DUF1619 domain-containing protein

Overview
NameDUF1619 domain-containing protein
Smed IDSMED30018865
Length (bp)1122
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF1619 domain-containing protein (SMED30018865) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF1619 domain-containing protein (SMED30018865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF1619 domain-containing protein (SMED30018865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF1619 domain-containing protein (SMED30018865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018865

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018865SMESG000057489.1 SmedASXL_008997SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018865SMESG000057489.1 SmedASXL_008998SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018865SMESG000057489.1 dd_Smed_v4_11225_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018865SMESG000057489.1 dd_Smed_v6_11225_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018865SMESG000057489.1 OX_Smed_1.0.16754ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018865SMESG000057489.1 dd_Smed_v4_11225_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Match: TCTN1 (tectonic family member 1 [Source:HGNC Symbol;Acc:HGNC:26113])

HSP 1 Score: 69.707 bits (169), Expect = 2.753e-12
Identity = 58/219 (26.48%), Postives = 95/219 (43.38%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIY-------RIASFANVSLTNLNDWVNITTTNAQLPSGD-CQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS----QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q ++M  I   + ++ Q+      +  +C +   V   +LFG  + +GC +       RL G     L A+    +         +A F N    ++ DWV I          D CQ+      E+ +++ G+      KI+ V A +  SS  P  NS     I + T V F+DV+  +    +  P +  +LP++FFFP 
Sbjct:  362 LSGNPGYVVGLPLAAGFQPHKMSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKL-------RLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHFITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTA-NLISSSFPEANSGNERTILISTAVTFVDVSAPAEAGFRAPPAINARLPFNFFFPF 572          
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Match: TCTN1 (tectonic family member 1 [Source:HGNC Symbol;Acc:HGNC:26113])

HSP 1 Score: 66.6254 bits (161), Expect = 2.723e-11
Identity = 57/219 (26.03%), Postives = 94/219 (42.92%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIY-------RIASFANVSLTNLNDWVNITTTNAQLPSGD-CQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS----QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q ++   I   + ++ Q+      +  +C +   V   +LFG  + +GC +       RL G     L A+    +         +A F N    ++ DWV I          D CQ+      E+ +++ G+      KI+ V A +  SS  P  NS     I + T V F+DV+  +    +  P +  +LP++FFFP 
Sbjct:  376 LSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKL-------RLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHFITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTA-NLISSSFPEANSGNERTILISTAVTFVDVSAPAEAGFRAPPAINARLPFNFFFPF 586          
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Match: TCTN1 (tectonic family member 1 [Source:HGNC Symbol;Acc:HGNC:26113])

HSP 1 Score: 66.6254 bits (161), Expect = 2.755e-11
Identity = 57/219 (26.03%), Postives = 94/219 (42.92%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIY-------RIASFANVSLTNLNDWVNITTTNAQLPSGD-CQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS----QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q ++   I   + ++ Q+      +  +C +   V   +LFG  + +GC +       RL G     L A+    +         +A F N    ++ DWV I          D CQ+      E+ +++ G+      KI+ V A +  SS  P  NS     I + T V F+DV+  +    +  P +  +LP++FFFP 
Sbjct:  362 LSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKL-------RLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHFITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTA-NLISSSFPEANSGNERTILISTAVTFVDVSAPAEAGFRAPPAINARLPFNFFFPF 572          
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Match: TCTN1 (tectonic family member 1 [Source:HGNC Symbol;Acc:HGNC:26113])

HSP 1 Score: 61.6178 bits (148), Expect = 9.438e-10
Identity = 56/224 (25.00%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIY-------RIASFANVSLTNLNDWVNITTTNAQLP------SGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS----QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q ++   I   + ++ Q+      +  +C +   V   +LFG  + +GC +       RL G     L A+    +         +A F N    ++ DWV I                 CQ+      E+ +++ G+      KI+ V A +  SS  P  NS     I + T V F+DV+  +    +  P +  +LP++FFFP 
Sbjct:  376 LSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKL-------RLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHFITQSFNRKHFVLQDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTA-NLISSSFPEANSGNERTILISTAVTFVDVSAPAEAGFRAPPAINARLPFNFFFPF 591          
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Match: TCTN2 (tectonic family member 2 [Source:HGNC Symbol;Acc:HGNC:25774])

HSP 1 Score: 60.8474 bits (146), Expect = 2.191e-9
Identity = 52/170 (30.59%), Postives = 85/170 (50.00%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGC--SISSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLND-WVNITTTNAQLPSGD---------C-QIVTTRTYEIMYSRTGTTQYL-HNKIIGVRAQSTYSSV 742
            LSGN GY++GKP+ RA+  N+M N+ T  L  WQ  +G    +S+T + ILFG+N+++GC   +     C +L+   N     +S +    +A   N    +L+D W+ I   +A  P  D         C  I    +  I+ S  G  + +   +I+GV  ++ +SSV
Sbjct:  432 LSGNPGYQLGKPV-RALNINRMNNVTT--LHLWQ-SAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLR--ENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGV--ETRFSSV 593          
BLAST of DUF1619 domain-containing protein vs. Ensembl Zebrafish
Match: tctn1 (tectonic family member 1 [Source:ZFIN;Acc:ZDB-GENE-081104-157])

HSP 1 Score: 71.633 bits (174), Expect = 3.093e-13
Identity = 61/222 (27.48%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  263 TGFVLSGNRGYEIGKPIMRAIQN-NQMLNIA--TDSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSI--SSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQ-----------STYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            TG   SGN GY +G+P++   +  N ++  A    SL   Q     +C   SS    +LFG N ++GC++  S    C ++  +    L  +S      +ASF N    N  DWV I      L +  C I  +   E+ +++ G       +I+ +              ++   +LPVT+S       V+F+DV+  +    K+ P +  KLP+DFFFP 
Sbjct:  321 TGLKYSGNPGYVLGRPLVAGTRTANGIVQFADPKGSLTTIQTSVDQDCLRGSSRRSPVLFGINTISGCTLKLSDGVNCSQVSEVILWALKGQSFPD--HVASFGNSLPQNSLDWVPIQNQTISLGAQACSIPLSYHLEVKWTKYGALLNPQAQIVSIMETIITNTSSLAFITSPGGLLPVTSS-------VSFVDVSASATPGFKVPPTIDAKLPFDFFFPF 533          
BLAST of DUF1619 domain-containing protein vs. Ensembl Xenopus
Match: ap3s2 (adaptor related protein complex 3 subunit sigma 2 [Source:Xenbase;Acc:XB-GENE-5734699])

HSP 1 Score: 77.0258 bits (188), Expect = 1.172e-14
Identity = 61/220 (27.73%), Postives = 100/220 (45.45%), Query Frame = 2
Query:  272 VLSGNRGYEIGKPIMRAIQNNQMLNIATDS----LQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLP---SGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNSQ----INLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFP 874
            +LSGN GY +G P++   +  Q   +   +    L   +  +G NC         +LFG N+++GC +     C          + A + L + R       +ASF N    N+ DWV IT   + LP   + DC+I  +   E+ +++ G+      +I+ V  + TY+ V   TNS     + + T V F+DV+  +    K  P +   LP+DFF P
Sbjct:  482 LLSGNPGYIVGLPVIAGFKEPQYPFLVNTNRFAQLTILRSSAGQNCLTEEGNRAAVLFGYNMVSGCKLQYPVPCQ---------VAATAILNVLRGQQFPEYVASFGNSQPQNVLDWVPITVVTSTLPQSATADCKIPVSLDLEVRWTKYGSLVNPQAQIVNVTEKITYAFVQ-NTNSGSGNVLQISTSVTFLDVSAPAQPGYKAPPTIDATLPFDFFRP 691          
BLAST of DUF1619 domain-containing protein vs. Ensembl Xenopus
Match: tctn2 (tectonic family member 2 [Source:NCBI gene;Acc:733954])

HSP 1 Score: 49.2914 bits (116), Expect = 7.786e-6
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSIS-SQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNI 595
            LSGN GY++GKP++ A  N     +    +  W+  S + C S++ V   LFGQN  +GC ++ ++  C +L+     +L A        IA   N    +L +WV I
Sbjct:  406 LSGNPGYQVGKPVIAA--NGSSTPVVRTEINLWKPVSNNICSSTTPV---LFGQNSFSGCLLNLNELNCTQLRNTVITHLRALVPADF--IAMRGNSKTNDLGEWVQI 506          
BLAST of DUF1619 domain-containing protein vs. Ensembl Xenopus
Match: tctn2 (tectonic family member 2 [Source:NCBI gene;Acc:733954])

HSP 1 Score: 49.2914 bits (116), Expect = 8.817e-6
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSIS-SQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNI 595
            LSGN GY++GKP++ A  N     +    +  W+  S + C S++ V   LFGQN  +GC ++ ++  C +L+     +L A        IA   N    +L +WV I
Sbjct:  427 LSGNPGYQVGKPVIAA--NGSSTPVVRTEINLWKPVSNNICSSTTPV---LFGQNSFSGCLLNLNELNCTQLRNTVITHLRALVPADF--IAMRGNSKTNDLGEWVQI 527          
BLAST of DUF1619 domain-containing protein vs. Ensembl Mouse
Match: Tctn1 (tectonic family member 1 [Source:MGI Symbol;Acc:MGI:3603820])

HSP 1 Score: 74.3294 bits (181), Expect = 4.825e-14
Identity = 56/217 (25.81%), Postives = 96/217 (44.24%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNI--TTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQ-STYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q  +   I   + +  Q       S  +C +S  +   +LFG N+ +GC +       RL G     L A+    + R       +A+F N    ++ DWV +   T ++ +  G CQ+      E+ +++ G+      +I+ V AQ  +    LP     + + T V F+DV+  +    +  P +  +LP+ FFFP 
Sbjct:  384 LSGNPGYRVGLPLAAGFQPQKGSGIIQTTNRQGQFTILRSTSQQDCLASEGLRTPVLFGYNVQSGCQL-------RLTGTIPCGLLAQKVQDLLRGQAFPDYVAAFGNSRAQDVQDWVPVHFVTYSSNM-KGSCQLPVALAIEVKWTKYGSLLNPQARIVNVTAQLVSVPEPLPGPERTVVISTAVTFVDVSAPAEAGFRAPPTINARLPFSFFFPF 592          
BLAST of DUF1619 domain-containing protein vs. Ensembl Mouse
Match: Tctn3 (tectonic family member 3 [Source:MGI Symbol;Acc:MGI:1914840])

HSP 1 Score: 62.3882 bits (150), Expect = 4.165e-10
Identity = 50/206 (24.27%), Postives = 86/206 (41.75%), Query Frame = 2
Query:  278 SGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSISS-QYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQ----IVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS-QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            SGN GY  GKP++       +    + S+   Q +    C  S+    + FG N ++GC +   +  C  L+    +Y T         +A F N        W  I + +  + + +C     I  +   +++++  G        + G R      SV       +++L T+VNF+D+T Q     +  P +  KLP+DFFFP 
Sbjct:  369 SGNPGYLTGKPLL------VLTGDTSHSMTLLQSEGNGLC--SAKRHAVQFGVNAVSGCQLRPREVNCSHLQ--EEVYQTLHGRPRPEHVAVFGNADPAQRGGWTRILSRDCSVSAVNCTSCCLIPVSLEIQVLWAHLGLQSNPQAHVAGARFLYQCKSVQEHQRGIEVSLTTLVNFVDIT-QKPEPPRDQPRIDWKLPFDFFFPF 563          
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BZ64|TECT1_MOUSE (Tectonic-1 OS=Mus musculus OX=10090 GN=Tctn1 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.375e-13
Identity = 56/217 (25.81%), Postives = 96/217 (44.24%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNI--TTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQ-STYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q  +   I   + +  Q       S  +C +S  +   +LFG N+ +GC +       RL G     L A+    + R       +A+F N    ++ DWV +   T ++ +  G CQ+      E+ +++ G+      +I+ V AQ  +    LP     + + T V F+DV+  +    +  P +  +LP+ FFFP 
Sbjct:  384 LSGNPGYRVGLPLAAGFQPQKGSGIIQTTNRQGQFTILRSTSQQDCLASEGLRTPVLFGYNVQSGCQL-------RLTGTIPCGLLAQKVQDLLRGQAFPDYVAAFGNSRAQDVQDWVPVHFVTYSSNM-KGSCQLPVALAIEVKWTKYGSLLNPQARIVNVTAQLVSVPEPLPGPERTVVISTAVTFVDVSAPAEAGFRAPPTINARLPFSFFFPF 592          
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2MV58|TECT1_HUMAN (Tectonic-1 OS=Homo sapiens OX=9606 GN=TCTN1 PE=2 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 1.308e-10
Identity = 57/219 (26.03%), Postives = 94/219 (42.92%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVK-----SGDNCESSSTVE-QILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIY-------RIASFANVSLTNLNDWVNITTTNAQLPSGD-CQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS----QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G P+    Q ++   I   + ++ Q+      +  +C +   V   +LFG  + +GC +       RL G     L A+    +         +A F N    ++ DWV I          D CQ+      E+ +++ G+      KI+ V A +  SS  P  NS     I + T V F+DV+  +    +  P +  +LP++FFFP 
Sbjct:  376 LSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKL-------RLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHFITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTA-NLISSSFPEANSGNERTILISTAVTFVDVSAPAEAGFRAPPAINARLPFNFFFPF 586          
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R2Q6|TECT3_MOUSE (Tectonic-3 OS=Mus musculus OX=10090 GN=Tctn3 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.913e-9
Identity = 50/206 (24.27%), Postives = 86/206 (41.75%), Query Frame = 2
Query:  278 SGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSISS-QYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQ----IVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNS-QINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            SGN GY  GKP++       +    + S+   Q +    C  S+    + FG N ++GC +   +  C  L+    +Y T         +A F N        W  I + +  + + +C     I  +   +++++  G        + G R      SV       +++L T+VNF+D+T Q     +  P +  KLP+DFFFP 
Sbjct:  369 SGNPGYLTGKPLL------VLTGDTSHSMTLLQSEGNGLC--SAKRHAVQFGVNAVSGCQLRPREVNCSHLQ--EEVYQTLHGRPRPEHVAVFGNADPAQRGGWTRILSRDCSVSAVNCTSCCLIPVSLEIQVLWAHLGLQSNPQAHVAGARFLYQCKSVQEHQRGIEVSLTTLVNFVDIT-QKPEPPRDQPRIDWKLPFDFFFPF 563          
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R9E0|TECT3_MACFA (Tectonic-3 OS=Macaca fascicularis OX=9541 GN=TCTN3 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 7.171e-9
Identity = 58/228 (25.44%), Postives = 96/228 (42.11%), Query Frame = 2
Query:  215 RRILMNSTSTIISPYPTGFVLSGNRGYEIGKPIMRAIQNNQMLNIATD-SLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSIS-SQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNI----TTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTN-SQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            R    ++ ++I SP       SGN GY +GKP         +L +  D S     ++S  N   S    ++ FG N ++GC +   +  C  L+    +Y T         +A F N        W  I       +A + +  C I  +   +++++  G        + GVR      SV      ++++L T+VNF+D+T Q     +  P +  KLP+DFFFP 
Sbjct:  365 RAFQQSTAASITSPR------SGNPGYIVGKP---------LLALTGDVSYSMTLLRSQGNGSCSVNRHEVQFGVNAISGCKLRLKKADCSYLQ--QEIYQTLHGRPRPQHVAIFGNADPAQKGGWTRILNRHCNISAIICTSCCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSVRDSQQVTEVSLTTIVNFVDIT-QKPEPPRGQPKMDWKLPFDFFFPF 574          
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96GX1|TECT2_HUMAN (Tectonic-2 OS=Homo sapiens OX=9606 GN=TCTN2 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.130e-8
Identity = 52/170 (30.59%), Postives = 85/170 (50.00%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGC--SISSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLND-WVNITTTNAQLPSGD---------C-QIVTTRTYEIMYSRTGTTQYL-HNKIIGVRAQSTYSSV 742
            LSGN GY++GKP+ RA+  N+M N+ T  L  WQ  +G    +S+T + ILFG+N+++GC   +     C +L+   N     +S +    +A   N    +L+D W+ I   +A  P  D         C  I    +  I+ S  G  + +   +I+GV  ++ +SSV
Sbjct:  433 LSGNPGYQLGKPV-RALNINRMNNVTT--LHLWQ-SAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLR--ENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGV--ETRFSSV 594          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A3B3VRK3 (DUF1619 domain-containing protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.801e-15
Identity = 65/215 (30.23%), Postives = 110/215 (51.16%), Query Frame = 2
Query:  278 SGNRGYEIGKPIM---RAIQN-NQMLNIATDSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRA--QSTYSSVLPVT--NSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFP 874
            SGN GY +G P+M   RA    ++ +N+  D+L   Q     +C +       +LFGQ+ M+GC++S       L+ ++N  L ++S L + R       +ASF N  L N+ DWV I +         CQI      EI +++ G+      +I+ +R   ++  SS+ P++  +S + + + V FI V+  +V   + +P +  KLP+DFFFP
Sbjct:  311 SGNPGYVVGMPLMSGDRATDGISRSINL-RDTLSLLQSTEDQDCLKGPHQRSPVLFGQDYMSGCTLS-------LEDITNCSLVSQSLLNVLRGPNPPQYVASFGNTLLENVLDWVPIKSNMNPTEVQSCQIPLALHLEIEWTKYGSLVNPQAQIVSIREMIETNQSSLAPLSGGSSIVPVRSSVAFIPVSAAAVPGYRAAPSINAKLPFDFFFP 517          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A087X4Z6 (DUF1619 domain-containing protein OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 2.090e-15
Identity = 65/215 (30.23%), Postives = 111/215 (51.63%), Query Frame = 2
Query:  278 SGNRGYEIGKPIM---RAIQN-NQMLNIATDSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRA--QSTYSSVLPVT--NSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFP 874
            SGN GY +G P+M   RA    ++ +N+  D+L   Q     +C +       +LFGQ+ M+GC++S       L+ ++N  L ++S L + R       +ASF N  L N+ DWV I +         CQI  +   EI +++ G+      +I+ +R   ++  SS+ P++  +S + + + V FI V+  +V   + +P +  KLP+DFFFP
Sbjct:  397 SGNPGYVVGMPLMSGDRATDGISRSINL-RDTLSLLQSTEDQDCLKGPHQRSPVLFGQDYMSGCTLS-------LEDITNCSLVSQSLLNVLRGPNPPQYVASFGNTLLENVLDWVPIKSNMNPTEVQSCQIPLSLHLEIEWTKYGSLVNPQAQIVSIREMIETNQSSLAPLSGGSSIVPVRSSVAFIPVSAAAVPGYRAAPSINAKLPFDFFFP 603          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A3B3VTQ4 (DUF1619 domain-containing protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.636e-15
Identity = 65/216 (30.09%), Postives = 110/216 (50.93%), Query Frame = 2
Query:  278 SGNRGYEIGKPIM---RAIQN-NQMLNIATDSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRA--QSTYSSVLPVT--NSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            SGN GY +G P+M   RA    ++ +N+  D+L   Q     +C +       +LFGQ+ M+GC++S       L+ ++N  L ++S L + R       +ASF N  L N+ DWV I +         CQI      EI +++ G+      +I+ +R   ++  SS+ P++  +S + + + V FI V+  +V   + +P +  KLP+DFFFP 
Sbjct:  316 SGNPGYVVGMPLMSGDRATDGISRSINL-RDTLSLLQSTEDQDCLKGPHQRSPVLFGQDYMSGCTLS-------LEDITNCSLVSQSLLNVLRGPNPPQYVASFGNTLLENVLDWVPIKSNMNPTEVQSCQIPLALHLEIEWTKYGSLVNPQAQIVSIREMIETNQSSLAPLSGGSSIVPVRSSVAFIPVSAAAVPGYRAAPSINAKLPFDFFFPF 523          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A3P9QGZ1 (DUF1619 domain-containing protein OS=Poecilia reticulata OX=8081 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.103e-15
Identity = 70/227 (30.84%), Postives = 110/227 (48.46%), Query Frame = 2
Query:  278 SGNRGYEIGKPIM---RAIQN-NQMLNIATDSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWV----NITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQ-----------STYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            SGN GY +G P+M   RA    ++ +N+  D+L   Q     +C +       +LFGQ+ M+GC++S       L+ ++N  L ++S L + R       +ASF N  L N+ DWV    NI  T AQ     C+I  +   EI +++ G+      +I+ +R             S  SS++PV +S       V FI V+  +V   + +P +  KLP+DFFFP 
Sbjct:  311 SGNPGYVVGMPLMSGDRATDGISRSINL-RDTLSLLQSTEDQDCLQGPHQRSPVLFGQDYMSGCTLS-------LEDITNCSLVSQSLLNVLRGPSPPQYVASFGNTPLENILDWVPVKSNINPTEAQ----SCKIPLSLHLEIEWTKYGSLVNPQAQIVTIREMIETNQSSLARLSGGSSIVPVRSS-------VAFIPVSAAAVPGYRAAPSINAKLPFDFFFPF 518          
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Match: A0A3B3YS60 (DUF1619 domain-containing protein OS=Poecilia mexicana OX=48701 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.617e-15
Identity = 67/222 (30.18%), Postives = 107/222 (48.20%), Query Frame = 2
Query:  278 SGNRGYEIGKPIM---RAIQN-NQMLNIATDSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQ-----------STYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFP 874
            SGN GY +G P+M   RA    ++ +N+  D+L   Q     +C +       +LFGQ+ M+GC++S       L+ ++N  L ++S L + R       +ASF N  L N+ DWV I +         CQI  +   EI +++ G+      +I+ +R             S  SS++PV +S       V FI V+  +V   + +P +  KLP+DFFFP
Sbjct:  311 SGNPGYVVGMPVMSGDRATDGISRSINL-RDTLSLLQSTEDQDCLKGPHQRSPVLFGQDYMSGCTLS-------LEDITNCSLVSQSLLNVLRGPSPPQYVASFGNTLLENVLDWVPIKSNMNPTEVQSCQIPLSLHLEIEWTKYGSLVNPQAQIVSIREMIETNQSSLALLSGGSSIVPVRSS-------VAFIPVSAAAVPGYRAAPSINAKLPFDFFFP 517          
BLAST of DUF1619 domain-containing protein vs. Ensembl Cavefish
Match: tctn1 (tectonic family member 1 [Source:ZFIN;Acc:ZDB-GENE-081104-157])

HSP 1 Score: 72.7886 bits (177), Expect = 1.248e-13
Identity = 62/214 (28.97%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  278 SGNRGYEIGKPIMRAIQNNQMLNIATD---SLQWWQVKSGDNCE-SSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTY-SSVLPV--TNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            SGN GY  G P++   +  + +  +TD   SL   Q     +C         +LFG + ++GC+        RL+  +N  L +E  LG  +       +A+F +    NL DWV I          DC I  +   E+ +++ GT     ++I+ V    T+ +S LP   T   I + + V+FIDV+  +    + +P +  KLPYDFFFP 
Sbjct:  284 SGNPGYVQGLPLVAGWRTAEGIIRSTDPQGSLTVLQSFVEQDCLFGVPQRSPVLFGTDTLSGCTF-------RLEDGANCSLVSEVILGTLKGQSFPDYVATFGDSLPQNLMDWVPIENQTTVTSLQDCSIPLSYHLEVRWTKYGTLVNPQSQIVSVMEVITFNTSTLPSSSTGGLIPVSSSVSFIDVSASASPGYRAAPTINAKLPYDFFFPF 490          
BLAST of DUF1619 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000013675.2 (tectonic family member 1 [Source:NCBI gene;Acc:101167130])

HSP 1 Score: 73.9442 bits (180), Expect = 5.066e-14
Identity = 55/216 (25.46%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIAT---DSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRA-QSTYSSVLPVTN---SQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G+P++   +  + ++ +T   D+L      +  +C         +LFG N ++GC++       RL   +N  L  +  L + R       +ASF N  L    DWV+I ++ + +    C +  +   EI +++ G+ +    +I+ +R    T SS LP+ +     + + + V F+ V+  ++   + +P +  KLP++FFFP 
Sbjct:  391 LSGNPGYVVGRPLLSGTKTAEGISRSTELRDALSLLHSSAEQDCLRGPHRRSPVLFGVNAVSGCTL-------RLDDAANCSLVLQQLLDVLRGPNYPQYVASFGNSPLNKQLDWVSIQSSFSPVEDQSCSLPLSLHLEIEWTKYGSLENPQAQIVSIREIIQTNSSSLPLLSGGGGSLPVRSSVAFVPVSADALPGYRATPTIDAKLPFNFFFPF 599          
BLAST of DUF1619 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029246.1 (tectonic family member 1 [Source:NCBI gene;Acc:101167130])

HSP 1 Score: 73.9442 bits (180), Expect = 5.341e-14
Identity = 55/216 (25.46%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIAT---DSLQWWQVKSGDNC-ESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYR-------IASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRA-QSTYSSVLPVTN---SQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPI 877
            LSGN GY +G+P++   +  + ++ +T   D+L      +  +C         +LFG N ++GC++       RL   +N  L  +  L + R       +ASF N  L    DWV+I ++ + +    C +  +   EI +++ G+ +    +I+ +R    T SS LP+ +     + + + V F+ V+  ++   + +P +  KLP++FFFP 
Sbjct:  398 LSGNPGYVVGRPLLSGTKTAEGISRSTELRDALSLLHSSAEQDCLRGPHRRSPVLFGVNAVSGCTL-------RLDDAANCSLVLQQLLDVLRGPNYPQYVASFGNSPLNKQLDWVSIQSSFSPVEDQSCSLPLSLHLEIEWTKYGSLENPQAQIVSIREIIQTNSSSLPLLSGGGGSLPVRSSVAFVPVSADALPGYRATPTIDAKLPFNFFFPF 606          
BLAST of DUF1619 domain-containing protein vs. Ensembl Medaka
Match: tctn2 (tectonic family member 2 [Source:NCBI gene;Acc:101155357])

HSP 1 Score: 50.8322 bits (120), Expect = 1.524e-6
Identity = 34/137 (24.82%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  275 LSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSI----SSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNI------TTTNAQLPSGDCQIVTTRTY 655
            +SGN GY++G+P++  I +N   ++    +  W+      C SS+  E +LFG+N  +GC +    ++   C+ L+    ++   E       +A   N  L  + DW+NI      ++  A+  S +C+ V +  +
Sbjct:  446 VSGNPGYQVGRPVIAGIIDNDTSSMQKTYINVWKPVHDGLC-SSAEREAVLFGKNYTSGCLLPVVTNNLTQCNLLR--ETVFKLQEGLTAAAYVAKRGNPDLFTMTDWLNISLVSLNSSDAAEDTSSECRAVPSHVH 579          
BLAST of DUF1619 domain-containing protein vs. Planmine SMEST
Match: SMESG000057489.1 (SMESG000057489.1)

HSP 1 Score: 448.743 bits (1153), Expect = 4.896e-158
Identity = 218/219 (99.54%), Postives = 218/219 (99.54%), Query Frame = 2
Query:  230 NSTSTIISPYPTGFVLSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPIYTP 886
            NSTSTIISPYPTGFVLSGNRGYEIGKPIMRAIQNNQMLNIATDS QWWQVKSGDNCESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPIYTP
Sbjct:  148 NSTSTIISPYPTGFVLSGNRGYEIGKPIMRAIQNNQMLNIATDSFQWWQVKSGDNCESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLPVTNSQINLYTVVNFIDVTPQSVISTKLSPFLTIKLPYDFFFPIYTP 366          
BLAST of DUF1619 domain-containing protein vs. Planmine SMEST
Match: SMESG000002053.1 (SMESG000002053.1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.620e-8
Identity = 54/176 (30.68%), Postives = 91/176 (51.70%), Query Frame = 2
Query:  278 SGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQVKSGDNCESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESSLGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRTGTTQYLHNKIIGVRAQSTYSSVLP-VTNSQINLYTVVNFIDVT 802
            SGN GY  GKP +RAI NN +L       + W + +GD+C + S   +I FG N+   CS +       +  L+++  +  SSL  Y I  F N + ++ +D V + +++    S     +  +   ++Y+R GT     NK+IGV+  + YS +   V NS +++   V+FID +
Sbjct:  313 SGNPGYITGKP-LRAIYNNNLL-------KDWLIPAGDDCVTGSR-TKINFGYNMEIDCSFA-------VVNLASVNSSLTSSLPSY-IGPFGNSAASD-SDQVPVISSSENSNSS--SALKKQFIYVVYARNGTLTLPQNKVIGVKVTNVYSDIPQGVNNSWVSI--SVSFIDAS 466          
The following BLAST results are available for this feature:
BLAST of DUF1619 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCTN12.753e-1226.48tectonic family member 1 [Source:HGNC Symbol;Acc:H... [more]
TCTN12.723e-1126.03tectonic family member 1 [Source:HGNC Symbol;Acc:H... [more]
TCTN12.755e-1126.03tectonic family member 1 [Source:HGNC Symbol;Acc:H... [more]
TCTN19.438e-1025.00tectonic family member 1 [Source:HGNC Symbol;Acc:H... [more]
TCTN22.191e-930.59tectonic family member 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctn13.093e-1327.48tectonic family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ap3s21.172e-1427.73adaptor related protein complex 3 subunit sigma 2 ... [more]
tctn27.786e-631.48tectonic family member 2 [Source:NCBI gene;Acc:733... [more]
tctn28.817e-631.48tectonic family member 2 [Source:NCBI gene;Acc:733... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tctn14.825e-1425.81tectonic family member 1 [Source:MGI Symbol;Acc:MG... [more]
Tctn34.165e-1024.27tectonic family member 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BZ64|TECT1_MOUSE3.375e-1325.81Tectonic-1 OS=Mus musculus OX=10090 GN=Tctn1 PE=1 ... [more]
sp|Q2MV58|TECT1_HUMAN1.308e-1026.03Tectonic-1 OS=Homo sapiens OX=9606 GN=TCTN1 PE=2 S... [more]
sp|Q8R2Q6|TECT3_MOUSE2.913e-924.27Tectonic-3 OS=Mus musculus OX=10090 GN=Tctn3 PE=1 ... [more]
sp|Q4R9E0|TECT3_MACFA7.171e-925.44Tectonic-3 OS=Macaca fascicularis OX=9541 GN=TCTN3... [more]
sp|Q96GX1|TECT2_HUMAN1.130e-830.59Tectonic-2 OS=Homo sapiens OX=9606 GN=TCTN2 PE=2 S... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3VRK31.801e-1530.23DUF1619 domain-containing protein OS=Poecilia lati... [more]
A0A087X4Z62.090e-1530.23DUF1619 domain-containing protein OS=Poecilia form... [more]
A0A3B3VTQ42.636e-1530.09DUF1619 domain-containing protein OS=Poecilia lati... [more]
A0A3P9QGZ17.103e-1530.84DUF1619 domain-containing protein OS=Poecilia reti... [more]
A0A3B3YS608.617e-1530.18DUF1619 domain-containing protein OS=Poecilia mexi... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctn11.248e-1328.97tectonic family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF1619 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000013675.25.066e-1425.46tectonic family member 1 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000029246.15.341e-1425.46tectonic family member 1 [Source:NCBI gene;Acc:101... [more]
tctn21.524e-624.82tectonic family member 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of DUF1619 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000057489.14.896e-15899.54SMESG000057489.1[more]
SMESG000002053.19.620e-830.68SMESG000002053.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018865 ID=SMED30018865|Name=DUF1619 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1122bp
GATCTCTGGCACTGGAAATCGAGTCTCGATTGTCGTTTGGAGCTAGTTTC
AATGGAATAATTCATTACAATTTCTACAAATGCGATATTACTCTTTCAAA
GATGAAAAATGGGAAAATAATTCTCAGATTGGATTATTATGGAAAAGAAT
TCAAATGTAACCCAATTATAGAACAATTTCCCCATCATTTGACAAAATTG
AAAGCTATAAAGAAAGAAGAATTCTTATGAACTCCACTTCCACGATTATA
TCTCCATATCCGACTGGATTTGTTCTCAGTGGCAACAGAGGCTATGAAAT
CGGGAAGCCAATTATGAGAGCGATTCAGAATAACCAAATGTTGAACATAG
CGACTGACTCCCTCCAATGGTGGCAAGTGAAAAGCGGCGACAATTGTGAA
TCCTCCAGTACAGTGGAACAGATTCTATTTGGACAAAATCTCATGGCTGG
CTGCTCGATCTCCTCACAGTACACGTGTGATAGATTGAAAGGTCTGTCTA
ATCTATACCTGACAGCAGAGAGCTCCCTCGGCATCTATCGGATTGCATCA
TTTGCTAATGTCAGTCTGACGAATCTCAATGATTGGGTGAATATCACCAC
TACCAATGCACAACTTCCCAGTGGCGATTGTCAGATTGTCACAACCCGGA
CATATGAGATCATGTATTCTCGAACGGGAACCACTCAGTATCTGCACAAC
AAAATCATCGGCGTGAGAGCCCAGTCCACCTACAGTTCCGTTTTACCGGT
CACGAATTCCCAGATCAATCTCTACACCGTTGTCAACTTCATTGATGTCA
CTCCACAGAGCGTCATTTCAACCAAGTTGTCACCATTCCTTACAATCAAG
TTACCCTATGATTTTTTCTTTCCCATTTATACTCCTTGATTTATCCTCGT
GTTTCCTTTGTATTGATTCACACAGTGTTTATGTCAATAAATTTGCTGTT
ATTTATCGATTGATTTATTCAGTTTATTTGCTGTTTCGTTACCAGTAAAC
ATTTCTTTAGCACGGTTTCATCGCTGATCGAATCCGATAATAATATGATT
TAAGGACTCCATCGCACTAGGACTTCTATAACCTTTCAAGGTCATCACAA
TGTCATATAAAGTGTGTGAGAT
back to top

protein sequence of SMED30018865-orf-1

>SMED30018865-orf-1 ID=SMED30018865-orf-1|Name=SMED30018865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MNSTSTIISPYPTGFVLSGNRGYEIGKPIMRAIQNNQMLNIATDSLQWWQ
VKSGDNCESSSTVEQILFGQNLMAGCSISSQYTCDRLKGLSNLYLTAESS
LGIYRIASFANVSLTNLNDWVNITTTNAQLPSGDCQIVTTRTYEIMYSRT
GTTQYLHNKIIGVRAQSTYSSVLPVTNSQINLYTVVNFIDVTPQSVISTK
LSPFLTIKLPYDFFFPIYTP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040354Tectonic
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
GO:0036038MKS complex
GO:0042995cell projection
GO:0060170ciliary membrane
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
GO:0097711ciliary basal body docking
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR040354TectonicPANTHERPTHR14611UNCHARACTERIZED DUF1619-CONTAININGcoord: 13..218