K KRR S+P L++              Q   + L++ V  I + DYE    +KDK+ EA+    ++T SG ++L   R +I K+     SDT  + K    + F+DS T+DRF+RI + +E ++++ +I  ++L++LDP+L +      SP + G + E  +  +S+D     A +    P    A             +K++  +  N E +++ A S       +N+    + +T         +K           + + KS +   +Q     GA     D  G + LHYAV  G+  +V Y+IN+AP ++L+  +  +G+TA+HKAAA  H++IC  L+ AGASL+  D    TP   ++   D +L ++L+  +    I+ D ++  +
Sbjct:  295 LMGAHYDPRLESWSGFLSKAIAKSGVQHLSAQSSATMPNKCEANREISQTV-----DWTENALFGQHVWFETSLSGDFCYVGESHCFAKSLQKSLPRYKCAACKISVHTTCMEQLEKINFRCKPSFREPGTRNVRETT----SVRHHWVHRRRQDGKCRQCGKGFQQKFSFHNKDIVAISCSWCKQAYHNKVTCFMLQQIEETCSLGAHAAVIVPPSWIIRVRRQQASLKSSKRRKKT-------SLKNKG---------------SKKGAEDGKWKHF-IVKPIPSQ--------------------LMKPLLVFVNPKSGGNQGSKIIRSFMWFLNPRQVFDLSQGGPKDGLEMYRKVPNLRILVCGGDGTVGWILSVLDDLQLNPQPAVAVLPLGTGNDLARTLNWGAGYTDEPVSKILSHVEDGNIVQLDRWNLSVEP---------------NPEATEDEKDEHQTDKLPINVFNNYFSLGFDAHVTLEFHESREAKPEKFNSRLRNKMFYAGTAFSDFLMRSSKDLSKHIRVVCDGMDLTSKVQELKLQCLLFLNIPRYCAGTTPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLHQCREVMLTTFKPIPVQVDGEPCRLAPSIIRITLRNQANMVQKTKRRISLPQLND-------------QQPFSEQLQIQVSRISMHDYETLHYDKDKLKEASIPLGIITVSGDNDLETCRLHIEKLHEGRGSDTVTVPKISPKWCFLDSTTADRFYRIDRAQEHLNYVTEISQDELFILDPELVTKETVGTSPGMPGMVEEVAESSNSSDQFAFPANSQAPSPLCRAA-----------GQRKRMSCDGTNPEGQTDAAVS-------INESLCRSDDTVWNTADKDTIKM---------LIGSVKSGNFKKLQELHTQGASLAVSDALGCTLLHYAVDVGSKEMVKYIINNAPPSILDAMEKETGETALHKAAASCHRTICGYLVEAGASLIKTDLQGDTPKVHAERALDWELAEYLENRQHHQMIQRDDQETAV 1236          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkzb (diacylglycerol kinase zeta [Source:NCBI gene;Acc:103036104])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 399/1031 (38.70%), Postives = 580/1031 (56.26%), Query Frame = 2
Query:  890 FRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKN-NFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKM----TSDTCMLDK---SFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPS----NLSP-IEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            F  RK+    G+    +          E N+   ++V +W+ +A    H+W +T+ SGDFCY+ E+ C     +K   + KC++CK+ +H  C+  L+     C+P+FRE G R+ R+      ++RHHWVHR+RQDGKC+QCGK FQ KF+ ++K+IVA+ CSWCK  YHNK  CF    + E CS G H   I+PPSWII++  +  + KSS R+ ++                         +  SK   +D   +H  ++K I  Q                      KPLLVF+NPKSGGN G K++R F W LNPRQVFD++  GP+ GLE++ K+ N+RILVCGGDGTVGW++S +D L + P P +A+LPLGTGNDLAR  +WG+GYTDE +SKI+S VE+G I  LDRWNL+  P               N + T ++ +     K P+NVFNNYFSLG DA   LEFHESREA PEKFNSRL+NK+FYAG    D L RS KDL  +I +VCDG+D T +++E+K   LLFLNI RY  GT PWGNP+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+  ++TT K IP+QVDGEPCRL PS I I+    A ++ K KRR S+P L++              Q   + L++ V  I + DYE    +KDK+ EA+    ++T SG ++L   R +I K+     SDT  + K    + F+DS T+DRF+RI + +E ++++ +I  ++L++LDP+L +      SP + G + E  +  +S+D     A +    P    A             +K++  +  N E +++ A S       +N+    + +T         +K           + + KS +   +Q     GA     D  G + LHYAV  G+  +V Y+IN+AP ++L+  +  +G+TA+HKAAA  H++IC  L+ AGASL+  D    TP   ++   D +L ++L+  +    I+ D ++  +
Sbjct:   62 FGRRKAIAKSGVQHLSAQSSATMPNKCEANREISQTV-DWTENALFGQHVWFETSLSGDFCYVGESHCFAKSLQKSLPRYKCAACKISVHTTCMEQLEKINFRCKPSFREPGTRNVRETT----SVRHHWVHRRRQDGKCRQCGKGFQQKFSFHNKDIVAISCSWCKQAYHNKVTCFMLQQIEETCSLGAHAAVIVPPSWIIRVRRQQASLKSSKRRKKTSLK----------------------NKGSKKGAEDGKWKHF-IVKPIPSQ--------------------LMKPLLVFVNPKSGGNQGSKIIRSFMWFLNPRQVFDLSQGGPKDGLEMYRKVPNLRILVCGGDGTVGWILSVLDDLQLNPQPAVAVLPLGTGNDLARTLNWGAGYTDEPVSKILSHVEDGNIVQLDRWNLSVEP---------------NPEATEDEKDEHQTDKLPINVFNNYFSLGFDAHVTLEFHESREAKPEKFNSRLRNKMFYAGTAFSDFLMRSSKDLSKHIRVVCDGMDLTSKVQELKLQCLLFLNIPRYCAGTTPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLHQCREVMLTTFKPIPVQVDGEPCRLAPSIIRITLRNQANMVQKTKRRISLPQLND-------------QQPFSEQLQIQVSRISMHDYETLHYDKDKLKEASIPLGIITVSGDNDLETCRLHIEKLHEGRGSDTVTVPKISPKWCFLDSTTADRFYRIDRAQEHLNYVTEISQDELFILDPELVTKETVGTSPGMPGMVEEVAESSNSSDQFAFPANSQAPSPLCRAAG-----------QRKRMSCDGTNPEGQTDAAVS-------INESLCRSDDTVWNTADKDTIKM---------LIGSVKSGNFKKLQELHTQGASLAVSDALGCTLLHYAVDVGSKEMVKYIINNAPPSILDAMEKETGETALHKAAASCHRTICGYLVEAGASLIKTDLQGDTPKVHAERALDWELAEYLENRQHHQMIQRDDQETAV 989          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: ENSAMXT00000017589.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:8274376:8360823:-1 gene:ENSAMXG00000017084.2 transcript:ENSAMXT00000017589.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 511.531 bits (1316), Expect = 9.617e-166
Identity = 284/659 (43.10%), Postives = 373/659 (56.60%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC----EKGGAKRKCSSCKLIIHQLCIPHL---QLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELS-MQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKI 2935
            ++  +W+ +A N  HLW++TN SGD CYL E  C     K   +RKC+ CK+++H  CI  L      C+PTFRE   R  RD     + LRHHWVHR+RQ+GKC+QCGKSFQ KF  +SKEI+A+ CSWCK  +HNK  CF    + E CS G H   I+PPSWIIK+   +++FK+S R+ +      R++         +P     + SP              ++K +                            LVF+NPKSGGN                             LEL+ K+ N+RIL CGGDGTVGWV+S +D L + P PP+A+LPLGTGNDLAR  +WG GYTDE +SKI+  VE+G +  LDRWNL            + E S  Q ++GT          K PLNVFNNYFSLG DA   LEFHESR ANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D T +I+E+K   ++FLNI  Y  GT PWGN      F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+   +TT KT+P+QVDGEPCRL PS + IS    A ++ K KRR+S+PLL+              +    + L+L V  I L +YE    +K+++
Sbjct:   95 RAAVDWTENAVNGDHLWLETNCSGDLCYLGEETCMVKIAKSAPRRKCAGCKIVVHMACIEQLDKINFRCKPTFREGSSRCLRD-----NVLRHHWVHRRRQEGKCRQCGKSFQQKF-FHSKEIIAISCSWCKQAFHNKVTCFMLHQIEEPCSLGAHAGVIVPPSWIIKVRKPQSSFKNSTRRKKRTSFKRRTSKKGTDESKWRPFMLKPLPSP--------------LMKPV----------------------------LVFVNPKSGGNQ----------------------------LELYRKVPNLRILACGGDGTVGWVLSALDELQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKILCHVEDGTVVQLDRWNL------------QVEWSPAQPEEGT---------QKLPLNVFNNYFSLGFDAHVTLEFHESR-ANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTAKIQELKFQCIVFLNIP-YCAGTMPWGNTGDHRDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVTLTTYKTMPVQVDGEPCRLAPSTLRISLRNQANMVQKSKRRTSVPLLN--------------SHAVPERLRLRVNRISLPEYENLQFDKERL 640          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkza (diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB-GENE-111104-3])

HSP 1 Score: 413.305 bits (1061), Expect = 9.271e-129
Identity = 211/425 (49.65%), Postives = 275/425 (64.71%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKM 3019
            VF+NPKSGGN G K+++ F W LNPRQVFD++  GP+ GLE++ K+ N+RIL CGGDGTVGW++S +D L + P P +A+LPLGTGNDLAR  +WG G T   +SKI+S VE+G I  LDRWNL   PN                +  SE+ +     K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L  S KDL  +I +VCDG D T +++E+K   L+FLNI RY  GT PWGNP+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+   +TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR+SIPLL++              Q   + L++ V  I + DYE     K+K+ E ++ + ++   G S+L   R +I ++
Sbjct:   77 VFVNPKSGGNQGAKIIQSFMWYLNPRQVFDLSQGGPKEGLEMYRKVHNLRILACGGDGTVGWILSTLDQLQLNPQPAVAVLPLGTGNDLARTLNWG-GVT---VSKILSHVEDGNIVQLDRWNLHLEPN---------------PEAGSEEKDEQVTDKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIKVVCDGADLTSKVQELKLQCLVFLNIPRYCAGTMPWGNPSEHHDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLNQCREVTLTTYKSIPMQVDGEPCKLAPSTIHISLRNQANMVQKTKRRTSIPLLND-------------QQPFPERLRIRVNRISMHDYEALHYHKEKLKEQSR-WGLIVVPGDSDLETCRIHIERL 468          
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Match: dgkab (diacylglycerol kinase beta [Source:NCBI gene;Acc:103047572])

HSP 1 Score: 265.774 bits (678), Expect = 6.018e-75
Identity = 193/649 (29.74%), Postives = 285/649 (43.91%), Query Frame = 2
Query:  926 TERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLW-VDTNSSGDFCYLNENVCEKGGAKR-KCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--------GGFGP-------------QSFNDGKLEVVGLTAA-SLATLQVG----GHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSS 2788
             +   T+  +      +N  P   +    +  ++  H+W +   +   +C++ +N+    G +   C+ CK  +H  C      PC  TF  +        K++     H WV       KC+ C K          K +   +C WC    HN+ +    S+ +  C  G   D ++PP W I    K +  S   +      +T      D +F               LQI                   F +    P +              VF+NPKSGG  G +++RKFQ+LLNPRQV+++++ GP  GL  F  +   +ILVCGGDGTVGWV+  ID   +  +PP+AILPLGTGNDLAR   WG GY    LS+I+  +EE  +  +DRW +   PN        DE         +E  +P      P  + NNYFS+G DA+ A  FH  RE +P+KFNSR KNK++Y  +   + +  S K+L + +T+ C G+        ++   +  LNI    GG+  WG           GG  P             Q  +D  LEVVGL  A  +  +  G    GH  R+ Q    ++ T K +PMQ+DGEP    P  I I+H   A ++  P  +SS
Sbjct:  179 ADSNGTVTQEEWIQGGMNNVPLLVLLGLKMADKDGQHVWRMKHFNRPTYCFVCQNMLLGLGKQGLSCNVCKCTVHSHCANKYHSPCAATFITS--------KEEIGLAVHAWVSADCDSSKCEICHKKI--------KALAGKRCVWCHLTRHNECV----SVGSVNCDCGPLKDHVLPP-WAICSVNKKDGGSHCLEESDLANIT-----SDGHF---------------LQI-------------------FPVHYSNPLL--------------VFVNPKSGGKQGGRVLRKFQYLLNPRQVYNLSNGGPNPGLHFFRNLQKYKILVCGGDGTVGWVLDAIDKADMAINPPVAILPLGTGNDLARCLRWGGGYEGSDLSEILKEIEESVVMKMDRWKVQVVPN--------DE---------NEVGDP-----LPSEIINNYFSIGVDASIAHRFHTMREKHPQKFNSRAKNKLWYFELATSETISASCKNLRECLTIQCCGVRLDLSSHSLEG--IAVLNIPSMHGGSNLWGETKKTEDVYKDGGHCPQVITDTDVLERSSQDMSDKLLEVVGLEGAIEMGQIYTGLKSKGH--RLAQTTQIMIKTKKALPMQIDGEPWMQPPCTIHITHKNQASMLAAPPAKSS 727          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: dgkzb (diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB-GENE-111104-4])

HSP 1 Score: 418.313 bits (1074), Expect = 6.820e-133
Identity = 202/350 (57.71%), Postives = 254/350 (72.57%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIP 2794
            VF+NPKSGGN G K+M+   WLLNPRQVFD+   GP+  LEL+ K+ N+R+L CGGDGTVGW++S +D L I P PP+AILPLGTGNDLAR  +WG GYTDE +SK++S VEEG    LDRWNL   PN     + +DE     + GTS+ S  P  ++ PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ ++CDG+D TP+I+E+K   ++FLNI RY  GT PWGNPA    F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+ AV+ T++T P+QVDGEPCRL PS I IS    A ++ K KRR+S+P
Sbjct:  208 VFINPKSGGNQGNKIMQSLMWLLNPRQVFDLGAGGPQEALELYRKVPNLRVLACGGDGTVGWILSVLDQLQIVPPPPVAILPLGTGNDLARTLNWGGGYTDEPISKVLSHVEEGATVQLDRWNLDVRPNP---DVGRDE----QEQGTSKPS--PNPNQLPLDVFNNYFSLGFDARVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLAKHVRVMCDGVDLTPKIQELKLQCIVFLNIPRYCAGTVPWGNPADHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREAVLATLRTTPVQVDGEPCRLAPSIIRISLRNQALMVQKSKRRASVP 548          

HSP 2 Score: 189.119 bits (479), Expect = 3.211e-51
Identity = 85/174 (48.85%), Postives = 111/174 (63.79%), Query Frame = 2
Query:  980 QSPQKSVPNWSIDAQNKT----HLWVDTNSSGD-FCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            QSP    P  S+  Q       H+W D+  SGD  CYL E+ C K  +++KC+SC++++H  CIP L+     C+PTFREAG R  R+       +RHHWVHR RQ+G+C+QCGK FQ KFT +SKEIVA+ CSWCK  YHNK  CF    + E CS G H   I+PP+WII++
Sbjct:    4 QSPHACAPRVSVGVQEAAVPGDHVWFDSGDSGDGCCYLGEDGCVKSMSRKKCASCRIVVHVACIPQLEQINFRCKPTFREAGTRSAREA----SAVRHHWVHRHRQEGRCRQCGKGFQQKFTFHSKEIVAISCSWCKQAYHNKVSCFMLQQIEEPCSLGVHAAVIVPPTWIIRV 173          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002929.1 (pep scaffold:Pmarinus_7.0:GL476935:158222:277059:-1 gene:ENSPMAG00000002642.1 transcript:ENSPMAT00000002929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.485 bits (711), Expect = 1.279e-80
Identity = 187/593 (31.53%), Postives = 270/593 (45.53%), Query Frame = 2
Query: 1118 CSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSIS-----LQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGG---------------------------FGPQSFNDGKLEVVGLTAA-SLATLQVG--GHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSI 2791
            C+ CK  +H+ C+    L C        +  Y   KK    + H+WV       KC +C KS +       + +  + C WC    HNK      S +  EC  GQ  D ++PP+ I  +         +    +P+    +  PQ+     +  +     S S   +DD++        S++     LQ T     H P +              VF+NPKSGG  G K++RKFQ+LLNPRQV+++   GP  GL  F  + + R+L CGGDGTVGWV+  ID L++   PP+A+LPLGTGNDLAR  HWG GY   SL K +  VE      LDRW++          I+ D           E+ +P      P ++ NNYFS+G DA+ A  FH  RE +PEKFNSR+KNK++Y   G  + L  + K L +++ + CDG+        ++   +  LNI    GG+  WG                                F  Q  +D  LEVVGL  A  +  +  G      R+ QC +  + T K +PMQ+DGEP    P  I I H   A +++ P  ++  
Sbjct:  145 CTFCKYTVHERCVAKAPLNC--------ISTYAKSKKSATVMDHYWV-EGNCPAKCDKCHKSIKC-----YQGLTGLHCVWCHITLHNK----CASHVKPECDCGQLKDHVLPPNTIFPLVL-------IMGIPTPN----ACEPQE-----RQMSVQRTDSGSGASLDDDVLRRFQRTNSVTGDGHALQITPTTGTH-PLL--------------VFVNPKSGGKQGEKILRKFQYLLNPRQVYNLNKGGPFPGLNFFRDVPDFRVLTCGGDGTVGWVLDCIDKLSLPKRPPVAVLPLGTGNDLARCLHWGGGYEGGSLRKTLKDVENSTPLMLDRWSI--------EVIATD---------LDEKGDP-----VPYSIINNYFSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTSETLFATCKKLYEFMEVECDGVQLDLANSSLEG--ITVLNIPSMHGGSNLWGETNTRRVSRRSSMRRSGREKVQATIADQRELKFCQQDLSDHLLEVVGLDGAMEMGQIYTGLKSAGSRLAQCSSVTIRTTKLLPMQIDGEPWMQPPCTIKIIHKNQAPMLMGPAPKTGF 664          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009725.1 (pep scaffold:Pmarinus_7.0:GL478043:6842:50807:-1 gene:ENSPMAG00000008779.1 transcript:ENSPMAT00000009725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 2.249e-63
Identity = 168/589 (28.52%), Postives = 248/589 (42.11%), Query Frame = 2
Query: 1118 CSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEI-DSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFH-ESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGG--------------------------FGPQSFNDGKLEVVGLTAA-SLATLQVG--GHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSI 2791
            CS CK  +H+ C+    L C        +  Y   KK  + + HH+        KC +C K+ +       + +  + C+WC+   HNK      S +  EC  G   D ++PPS I  +      K+++  SR     T+  L   S  +   +           QI   +  H                   P +              VF NPKSGG  G +++RK Q+LLNPRQV+++   GP  GL  F  + + R+L CGGDGTVGWV+  I D   +   PP+A+LPLGTGNDLAR   WG GY   SL K++  +E   +  LDRW    TP+                  TSE+   P     P ++ NNYFS+G         H  + +  P      +KNK++Y   G  +    + K L + I + CDG+        ++   +  LNI    GG+  WG                               +  Q   D  LEVVGL  A  +  +  G      R+ QC +  + T K +PMQ+DGEP    P  I ++H   A +++ P+ +SS+
Sbjct:  144 CSFCKYTVHERCVARAPLSC--------ITTYVKSKKDANKVMHHFWVEGNCHTKCHKCHKAIKC-----YQGLTGLHCAWCQITLHNK----CASHVKPECDCGPLKDHVLPPSSICPIVLVACRKTAL--SRRCHKRTKKKLHCGSATVCLLS-----------QITPVLGTH-------------------PLL--------------VFGNPKSGGKQGDRILRKIQYLLNPRQVYNLAKGGPMPGLSFFRDVPDFRVLACGGDGTVGWVLDCIADKAGLTRHPPVAVLPLGTGNDLARCLRWGGGYEGGSLMKVMKDIENSSVVMLDRWWFDVTPH------------------TSEEKGDPV----PYSIINNYFSMGVHLPIQHGVHFIATKYFPPLCEGSMKNKLWYFEFGTSETFSATCKKLHECIEIECDGMLLDLSNTSLEG--VALLNIPSMHGGSNLWGESRRRRNYRRQSKKRPPERAMTTVTDPKELKYCVQDLGDQLLEVVGLEGAMEMGQIYTGLKSAGKRMAQCSSVTIRTTKLLPMQIDGEPWMQPPCTIKVTHKNQAPMLMGPQPKSSL 645          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: DGKI (diacylglycerol kinase iota [Source:HGNC Symbol;Acc:HGNC:2855])

HSP 1 Score: 214.542 bits (545), Expect = 7.992e-61
Identity = 102/185 (55.14%), Postives = 128/185 (69.19%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESR 2305
            +F+NPKSGGN G K+M+ F W LNPRQVFD+++ GPR  LE++ K+ N+RIL CGGDGTVGW++S +D L + P PP+A+LPLGTGNDLAR  +WG GYTDE +SKI+S VE+G I  LDRWNL                  +N D   E+ +     + PL+VFNNYFSLG DA   LEFHESR
Sbjct:  278 IFINPKSGGNQGTKVMQTFMWYLNPRQVFDLSNGGPRDALEMYKKVPNLRILACGGDGTVGWILSVLDQLQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKILSHVEDGLIVQLDRWNLD---------------LQRNPDVGPEEFDDGVQKRLPLDVFNNYFSLGFDAHVTLEFHESR 447          

HSP 2 Score: 154.836 bits (390), Expect = 2.180e-40
Identity = 72/161 (44.72%), Postives = 100/161 (62.11%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHL---QLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSI 1450
            +S+ +W+ +A    HLW DT+ SGD CY+ E  C     +K   ++KC++CK+++H  CI  L      C+PTFREAG R+ R+       +RHHWVHR+RQDGKCKQCGK FQ KF  +SKEIVA+ CSWCK  Y    +C  +    E  + G+ Y ++
Sbjct:   59 RSIVDWNENASIGEHLWYDTSVSGDVCYVGEESCMAKTAQKSLPRKKCAACKIVVHVACIDQLAKINFRCKPTFREAGCRNIREP----SFVRHHWVHRRRQDGKCKQCGKGFQQKFAFHSKEIVAISCSWCKQAYFCAVMCLNSEPSGEWRAVGKTYAAV 215          
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007068.1 (pep scaffold:Pmarinus_7.0:GL477921:19741:38299:1 gene:ENSPMAG00000006363.1 transcript:ENSPMAT00000007068.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.149 bits (531), Expect = 4.919e-59
Identity = 128/337 (37.98%), Postives = 184/337 (54.60%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAI---FPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDF-TPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA-GGFGPQSFNDGKLEVVGLTAA-SLATLQVGGHAD-RICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISIS 2740
            V +NP+SGG  G +L+  F+  +NP QVFD+   GP  GL +F ++   R+LVCGGDGTVGWV+S ++ + +      PP+AILPLGTGNDLAR   WG GY+ E    ++  V+E Q   +DRW +    N+     +++  SM      +E       S++ +   NNYF +G DA  +L FH +RE +P KFNSRL NK  Y  +G + +     ++L   I +  D +D   P ++      L+FLNI  +  G   WG+ + G F     +DG LEVVG+T    +  +Q G  +  RI Q Q   V   +  P+QVDGEP    P  I +S
Sbjct:  118 VLINPRSGGMQGRELLHSFRKAVNPHQVFDLACGGPLPGLHVFREVPRFRLLVCGGDGTVGWVLSLLEDIKLKLACTQPPVAILPLGTGNDLARVLRWGPGYSGEDPLSVLINVDEAQEVKMDRWTILLDANE--PECAQERTSMPRLGDETE-------SQYQIVQMNNYFGIGVDADLSLGFHNAREEDPGKFNSRLHNKSVYVKVGLQKITHN--RNLHRDIKVQVDNVDIDLPSVEG-----LIFLNIPSWGSGADLWGSDSEGKFSKPCMHDGLLEVVGVTGVMHMGQVQGGLRSGIRIAQGQFIRVVLQRETPIQVDGEPWLQPPGNIIVS 438          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO38287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC5])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 353/973 (36.28%), Postives = 512/973 (52.62%), Query Frame = 2
Query: 1016 DAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGG--FGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSD-----TCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPK--------LPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEF---SENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTP---SQLTDDLQLMQFLQKEE 3862
            +A N  H+WVD+ +SG  CYL +  C K GA++KC++CK++IH  C+  L+     C+ TFRE   +        E  +RHHWVHR+RQDG+C+ CGKSFQ   +  SK             YHNK  CF    + E C  G H + I+PPSW++K+  K     + R S    ++ R +  +   F+ KP+                                 G  N  P V              VF+NPKSGGN G+++M KFQWLLNPRQVFD++  GPR GLEL+ K+ NVR+L CGGDGTVGW++SE+D L   P PP+AILPLGTGNDL+RA +WG GY DE LSKI++ V+EG +  LDRW+L   P                   +       A S+ PLNV NNYFSLG DA   LEFHESREA+P KFNSR+KNK+FY        ++   KD   +  L CDG+D T ++ E KP  LLFLNI +YS GT PWGNP     F PQ  +DG +EV+ LT+A+LAT +VGGH +R+ QC+N ++TT K+IPMQVDGEPCRL PS I IS    A +I K KRR+            G S E +      + +K+ +F +   DYE +  +  ++ E+A      +    ++L  +R  I +  S+       +L   + F+D++  DR +R+   +E+++ ++DI  + ++++D K          S   P    ++ +G   + +     E + D +Q  SL  P      +EF   +E++  ++    N   K ND    E++            E ++++                +  EA  S++V +++     G  PL          HYA  +G+ S++ Y+I++ P  +L+L +   GQTA+HKAA    ++ICSLL+ AGASL   D    TP   +    D +L ++L+ +E
Sbjct:  112 NAINGKHMWVDSEASGTLCYLYDFDCVKSGARKKCTACKIVIHTKCMEKLERINFICKTTFREIQPKGVH-----ESNMRHHWVHRRRQDGRCETCGKSFQHMLSFQSK-------------YHNKDECFKVDRIEELCDLGVHSNVIVPPSWVVKIPKKARSFPTKRNSFKKKSIKRRSTKERKPFVIKPS---------------------------------GSANKRPLV--------------VFINPKSGGNQGLRIMHKFQWLLNPRQVFDLSREGPREGLELYRKVPNVRLLACGGDGTVGWILSELDKLKFNPRPPVAILPLGTGNDLSRALNWGGGYADEPLSKILTHVDEGSVVQLDRWDLEVVP-------------------SGYTDGEIAESRLPLNVMNNYFSLGFDAEVCLEFHESREAHPAKFNSRVKNKLFYGKASSTTFIQGKAKDFYKHTKLECDGVDITEKLLEAKPMCLLFLNISKYSAGTSPWGNPGRDHEFLPQRSDDGYIEVLALTSATLATTRVGGHGERLAQCRNVIMTTSKSIPMQVDGEPCRLQPSRIRISVRNQADMIQKVKRRA-----------LGSSGESE-PAPSPEPVKVKIFCVNFKDYELHCYDIRRLRESATVLTTTSIEPDADLEQMRVWIERFISEEEESQKTILSDDWCFLDTSYPDRVYRVDVAQENIYNVVDIVEKGVFIVDLKGGKTVTRTSSSTTPPTSVNLARRGLPVAHSQESLREDSDDVLQT-SLITPFTPTGKKEFVIPAEDEVWVK----NTTAKKNDLLMIEAAK---------TGELEKVI----------------ELHEAGVSLTVGDLR-----GWRPL----------HYAARHGHKSIITYIISNVPRCVLDLVEEEKGQTALHKAAFYQRRTICSLLVQAGASLTRTDYDGNTPRIQALKCQDKELSRYLETQE 943          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO42510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H8])

HSP 1 Score: 296.975 bits (759), Expect = 2.486e-86
Identity = 194/575 (33.74%), Postives = 279/575 (48.52%), Query Frame = 2
Query: 1115 KCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHL--LLFLNIQRYSGGTQPWGNPAG-----------------GFGPQSFNDGKLEVVGLTAASLATLQVGG---HADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKP 2773
            +C  CK  +H+ C+      C  T+        + ++  + T+ HHWV      GKC +C K+ +S     +  +  ++C+WC+   HNK    AT++ + EC+ G H + I+PP  I    T     S+ RK  +                    +PD+ + P+     D +   IT      L  T  +                     VF+NPKSGG  G +LM KFQ+LLNPRQVF++ D GP  GL+ F  +++ R+L CGGDGTVGWV++ ID L +   PP+A+LPLGTGNDLAR   WG GY   S+SK++S V+ G +  +DRW +  T                    +SE  + P     PLN+ NNYFS+G DA+ AL+FH  RE NPEKFNSRLKNK  Y   G  + L  + K+L D I ++CDG     +I E+ P+L  +  +NI    GG   WG                      +  Q   DG+LEVVGL ++      + G   H  R+ QC +  + T +  PMQ+DGEP     + + I H     ++  P
Sbjct:  216 QCLFCKYTVHERCVQRAPASCINTY-------VKSKRTGKMTMDHHWV-EGNCPGKCFKCNKTVKS-----TNCLTGLRCAWCQMVVHNKC---ATNV-SPECNLGVHREHILPPMSI----TPAGLVSTDRKRTNSSA----------------ESPDSTTKPNSYVNFDGMPMQIT-----PLPGTHPLA--------------------VFINPKSGGRQGSRLMHKFQYLLNPRQVFNLGDGGPAPGLKFFQHLSDFRVLCCGGDGTVGWVLATIDKLQMRFRPPVAVLPLGTGNDLARCLKWGGGYEGGSISKVLSQVQRGSVLSMDRWQIDVTDVD-----------------SSENGDSP-----PLNIINNYFSIGVDASVALKFHLQREKNPEKFNSRLKNKFRYFECGTSETLSATCKNLQDAIQVICDG-----KILEL-PNLEGIAIVNIPSVYGGANLWGETDKKKAKKSRSKSGSKDNDLAWAVQDIGDGQLEVVGLESSLYVGQIIAGVRTHGLRLAQCSSIEIKTKRLFPMQIDGEPWMQPAATMKIVHKNQVPMLQGP 700          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO48435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW1])

HSP 1 Score: 197.593 bits (501), Expect = 7.341e-54
Identity = 131/352 (37.22%), Postives = 186/352 (52.84%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIAN--VRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYT-DESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVF--NNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFG-PQSFNDGKLEVVGL-TAASLATLQVG-------GHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQII 2764
            VF N KSG N G +L++ F+ +LNP QV D+ +  P   LE    +     R+LVCGGDG+VGWV+  +D + +  SP I ILPLGTGNDLAR   WGSGY  +E  + +++ + +  +  LDRW +                       T E +    V K P   +  NNYFS+G DA   L FH  RE+ P  F SRL NK  Y   G +DVL++  K+L + + L  D  D    + +++   ++ LNI  + GG   W + +   G P + +DG LEVVGL ++  +A LQV        G A +I   +NA     K +P+QVDGEP    P  I+I+HH  A ++
Sbjct:  207 VFANCKSGDNDGERLLQAFRGVLNPVQVIDLHEVPPETALEFCRLLPGHRCRVLVCGGDGSVGWVLDALDKVKLKLSPYIGILPLGTGNDLARVLGWGSGYAGEEDANDVLNSILKADVTELDRWKV-----------------------TVECAGFLGVRK-PRKTYSMNNYFSVGCDAKVVLNFHRHRESQPTLFTSRLFNKAMYGVYGARDVLQQECKNLHEMVELELD--DKKVELPDLEG--IVILNISSWCGGCDMWNSCSDDDGRPPTASDGLLEVVGLYSSLHIARLQVSLADPHRIGQAHKIKASENA-----KHLPVQVDGEPWEQAPCVITITHHNQALML 525          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO34591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX6])

HSP 1 Score: 194.512 bits (493), Expect = 8.752e-51
Identity = 120/337 (35.61%), Postives = 178/337 (52.82%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLA---IFPSPPIAILPLGTGNDLARATHWGSGYT--DESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWG-NPAGGFGPQSFNDGKLEVVGLTAA-SLATLQVGGHAD-RICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISI 2737
            VF+N KSGG  G  ++  FQ LLNP QV+++ D GP  GL  F  +   RIL+CGGDGTVGWV+S +D ++    +  PP AI+PLGTGND++R   WGSGY+  D  LS +I+ V+  ++  LDRW +          +  +  ++    G  E+ N        + V NNY  +G DA   L+FH  RE  PEKF SRL+NK  Y  +G + +  ++     + + +  DG     +++      ++ LNI  ++ G   WG +    F P S+ D  +EVVGLT    +  +Q G  +  R+ Q     +     IP+Q+DGEP    P  + I
Sbjct:  542 VFVNCKSGGGQGDDILSAFQRLLNPHQVYNLMDGGPLPGLYAFKDLPRFRILICGGDGTVGWVLSCLDDVSTALTYKKPPSAIVPLGTGNDMSRVLQWGSGYSSGDTPLSLLIA-VDHAEVVHLDRWFVMFDSVDSLSDMKSNVSAIGLTAGREEEPN--------MFVMNNYLGIGIDADLCLDFHLRREEAPEKFTSRLRNKGVYFRVGLRKMANKTKWVFSEEVEIEVDG----EKLQLPTLEGIVILNIGSWAAGADLWGPDKDDEFRPSSYCDCLVEVVGLTGVMQMGQIQSGIRSGVRLAQGAQINIKLKCEIPVQIDGEPWMQSPGNVII 865          
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Match: EDO28107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7E3])

HSP 1 Score: 138.272 bits (347), Expect = 5.960e-38
Identity = 74/157 (47.13%), Postives = 91/157 (57.96%), Query Frame = 2
Query: 1868 LELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLA--STPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNS 2332
            LEL+ K+ NVR+L CGGDGTVGW++SE+D L   P PP+AILPLGTGNDL+RA +WG      +L  ++   E G++     W  A      +C                   + NP      PLNV NNYFSLG DA   LEFHESREA+P KFNS
Sbjct:    1 LELYRKVPNVRLLACGGDGTVGWILSELDKLKFNPRPPVAILPLGTGNDLSRALNWGGVSKTANLFNLLRISELGRL-----WKTALIVVVRRC------------------NEGNP-----LPLNVMNNYFSLGFDAEVCLEFHESREAHPAKFNS 129          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: ENSORLT00000021009.2 (diacylglycerol kinase iota [Source:NCBI gene;Acc:101166178])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 315/739 (42.63%), Postives = 437/739 (59.13%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSAT--SDRFFRIAKDKESVHFLMDICLEDLYVLDPKLP 3172
            ++  +W+ +A N  HLW++T+ SG+ CYL E+ C     K   +RKC++CK+++H  C+  L+     C+PTFRE G R  RD     + LRHHWVHR+RQ+GKCKQCGKSFQ KF  +SKEI+A+ CSWCK  +HNK  CF    + E CS G H   I+PPSWIIK+   +++ K+S R+ +      R++   +S + P    P  + SP              ++K I                            LVF+NPKSGGN G KL++ F W+LNPRQVFD++  G R  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+A+LPLGTGNDLAR  +WG GYTDE +SK++  VE+G +  LDRWNL           S ++ S Q ++GT          K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGN      F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT KT+P+QVDGEPCRL PS + IS    A ++ K KRR+S+PLL++      R             L+L V  I L +Y+    +K+++ + +    ++   G  +L   R  I ++   +           S+      +F      E +HF+ +IC E++++LD + P
Sbjct:  132 RTCVDWTENAVNGDHLWMETSCSGELCYLGEDACLLKTAKSAPRRKCAACKIVVHSGCMEQLEKINFRCKPTFREGGSRCLRD-----NVLRHHWVHRRRQEGKCKQCGKSFQQKF-FHSKEIIAISCSWCKLAFHNKVTCFMLHQIEEPCSLGAHAGVIVPPSWIIKVRKPQSSLKNSARRKKRTSFKRRTSKKGESKWRPFMLKP--LPSP--------------LMKPI----------------------------LVFVNPKSGGNQGAKLLQMFMWILNPRQVFDLSQGGLREALELYRKVPNLRILACGGDGTVGWILSALDELQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKVLCHVEDGSVVQLDRWNL-----------SVEKSSPQPEEGT---------QKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVRVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNTGDHRDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVILTTYKTVPVQVDGEPCRLAPSTLRISLRNQANMVQKSKRRTSVPLLNDPHAVPDR-------------LRLRVNRISLQEYDRLQFDKERLRDVSIPVGIVVVRGDCDLETCRLYIDRLQEVSLRPSHPSALRPSSLLPLHHYF-----MEHLHFVTEICQEEVFILDHEGP 782          

HSP 2 Score: 53.1434 bits (126), Expect = 2.455e-6
Identity = 43/118 (36.44%), Postives = 61/118 (51.69%), Query Frame = 2
Query: 3500 AKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPS-QLTDDLQLMQFL 3850
            A  L A  S  +  +   V  G   L  D EG S LH A  NG+  +V Y++      LL+L D   G TA+HKAA+    ++C LL+ AGASL   +   +TP+ Q  +D +L  +L
Sbjct:  815 AALLTAAVSGDLPTLSECVQRGVSLLVRDAEGCSALHIAAQNGHTDLVRYILQQGSKVLLDLTDREKGDTALHKAASEKQHAVCRLLVEAGASLEKTNFQGKTPADQAQEDAELSNYL 932          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: ENSORLT00000046210.1 (diacylglycerol kinase iota [Source:NCBI gene;Acc:101166178])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 319/765 (41.70%), Postives = 440/765 (57.52%), Query Frame = 2
Query:  992 KSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTE---------SGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATS-------------------DRFFRIAKDKESVHFLMDICLEDLYVLDPKLP 3172
            ++  +W+ +A N  HLW++T+ SG+ CYL E+ C     K   +RKC++CK+++H  C+  L+     C+PTFRE G R  RD     + LRHHWVHR+RQ+GKCKQCGKSFQ KF  +SKEI+A+ CSWCK  +HNK  CF    + E CS G H   I+PPSWIIK+   +++ K+S R+ +      R++   +S + P    P  + SP              ++K I                            LVF+NPKSGGN G KL++ F W+LNPRQVFD++  G R  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+A+LPLGTGNDLAR  +WG GYTDE +SK++  VE+G +  LDRWNL           S ++ S Q ++GT          K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGN      F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT KT+P+QVDGEPCRL PS + IS    A ++ K KRR+S+PLL++      R             L+L V  I L +Y+    +K+++ +  K   +             G    +A+   I+ +  D C L+    +ID                         +F      E +HF+ +IC E++++LD + P
Sbjct:  132 RTCVDWTENAVNGDHLWMETSCSGELCYLGEDACLLKTAKSAPRRKCAACKIVVHSGCMEQLEKINFRCKPTFREGGSRCLRD-----NVLRHHWVHRRRQEGKCKQCGKSFQQKF-FHSKEIIAISCSWCKLAFHNKVTCFMLHQIEEPCSLGAHAGVIVPPSWIIKVRKPQSSLKNSARRKKRTSFKRRTSKKGESKWRPFMLKP--LPSP--------------LMKPI----------------------------LVFVNPKSGGNQGAKLLQMFMWILNPRQVFDLSQGGLREALELYRKVPNLRILACGGDGTVGWILSALDELQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKVLCHVEDGSVVQLDRWNL-----------SVEKSSPQPEEGT---------QKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVRVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNTGDHRDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVILTTYKTVPVQVDGEPCRLAPSTLRISLRNQANMVQKSKRRTSVPLLNDPHAVPDR-------------LRLRVNRISLQEYDRLQFDKERLRDVCKPARLRATLPPPAGRGCHGVCVFAAIPVGIVVVRGD-CDLETCRLYIDRLQEVSLRPSHPSALRPSSLLPLHHYF-----MEHLHFVTEICQEEVFILDHEGP 807          

HSP 2 Score: 53.1434 bits (126), Expect = 2.330e-6
Identity = 43/118 (36.44%), Postives = 61/118 (51.69%), Query Frame = 2
Query: 3500 AKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPS-QLTDDLQLMQFL 3850
            A  L A  S  +  +   V  G   L  D EG S LH A  NG+  +V Y++      LL+L D   G TA+HKAA+    ++C LL+ AGASL   +   +TP+ Q  +D +L  +L
Sbjct:  840 AALLTAAVSGDLPTLSECVQRGVSLLVRDAEGCSALHIAAQNGHTDLVRYILQQGSKVLLDLTDREKGDTALHKAASEKQHAVCRLLVEAGASLEKTNFQGKTPADQAQEDAELSNYL 957          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkzb (diacylglycerol kinase zeta [Source:NCBI gene;Acc:101171163])

HSP 1 Score: 474.937 bits (1221), Expect = 6.133e-148
Identity = 274/707 (38.76%), Postives = 377/707 (53.32%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDT----------------------------CM-----------------LDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAA 3730
            VF+NPKSGGN G K+++ F W LNPRQVFD+T  GP+ GLEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE ++KI+S VE+G I  LDRWNL    N   R   K+E                   K P++VFNNYFSLG DA   L FHESREANPEKFNSR KNK+FYAG    D L  S KDL  +I +VCDG D T +++EMK   LLFLNI RY  GT PWG+P+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+   +TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR S+P L++              Q   + L++ V  I L  YE    + D++ EA+    ++T  G S+L   R +I ++ S+                             C                  L   + F+D  T+DRF+RI + +E ++++ +I LE+LY+LDP+L    +         G   S  D + +E   ++             F           R         S+D+  +     L       ++  KE+   +++             +   +  +++ ++     GAD L  D +G + LHYAV  G+  +V YLI++ P + L+  D  +G T +HKAAA
Sbjct:  291 VFVNPKSGGNQGAKIIQSFMWYLNPRQVFDLTKGGPKEGLELYSKVPNLRILACGGDGTVGWILSVLDQLNLRPQPPVAILPLGTGNDLARTLNWGGGYTDEPITKILSHVEDGNIVQLDRWNLEVEANPEARPEEKEEHQ---------------TDKLPIDVFNNYFSLGFDAHVTLGFHESREANPEKFNSRFKNKMFYAGTAFSDFLSGSSKDLAKHIKVVCDGNDLTAKVQEMKLQCLLFLNIPRYCAGTTPWGHPSEHQDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLHQCKEVTLTTFKSIPMQVDGEPCKLAPSIIRISLRNQANMVQKAKRRISMPHLND-------------QQPVPEKLQIRVNRISLAAYEALHYDMDQLKEASALLGVITVPGDSDLETCRLHIERLQSNLEQGISEDVARCDNDQEEEEEKSKQERTPCQTLKAEDDVKEESPSSQKLSSKWCFLDCTTADRFYRIDRAQEHLNYVTEISLEELYILDPELVVKET--------VGTSPSMPDLVDSEEPQEQF-----------AFPSSPPSPTSASRMVECRRRRVSSDSEMSSVLTPLCRSTAATSQNAKEVSSDEEL-------------ISCIRDKNLSKLKELHQQGADLLLQDPDGCTLLHYAVKAGDKDIVKYLIDNVPTSHLDTADSETGATVLHKAAA 937          

HSP 2 Score: 181.8 bits (460), Expect = 4.702e-46
Identity = 80/169 (47.34%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  995 SVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            S  +WS +AQ   H+W + + SGDFCY+ E  C     +K  A++KC+ CK+ +H  C+  L+     C+P+FRE   R      K+   +RHHWVHR+RQ GKC+QCGK FQ KF+ +SKEIVA+ CSWCK  YHNK  CF    + E CS G H   IIPP+WII++
Sbjct:   74 STIDWSENAQYGEHIWFEASVSGDFCYVGEQSCIAKSQQKSVARKKCAGCKICVHVTCMEQLEKINFRCKPSFREPASRAV----KEASVVRHHWVHRRRQTGKCRQCGKGFQQKFSFHSKEIVAISCSWCKQAYHNKVTCFMLQQIEECCSLGAHAAVIIPPTWIIRV 238          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: dgkzb (diacylglycerol kinase zeta [Source:NCBI gene;Acc:101171163])

HSP 1 Score: 452.595 bits (1163), Expect = 2.607e-139
Identity = 272/719 (37.83%), Postives = 382/719 (53.13%), Query Frame = 2
Query: 1751 VFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPA--GGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDT----------------------------CM-----------------LDKSFTFIDSATSDRFFRIAKDKESVH----------FLMD--ICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAA 3730
            VF+NPKSGGN G K+++ F W LNPRQVFD+T  GP+ GLEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+AILPLGTGNDLAR  +WG GYTDE ++KI+S VE+G I  LDRWNL    N   R   K+E                   K P++VFNNYFSLG DA   L FHESREANPEKFNSR KNK+FYAG    D L  S KDL  +I +VCDG D T +++EMK   LLFLNI RY  GT PWG+P+    F PQ  +DG +EV+G T  SLATLQVGGH +R+ QC+   +TT K+IPMQVDGEPC+L PS I IS    A ++ K KRR S+P L++              Q   + L++ V  I L  YE    + D++ EA+    ++T  G S+L   R +I ++ S+                             C                  L   + F+D  T+DRF+RI + +E ++          +++D  + +++     P +P  +   E +          + +  +     R +  S ++   +V T       K I    N H  +SN   +A S   ++      ++  KE+   +++             +   +  +++ ++     GAD L  D +G + LHYAV  G+  +V YLI++ P + L+  D  +G T +HKAAA
Sbjct:  291 VFVNPKSGGNQGAKIIQSFMWYLNPRQVFDLTKGGPKEGLELYSKVPNLRILACGGDGTVGWILSVLDQLNLRPQPPVAILPLGTGNDLARTLNWGGGYTDEPITKILSHVEDGNIVQLDRWNLEVEANPEARPEEKEEHQ---------------TDKLPIDVFNNYFSLGFDAHVTLGFHESREANPEKFNSRFKNKMFYAGTAFSDFLSGSSKDLAKHIKVVCDGNDLTAKVQEMKLQCLLFLNIPRYCAGTTPWGHPSEHQDFEPQRHDDGCIEVIGFTMTSLATLQVGGHGERLHQCKEVTLTTFKSIPMQVDGEPCKLAPSIIRISLRNQANMVQKAKRRISMPHLND-------------QQPVPEKLQIRVNRISLAAYEALHYDMDQLKEASALLGVITVPGDSDLETCRLHIERLQSNLEQGISEDVARCDNDQEEEEEKSKQERTPCQTLKAEDDVKEESPSSQKLSSKWCFLDCTTADRFYRIDRAQEHLNYVTEISLEELYILDPELVVKETVGTSPSMPDLVDSEEPQEQFAFPSSPPSPTSASRMVECRRRRVSSDSEMSSVLTPLCRRGAKII----NVH--RSNTTLAAFSP--IIRSTAATSQNAKEVSSDEEL-------------ISCIRDKNLSKLKELHQQGADLLLQDPDGCTLLHYAVKAGDKDIVKYLIDNVPTSHLDTADSETGATVLHKAAA 960          

HSP 2 Score: 181.8 bits (460), Expect = 4.216e-46
Identity = 80/169 (47.34%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  995 SVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVC-----EKGGAKRKCSSCKLIIHQLCIPHLQ---LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKM 1477
            S  +WS +AQ   H+W + + SGDFCY+ E  C     +K  A++KC+ CK+ +H  C+  L+     C+P+FRE   R      K+   +RHHWVHR+RQ GKC+QCGK FQ KF+ +SKEIVA+ CSWCK  YHNK  CF    + E CS G H   IIPP+WII++
Sbjct:   74 STIDWSENAQYGEHIWFEASVSGDFCYVGEQSCIAKSQQKSVARKKCAGCKICVHVTCMEQLEKINFRCKPSFREPASRAV----KEASVVRHHWVHRRRQTGKCRQCGKGFQQKFSFHSKEIVAISCSWCKQAYHNKVTCFMLQQIEECCSLGAHAAVIIPPTWIIRV 238          
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Match: ENSORLT00000033759.1 (diacylglycerol kinase iota [Source:NCBI gene;Acc:101166178])

HSP 1 Score: 426.402 bits (1095), Expect = 1.417e-133
Identity = 230/517 (44.49%), Postives = 309/517 (59.77%), Query Frame = 2
Query: 1409 LTEECSRGQHYDSIIPPSWIIKMAT-KNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAG--GFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAK 2950
            + E CS G H   I+PPSWIIK+   +++ K+S R+ +      R++   +S + P    P  + SP              ++K I                            LVF+NPKSGGN G KL++ F W+LNPRQVFD++  G R  LEL+ K+ N+RIL CGGDGTVGW++S +D L + P PP+A+LPLGTGNDLAR  +WG GYTDE +SK++  VE+G +  LDRWNL           S ++ S Q ++GT          K PL+VFNNYFSLG DA   LEFHESREANPEKFNSR +NK+FYAG    D L+RS +DL  ++ +VCDG D TP+I+E+K   ++FLNI RY  GT PWGN      F PQ  +DG +EV+G T ASLA LQVGGH +R+ QC+  ++TT KT+P+QVDGEPCRL PS + IS    A ++ K KRR+S+PLL++      R             L+L V  I L +Y+    +K+++ +  K
Sbjct:    5 IEEPCSLGAHAGVIVPPSWIIKVRKPQSSLKNSARRKKRTSFKRRTSKKGESKWRPFMLKP--LPSP--------------LMKPI----------------------------LVFVNPKSGGNQGAKLLQMFMWILNPRQVFDLSQGGLREALELYRKVPNLRILACGGDGTVGWILSALDELQMNPQPPVAVLPLGTGNDLARTLNWGGGYTDEPVSKVLCHVEDGSVVQLDRWNL-----------SVEKSSPQPEEGT---------QKLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVRVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNTGDHRDFEPQRHDDGCIEVIGFTMASLAALQVGGHGERLHQCREVILTTYKTVPVQVDGEPCRLAPSTLRISLRNQANMVQKSKRRTSVPLLNDPHAVPDR-------------LRLRVNRISLQEYDRLQFDKERLRDVCK 444          

HSP 2 Score: 52.7582 bits (125), Expect = 2.787e-6
Identity = 43/118 (36.44%), Postives = 61/118 (51.69%), Query Frame = 2
Query: 3500 AKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPS-QLTDDLQLMQFL 3850
            A  L A  S  +  +   V  G   L  D EG S LH A  NG+  +V Y++      LL+L D   G TA+HKAA+    ++C LL+ AGASL   +   +TP+ Q  +D +L  +L
Sbjct:  541 AALLTAAVSGDLPTLSECVQRGVSLLVRDAEGCSALHIAAQNGHTDLVRYILQQGSKVLLDLTDREKGDTALHKAASEKQHAVCRLLVEAGASLEKTNFQGKTPADQAQEDAELSNYL 658          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000051710.1 (SMESG000051710.1)

HSP 1 Score: 2537.68 bits (6576), Expect = 0.000e+0
Identity = 1255/1262 (99.45%), Postives = 1256/1262 (99.52%), Query Frame = 2
Query:  119 MLTGLKNKAIMKEFSLNQTAFSKRFERKQKLISKSKTQTLDLPEEKHLPTLIIEPSSDGEEIHDGIIESITNFKLKSRSHSYTNNESVDKTSPSTPDPIEDFAQTKIMKHYFRRRGKSVDIPKPCIHCILVEKYASNLGFCQLLEDELYDKTLENYLTMSETSSNIPRPNDKNKERNETMTMKDQPFIPNSSPSSDKLSHFLQVPEQKDANINSKPRSQSIDQIIDYLSLDKQNLSVEFLMTSNNKPRAVSIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            MLTGLKNKAIMKEFSLNQTAFSKRFERKQKLISKSKTQTLDLPEEKHLPTLIIEPSSDGEEIHDGIIESITNFKLKSRSHSYTNNESVDKTSPSTPDPIEDFAQTKIMKHYFRRRGKSVDIPKPCIHCILVEKYASNL FCQLLEDELYDKTLENYLTMSETSSNIPRPNDKNKERNETM MKDQPFIPNSSPSSDKLSHFLQVPEQKD NINSKPRSQSIDQIIDYLSLDKQNLSVEFLMTSNNKPRAVSIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDS FIPKPANPDNISSPSKL IDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISE+GDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSND SSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI
Sbjct:    1 MLTGLKNKAIMKEFSLNQTAFSKRFERKQKLISKSKTQTLDLPEEKHLPTLIIEPSSDGEEIHDGIIESITNFKLKSRSHSYTNNESVDKTSPSTPDPIEDFAQTKIMKHYFRRRGKSVDIPKPCIHCILVEKYASNLAFCQLLEDELYDKTLENYLTMSETSSNIPRPNDKNKERNETMKMKDQPFIPNSSPSSDKLSHFLQVPEQKDVNINSKPRSQSIDQIIDYLSLDKQNLSVEFLMTSNNKPRAVSIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSTFIPKPANPDNISSPSKLHIDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISERGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDTSSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI 1262          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000051710.1 (SMESG000051710.1)

HSP 1 Score: 2008.42 bits (5202), Expect = 0.000e+0
Identity = 997/1001 (99.60%), Postives = 998/1001 (99.70%), Query Frame = 2
Query:  902 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDS FIPKPANPDNISSPSKL IDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISE+GDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSND SSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI
Sbjct:   13 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSTFIPKPANPDNISSPSKLHIDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISERGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDTSSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI 1013          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000051710.1 (SMESG000051710.1)

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 636/648 (98.15%), Postives = 638/648 (98.46%), Query Frame = 2
Query:  902 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKKSGRSFEEDF 2845
            KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDS FIPKPANPDNISSPSKL IDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLS+C K +     E F
Sbjct:   13 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSTFIPKPANPDNISSPSKLHIDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSDCGKSTSFDRHEYF 660          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000051710.1 (SMESG000051710.1)

HSP 1 Score: 1288.09 bits (3332), Expect = 0.000e+0
Identity = 632/635 (99.53%), Postives = 633/635 (99.69%), Query Frame = 2
Query:  902 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQIDDNISEHITMIKSISLQSTFGITNHIPFVXXXXXXXXXXXXXXVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSE 2806
            KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDS FIPKPANPDNISSPSKL IDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLS+
Sbjct:   13 KSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSIDAQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQLPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKFTINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWIIKMATKNNFKSSVRKSRSPDTMTRSALPQDSTFIPKPANPDNISSPSKLHIDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPKSGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGGDGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSKIISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPAVSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIGGKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQPWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVTTIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSD 647          
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Match: SMESG000051710.1 (SMESG000051710.1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 357/359 (99.44%), Postives = 358/359 (99.72%), Query Frame = 2
Query: 2828 SFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKXXXXXXXXXXXXXXXKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI 3904
            SFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISE+GDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSND SSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI
Sbjct:   12 SFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMTESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVHFLMDICLEDLYVLDPKLPSNLSPIEGRISERGDIYSSADSIYNEATADRVQPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDTSSAESSAHLVNQKHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGADPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIHKAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEIIMKIENDPRKINI 370          
The following BLAST results are available for this feature:
BLAST of Diacylglycerol kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKI0.000e+042.88diacylglycerol kinase iota [Source:HGNC Symbol;Acc... [more]
DGKI0.000e+043.37diacylglycerol kinase iota [Source:HGNC Symbol;Acc... [more]
DGKI0.000e+042.95diacylglycerol kinase iota [Source:HGNC Symbol;Acc... [more]
DGKI0.000e+042.95diacylglycerol kinase iota [Source:HGNC Symbol;Acc... [more]
DGKZ2.141e-14446.80diacylglycerol kinase zeta [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgk-57.417e-15738.67Putative diacylglycerol kinase K06A1.6 [Source:Un... [more]
dgk-52.262e-15638.67Putative diacylglycerol kinase K06A1.6 [Source:Un... [more]
dgk-55.987e-15638.67Putative diacylglycerol kinase K06A1.6 [Source:Un... [more]
dgk-51.365e-15538.67Putative diacylglycerol kinase K06A1.6 [Source:Un... [more]
dgk-53.522e-15438.62Putative diacylglycerol kinase K06A1.6 [Source:Un... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdgA0.000e+036.34gene:FBgn0261549 transcript:FBtr0302662[more]
rdgA0.000e+036.06gene:FBgn0261549 transcript:FBtr0302664[more]
rdgA0.000e+036.23gene:FBgn0261549 transcript:FBtr0302661[more]
rdgA0.000e+036.23gene:FBgn0261549 transcript:FBtr0302663[more]
rdgA4.007e-12337.03gene:FBgn0261549 transcript:FBtr0333602[more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgkzb0.000e+037.86diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB... [more]
DGKI0.000e+044.32diacylglycerol kinase, iota [Source:NCBI gene;Acc:... [more]
dgkza2.484e-15439.15diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB... [more]
dgkza3.146e-15338.64diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB... [more]
dgkza6.759e-15338.64diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DGKZ1.324e-15539.84diacylglycerol kinase, zeta [Source:NCBI gene;Acc:... [more]
DGKZ3.525e-15539.84diacylglycerol kinase, zeta [Source:NCBI gene;Acc:... [more]
DGKZ1.392e-15439.04diacylglycerol kinase, zeta [Source:NCBI gene;Acc:... [more]
DGKZ3.136e-15439.04diacylglycerol kinase, zeta [Source:NCBI gene;Acc:... [more]
DGKZ3.819e-15439.04diacylglycerol kinase, zeta [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dgki0.000e+043.32diacylglycerol kinase, iota [Source:MGI Symbol;Acc... [more]
Dgki0.000e+042.88diacylglycerol kinase, iota [Source:MGI Symbol;Acc... [more]
Dgki0.000e+043.52diacylglycerol kinase, iota [Source:MGI Symbol;Acc... [more]
Dgkz2.542e-642.51diacylglycerol kinase zeta [Source:MGI Symbol;Acc:... [more]
Dgkz2.171e-642.51diacylglycerol kinase zeta [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Diacylglycerol kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08560|DGKZ_RAT7.325e-642.65Diacylglycerol kinase zeta OS=Rattus norvegicus OX... [more]
sp|Q80UP3|DGKZ_MOUSE0.000e+042.51Diacylglycerol kinase zeta OS=Mus musculus OX=1009... [more]
sp|O75912|DGKI_HUMAN0.000e+042.95Diacylglycerol kinase iota OS=Homo sapiens OX=9606... [more]
sp|Q10024|DGK5_CAEEL2.877e-15538.67Putative diacylglycerol kinase K06A1.6 OS=Caenorha... [more]
sp|Q13574|DGKZ_HUMAN3.625e-13946.80Diacylglycerol kinase zeta OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Diacylglycerol kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K5740.000e+044.15Diacylglycerol kinase OS=Lingula unguis OX=7574 GN... [more]
A0A1S3K5J50.000e+042.97Diacylglycerol kinase OS=Lingula unguis OX=7574 GN... [more]
A0A1S3K5690.000e+049.26Diacylglycerol kinase OS=Lingula unguis OX=7574 GN... [more]
A0A1S3K5750.000e+049.26Diacylglycerol kinase OS=Lingula unguis OX=7574 GN... [more]
A0A1S3K5S60.000e+049.26Diacylglycerol kinase OS=Lingula unguis OX=7574 GN... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgkzb0.000e+038.61diacylglycerol kinase zeta [Source:NCBI gene;Acc:1... [more]
dgkzb0.000e+038.70diacylglycerol kinase zeta [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000017589.29.617e-16643.10pep primary_assembly:Astyanax_mexicanus-2.0:7:8274... [more]
dgkza9.271e-12949.65diacylglycerol kinase, zeta a [Source:ZFIN;Acc:ZDB... [more]
dgkab6.018e-7529.74diacylglycerol kinase beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dgkzb6.820e-13357.71diacylglycerol kinase, zeta b [Source:ZFIN;Acc:ZDB... [more]
ENSPMAT00000002929.11.279e-8031.53pep scaffold:Pmarinus_7.0:GL476935:158222:277059:-... [more]
ENSPMAT00000009725.12.249e-6328.52pep scaffold:Pmarinus_7.0:GL478043:6842:50807:-1 g... [more]
DGKI7.992e-6155.14diacylglycerol kinase iota [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000007068.14.919e-5937.98pep scaffold:Pmarinus_7.0:GL477921:19741:38299:1 g... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382870.000e+036.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425102.486e-8633.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484357.341e-5437.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345918.752e-5135.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281075.960e-3847.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diacylglycerol kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021009.22.455e-642.63diacylglycerol kinase iota [Source:NCBI gene;Acc:1... [more]
ENSORLT00000046210.12.330e-641.70diacylglycerol kinase iota [Source:NCBI gene;Acc:1... [more]
dgkzb6.133e-14838.76diacylglycerol kinase zeta [Source:NCBI gene;Acc:1... [more]
dgkzb2.607e-13937.83diacylglycerol kinase zeta [Source:NCBI gene;Acc:1... [more]
ENSORLT00000033759.11.417e-13344.49diacylglycerol kinase iota [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diacylglycerol kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051710.10.000e+099.45SMESG000051710.1[more]
SMESG000051710.10.000e+099.60SMESG000051710.1[more]
SMESG000051710.10.000e+098.15SMESG000051710.1[more]
SMESG000051710.10.000e+099.53SMESG000051710.1[more]
SMESG000051710.10.000e+099.44SMESG000051710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018866 ID=SMED30018866|Name=Diacylglycerol kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3964bp
CTCGTTTTAGTATTTAAATTGATGGCTGCTATTAAAATACTACTTTCAAA
CTAAACTCTGTACCAGAGACTCAGTAAAATTTGTAATTTTTCCCATGTGA
TTACCTACTGCAATCAGAATGCTAACTGGGCTGAAAAACAAAGCGATTAT
GAAAGAATTCTCACTCAACCAAACGGCATTCAGCAAAAGATTTGAAAGGA
AACAGAAGCTCATTTCCAAATCTAAAACCCAGACCTTAGATTTGCCCGAA
GAGAAACATTTGCCGACTCTCATAATTGAACCGTCGAGTGATGGAGAAGA
GATTCACGATGGGATAATTGAGTCAATCACGAATTTCAAGTTGAAATCCC
GATCCCATTCCTACACTAACAATGAATCGGTCGACAAAACCAGTCCATCA
ACTCCAGACCCCATCGAAGATTTTGCTCAAACGAAAATCATGAAACACTA
TTTCCGTCGTCGAGGAAAATCAGTCGACATTCCCAAGCCTTGCATTCACT
GTATTTTAGTGGAGAAATATGCATCCAATTTGGGTTTCTGTCAATTATTG
GAAGACGAATTGTACGATAAAACTCTTGAAAACTATTTGACAATGAGTGA
AACCAGCTCGAATATCCCGCGACCTAATGATAAGAATAAGGAGAGAAATG
AGACAATGACAATGAAAGACCAACCTTTCATTCCCAATTCCAGTCCTTCC
TCCGATAAACTGTCCCATTTTCTCCAAGTGCCCGAACAGAAGGATGCCAA
TATCAATTCCAAACCTCGATCCCAATCAATTGACCAAATTATCGATTATT
TGAGTTTAGACAAACAAAACCTTTCGGTGGAATTTTTAATGACAAGCAAT
AATAAACCAAGAGCGGTTTCAATAGACTTTAATATGCCTTTTCGATTGAG
AAAATCAGCGAAATCCCTCGGCATTACAGAGCGTCAAAGCACTTTGATTA
CGGACCGAGTCCAAAATGCTGAAATCAACCAAAGCCCCCAAAAATCTGTT
CCTAACTGGTCGATAGACGCACAGAACAAGACTCATCTTTGGGTCGACAC
GAATTCTTCGGGAGATTTTTGTTATTTAAATGAAAATGTGTGCGAGAAAG
GTGGTGCTAAAAGAAAGTGTTCTTCTTGTAAATTAATAATTCATCAGCTG
TGCATTCCACATTTGCAACTTCCATGTCGCCCAACTTTCAGGGAAGCCGG
TGTTAGAGATTACAGAGACGAAAAGAAAAAAGAAGACACATTGAGACATC
ATTGGGTACATAGGAAACGACAAGATGGAAAATGTAAACAGTGCGGTAAA
TCTTTCCAAAGTAAATTCACCATCAACAGTAAAGAAATTGTTGCCGTTCA
ATGTAGTTGGTGTAAATCTCCATATCACAACAAAACTTTATGCTTTGCTA
CCTCTCTCTTAACAGAAGAATGTTCGAGAGGTCAACACTATGACAGTATT
ATCCCTCCATCATGGATAATAAAAATGGCAACGAAGAATAATTTCAAATC
TTCGGTTAGAAAATCCCGGAGTCCAGATACAATGACCCGATCTGCTTTGC
CTCAAGACTCGAATTTCATTCCAAAACCAGCTAACCCAGATAACATATCT
AGTCCATCGAAATTACAAATTGACGATAACATTTCCGAGCATATCACTAT
GATTAAGAGTATCTCATTGCAATCTACATTCGGAATTACAAACCACATTC
CTTTTGTCATTAAACCAATTCCAAATAGCCCCCCTTCAAAACCCTTGCTC
GTATTTCTTAATCCAAAATCTGGAGGAAATGCCGGAGTCAAACTGATGAG
AAAATTTCAATGGCTACTCAATCCTAGACAAGTTTTTGATATTACCGATC
GTGGACCTCGACTTGGACTGGAACTATTTGGGAAAATTGCCAACGTGAGA
ATTCTAGTCTGCGGAGGTGATGGGACTGTTGGATGGGTAATGTCCGAAAT
TGATAGTCTTGCTATTTTCCCAAGTCCACCAATAGCTATTTTACCATTGG
GTACCGGAAACGATTTGGCAAGGGCAACTCATTGGGGATCAGGCTACACA
GACGAATCATTATCTAAGATCATATCGTGTGTTGAAGAAGGGCAAATTAA
GCCACTGGATAGATGGAATCTAGCAAGTACTCCAAACCAGTGTCCTCGAA
CCATATCCAAAGATGAATTATCAATGCAAAACAAAGATGGTACTTCAGAA
CAAAGTAATCCACCTGCAGTTTCAAAATTTCCTTTAAATGTTTTTAACAA
TTATTTTTCTCTTGGGGCTGACGCAGCAACAGCTTTGGAGTTTCACGAAT
CTAGAGAAGCTAATCCTGAGAAGTTCAACAGCCGTTTAAAGAACAAGATT
TTTTACGCTGGAATTGGCGGAAAAGATGTTCTTAAAAGATCATGGAAAGA
CTTGTGTGACTACATCACATTGGTGTGTGATGGTATCGATTTCACTCCCA
GAATCAAAGAAATGAAGCCACATTTGTTGTTATTTTTAAATATACAAAGG
TATAGTGGTGGAACGCAACCTTGGGGCAATCCAGCGGGAGGATTTGGGCC
CCAGAGCTTCAATGATGGCAAACTGGAGGTTGTTGGTTTGACAGCAGCTA
GTTTGGCCACGTTACAAGTGGGAGGACACGCAGACAGGATTTGCCAGTGT
CAAAATGCCGTCGTTACAACGATCAAAACCATACCTATGCAAGTAGACGG
AGAGCCCTGTCGACTTTTACCGTCGGAAATTTCTATCTCACATCATGGAA
TCGCTCAAATTATACTTAAACCAAAGAGGCGATCATCAATTCCTTTATTG
TCTGAATGTTGTAAAAAATCTGGCCGCAGCTTTGAAGAAGATTTCAATCA
AGATTGCGATCAACTTCTCAAGTTGAGTGTTTTTGTGATTCCATTGGTAG
ATTATGAAGAAAATGCAATGGAAAAGGATAAAATTTTAGAAGCTGCTAAA
TTCTACTGCATGATGACTGAGAGTGGCAGTTCAAATTTATCGGCAGTTCG
AGATAATATTCTCAAAATGACATCTGACACTTGCATGCTGGATAAATCGT
TTACGTTTATTGATTCTGCGACATCTGATAGGTTTTTCAGAATAGCAAAG
GACAAGGAAAGCGTTCATTTTTTAATGGATATTTGTCTGGAAGATCTCTA
CGTTCTTGATCCTAAATTACCGTCAAACCTGTCACCAATAGAAGGCAGAA
TCAGTGAAAAGGGGGACATCTATTCCTCGGCTGACTCTATCTATAATGAG
GCCACCGCTGATCGAGTGCAGCCGTATTCCCTCAATGCTCCGCCAGATAA
TGTATTCACTGAAGAATTTTCTGAGAACAAAAAACAGATTCGTAAAGAAA
ATAATAACCATGAAAATAAGTCAAATGATGCAAGTTCAGCTGAAAGTAGT
GCGCATTTAGTAAATCAGAAGCATCTGGATAATAAAGAAACCAAAGAAAT
TGTATTTCCTGATCAGGTTATGAAATATAGAAGTCTTGAAGTCTTGAATG
CCAAGTTCCTCGAAGCCTGCAAGTCAATGAGTGTAACGAATGTGCAAAGT
TATGTATTTGACGGAGCAGATCCCTTGACAGTCGATAAGGAAGGTTTATC
CGGTCTTCACTATGCAGTTATGAATGGAAATATTAGTGTGGTACACTATC
TCATCAATGACGCTCCTGGAAATTTGTTGGAATTGAAAGATTATATCTCT
GGTCAAACGGCAATTCATAAAGCTGCTGCTATTGGCCACAAATCTATTTG
TTCTTTGCTCATATCAGCCGGTGCTTCTCTTTTAGCAAAAGATAATTCCA
ACAGAACTCCATCACAATTAACCGATGATCTTCAACTGATGCAATTTTTG
CAAAAAGAGGAAATTATCATGAAAATTGAAAATGATCCAAGAAAAATTAA
CATTTAATTTTCACAAATTAGAATAGTTCACCAATCAAAGGAGGAGAGAC
ACTTTCAAATAGAT
back to top

protein sequence of SMED30018866-orf-1

>SMED30018866-orf-1 ID=SMED30018866-orf-1|Name=SMED30018866-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1263bp
MLTGLKNKAIMKEFSLNQTAFSKRFERKQKLISKSKTQTLDLPEEKHLPT
LIIEPSSDGEEIHDGIIESITNFKLKSRSHSYTNNESVDKTSPSTPDPIE
DFAQTKIMKHYFRRRGKSVDIPKPCIHCILVEKYASNLGFCQLLEDELYD
KTLENYLTMSETSSNIPRPNDKNKERNETMTMKDQPFIPNSSPSSDKLSH
FLQVPEQKDANINSKPRSQSIDQIIDYLSLDKQNLSVEFLMTSNNKPRAV
SIDFNMPFRLRKSAKSLGITERQSTLITDRVQNAEINQSPQKSVPNWSID
AQNKTHLWVDTNSSGDFCYLNENVCEKGGAKRKCSSCKLIIHQLCIPHLQ
LPCRPTFREAGVRDYRDEKKKEDTLRHHWVHRKRQDGKCKQCGKSFQSKF
TINSKEIVAVQCSWCKSPYHNKTLCFATSLLTEECSRGQHYDSIIPPSWI
IKMATKNNFKSSVRKSRSPDTMTRSALPQDSNFIPKPANPDNISSPSKLQ
IDDNISEHITMIKSISLQSTFGITNHIPFVIKPIPNSPPSKPLLVFLNPK
SGGNAGVKLMRKFQWLLNPRQVFDITDRGPRLGLELFGKIANVRILVCGG
DGTVGWVMSEIDSLAIFPSPPIAILPLGTGNDLARATHWGSGYTDESLSK
IISCVEEGQIKPLDRWNLASTPNQCPRTISKDELSMQNKDGTSEQSNPPA
VSKFPLNVFNNYFSLGADAATALEFHESREANPEKFNSRLKNKIFYAGIG
GKDVLKRSWKDLCDYITLVCDGIDFTPRIKEMKPHLLLFLNIQRYSGGTQ
PWGNPAGGFGPQSFNDGKLEVVGLTAASLATLQVGGHADRICQCQNAVVT
TIKTIPMQVDGEPCRLLPSEISISHHGIAQIILKPKRRSSIPLLSECCKK
SGRSFEEDFNQDCDQLLKLSVFVIPLVDYEENAMEKDKILEAAKFYCMMT
ESGSSNLSAVRDNILKMTSDTCMLDKSFTFIDSATSDRFFRIAKDKESVH
FLMDICLEDLYVLDPKLPSNLSPIEGRISEKGDIYSSADSIYNEATADRV
QPYSLNAPPDNVFTEEFSENKKQIRKENNNHENKSNDASSAESSAHLVNQ
KHLDNKETKEIVFPDQVMKYRSLEVLNAKFLEACKSMSVTNVQSYVFDGA
DPLTVDKEGLSGLHYAVMNGNISVVHYLINDAPGNLLELKDYISGQTAIH
KAAAIGHKSICSLLISAGASLLAKDNSNRTPSQLTDDLQLMQFLQKEEII
MKIENDPRKINI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003951NAD+ kinase activity
GO:0005515protein binding
GO:0004143diacylglycerol kinase activity
GO:0016301kinase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0035556intracellular signal transduction
GO:0007205protein kinase C-activating G-protein coupled receptor signaling pathway
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR017438ATP-NAD_kinase_N
IPR037607DGK
IPR002219PE/DAG-bd
IPR002110Ankyrin_rpt
IPR000756Diacylglycerol_kin_accessory
IPR001206Diacylglycerol_kinase_cat_dom
IPR020683Ankyrin_rpt-contain_dom
IPR016064NAD/diacylglycerol_kinase_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1064..1084
NoneNo IPR availableGENE3DG3DSA:2.60.200.40coord: 706..873
e-value: 3.6E-9
score: 38.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1084..1098
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1074..1101
NoneNo IPR availablePANTHERPTHR11255:SF93EYE-SPECIFIC DIACYLGLYCEROL KINASEcoord: 252..1027
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 1158..1188
e-value: 0.0081
score: 25.4
coord: 1194..1223
e-value: 0.033
score: 23.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 1194..1226
score: 11.808
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 1158..1180
score: 9.19
IPR001206Diacylglycerol kinase, catalytic domainSMARTSM00046dagk_c4a_7coord: 542..666
e-value: 3.1E-53
score: 192.8
IPR001206Diacylglycerol kinase, catalytic domainPFAMPF00781DAGK_catcoord: 542..652
e-value: 7.9E-26
score: 90.1
IPR001206Diacylglycerol kinase, catalytic domainPROSITEPS50146DAGKcoord: 538..672
score: 46.526
IPR000756Diacylglycerol kinase, accessory domainSMARTSM00045dagk_c4b_2coord: 708..863
e-value: 1.0E-76
score: 270.8
IPR000756Diacylglycerol kinase, accessory domainPFAMPF00609DAGK_acccoord: 708..863
e-value: 3.4E-42
score: 144.5
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 377..435
e-value: 0.0046
score: 26.2
coord: 304..353
e-value: 0.029
score: 20.2
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 377..434
e-value: 1.3E-9
score: 37.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1066..1249
e-value: 8.1E-22
score: 79.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 1142..1234
IPR017438Inorganic polyphosphate/ATP-NAD kinase, N-terminalGENE3DG3DSA:3.40.50.10330coord: 537..671
e-value: 6.6E-11
score: 43.7
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 1142..1225
e-value: 1.0E-8
score: 35.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1142..1231
score: 18.749
IPR037607Diacylglycerol kinasePANTHERPTHR11255DIACYLGLYCEROL KINASEcoord: 252..1027
IPR016064NAD kinase/diacylglycerol kinase-like domain superfamilySUPERFAMILYSSF111331NAD kinase/diacylglycerol kinase-likecoord: 538..879