Cytoplasmic polyadenylation element-binding protein 1

Overview
NameCytoplasmic polyadenylation element-binding protein 1
Smed IDSMED30018862
Length (bp)2374
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoplasmic polyadenylation element-binding protein 1 (SMED30018862) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoplasmic polyadenylation element-binding protein 1 (SMED30018862) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Human
Match: CPEB1 (cytoplasmic polyadenylation element binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21744])

HSP 1 Score: 285.034 bits (728), Expect = 7.421e-87
Identity = 143/293 (48.81%), Postives = 189/293 (64.51%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS + R+ S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDS+C+ C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  200 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 486          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Human
Match: CPEB1 (cytoplasmic polyadenylation element binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21744])

HSP 1 Score: 285.034 bits (728), Expect = 7.421e-87
Identity = 143/293 (48.81%), Postives = 189/293 (64.51%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS + R+ S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDS+C+ C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  200 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 486          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Human
Match: CPEB1 (cytoplasmic polyadenylation element binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21744])

HSP 1 Score: 284.648 bits (727), Expect = 1.112e-86
Identity = 143/293 (48.81%), Postives = 188/293 (64.16%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS + R+ S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDS+C+ C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  200 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG------YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 481          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Human
Match: CPEB1 (cytoplasmic polyadenylation element binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21744])

HSP 1 Score: 284.648 bits (727), Expect = 1.112e-86
Identity = 143/293 (48.81%), Postives = 188/293 (64.16%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS + R+ S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDS+C+ C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  200 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG------YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 481          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Human
Match: CPEB1 (cytoplasmic polyadenylation element binding protein 1 [Source:HGNC Symbol;Acc:HGNC:21744])

HSP 1 Score: 284.648 bits (727), Expect = 1.112e-86
Identity = 143/293 (48.81%), Postives = 188/293 (64.16%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS + R+ S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDS+C+ C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  200 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG------YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 481          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Celegans
Match: cpb-3 (Cytoplasmic polyadenylation element-binding protein 3 [Source:UniProtKB/Swiss-Prot;Acc:O01835])

HSP 1 Score: 218.394 bits (555), Expect = 2.064e-60
Identity = 114/284 (40.14%), Postives = 163/284 (57.39%), Query Frame = 1
Query: 1213 WSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDX--------------XXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE-FFKISSPKFRS---KDVQVIPWITQDSQYCR------TGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            W G+LP   Y    +SRK+F+GGVPWD TE  L  +F +FG  +V +P ++               +  ++   +  +  GY Y+IFE E +VA LL +C +     GE +FKI + + +S   + VQ+IPW+T DS +C       TG    + K+TVFVGALHGMMTA  L ++M + F  V    LDTDK+KYPIGSGRVTF    +Y +A+   ++HV T+KF K +QIDP+LE + C  C       FCR+  CF+Y+C  CW + H + +    H P+
Sbjct:  279 WFGELPPRDYTSPTFSRKIFVGGVPWDITEAALKDSFGEFGSCAVEWPGQEARYRSGQSNLAPSNGSLRAQTKYTGQAATGYVYMIFEDERAVASLLHECSQEIGGAGEWYFKIRAQRSKSTEIRQVQIIPWVTSDSMFCEDDTLLETGI---EPKRTVFVGALHGMMTAQVLHSIMEDCFGAVECVQLDTDKFKYPIGSGRVTFREHGAYFKAIEMGYLHVYTSKFRKRVQIDPFLESTCCMVCNSQSAHCFCRNKNCFKYYCHNCWALDHGKDDDQEVHIPV 559          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Celegans
Match: cpb-1 (Cytoplasmic polyadenylation element-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q03571])

HSP 1 Score: 141.739 bits (356), Expect = 3.322e-35
Identity = 91/313 (29.07%), Postives = 157/313 (50.16%), Query Frame = 1
Query: 1120 MGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXX------XXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCF-----QSPGIYFCRSFECFRYFCSGCWQVWH------NRCETLFNHKPLRRT 2001
            M + +     A   Y+    ++   +++  + S K PI++  +  YSRKVF+GG+P D +E  + + F  FG + + +P++  ++  +          S ++ GY +++F  E SV  L++ C   E     + ++SSP    K VQV PW   D  Y    +   D ++TVF+G +     A  LA  +   +  V +  +D D + KYP G+ RVTFS+ ++++RA++  F+ V  A+ +K ++I PY +E+  C+ C       +   YFC    C +Y+C GCW   H      N+ E    H P+ RT
Sbjct:  201 MEVTDPQAVSAPPEYKRLDGSLMGVSKSCLEASKKRPISAEPL--YSRKVFIGGLPIDVSEEQVWATFGAFGKVLIDWPRRPEHNAERAEQELKKGSGSRAVTGYVFLVFTHERSVQELVNACEFYEDK--YYLQLSSPTMTDKAVQVRPWRLSDIDYFCNDNSSVDHRRTVFIGGVPRPTRAQDLARCLEGHYGKVSYVGIDIDPELKYPKGAARVTFSTSQAFVRAISGRFVQVNHAENNKRVEIKPYVMEEQYCDECEGRLCKHNYAPYFCGHASCLQYYCEGCWDRMHIGKNEDNKLED--QHYPMVRT 507          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Celegans
Match: cpb-2 (Cytoplasmic polyadenylation element-binding protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18317])

HSP 1 Score: 112.079 bits (279), Expect = 1.853e-25
Identity = 63/199 (31.66%), Postives = 103/199 (51.76%), Query Frame = 1
Query: 1414 YCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNC----FQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            Y +++FE E SV  L+  C + E   G F  + S    S  VQ+ PW+  D+++    +   ++K   F+G +   + A  LA+   + + +V+   +D D K+KYP GSGRV FS   +Y++A+T  +I +      K ++I PY   +  C  C     +    YFC S ECF+Y+C  CW   H+   + F+H P+
Sbjct:  372 YVFLLFEKERSVRDLVLDCFEEEE--GLFITLESST-DSIRVQIRPWLLADAEFLMDFNVPINTKLVAFIGGVPRPLKAVELAHFFEQTYGHVVCVGIDIDNKFKYPRGSGRVAFSDYDAYVQAITDRYIVLDHEDIHKRVEIKPYFFHNQSCEECSGRYHRQHAPYFCPSLECFQYYCEPCWHKMHSH-PSRFHHMPV 566          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Celegans
Match: fog-1 (Feminization Of Germline [Source:UniProtKB/TrEMBL;Acc:A0A0K3AQU4])

HSP 1 Score: 92.4337 bits (228), Expect = 3.975e-19
Identity = 71/220 (32.27%), Postives = 112/220 (50.91%), Query Frame = 1
Query: 1258 SRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKP---DSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDK-YKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKT-IQIDPY-LEDSMCNNCFQSPGIYF 1899
            S KVF+GG+        +   F +FG + V +P K   +    S +  S   Y ++++  E SV +L+S C +N  N  +FF +S P FR   +Q+ PW   +  Y    +      D  +TVF+G L  ++TA  +A + +E F  V+   +D D+ Y YP G+ RVTF    ++ RA+   F+       SKT I+I PY +ED  C+ C    G++F
Sbjct:  204 SNKVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYS-YLFLVYSDEQSVIKLMSACHRNSQN--DFF-VSVPGFRDM-IQIRPWFIYNGFYILEKARHNRIIDIHRTVFLGGLPRIVTAEEIAQMFSE-FGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALEKKFLKFDNIDSSKTMIEIKPYVMEDVGCDEC---GGLWF 414          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Celegans
Match: fog-1 (Feminization Of Germline [Source:UniProtKB/TrEMBL;Acc:A0A0K3AQU4])

HSP 1 Score: 85.1149 bits (209), Expect = 2.682e-17
Identity = 57/168 (33.93%), Postives = 90/168 (53.57%), Query Frame = 1
Query: 1414 YCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKP---DSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDK-YKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKT-IQIDPY-LEDSMCNNCFQSPGIYF 1899
            Y ++++  E SV +L+S C +N  N  +FF +S P FR   +Q+ PW   +  Y    +      D  +TVF+G L  ++TA  +A + +E F  V+   +D D+ Y YP G+ RVTF    ++ RA+   F+       SKT I+I PY +ED  C+ C    G++F
Sbjct:   41 YLFLVYSDEQSVIKLMSACHRNSQN--DFF-VSVPGFRDM-IQIRPWFIYNGFYILEKARHNRIIDIHRTVFLGGLPRIVTAEEIAQMFSE-FGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALEKKFLKFDNIDSSKTMIEIKPYVMEDVGCDEC---GGLWF 200          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Fly
Match: orb (gene:FBgn0004882 transcript:FBtr0084386)

HSP 1 Score: 299.286 bits (765), Expect = 9.686e-92
Identity = 152/324 (46.91%), Postives = 206/324 (63.58%), Query Frame = 1
Query: 1057 SANPISLKDEIAMLSMSYRNMMGILESD---IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCC--KNEANGGE--FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            SA   SL  E+A       N+ GI+ ++   +++ A  Y++SA       +A   WSG LP  S+++  YS KVFLGG+PWD +E  L+  F  FG + V +P K+  +             Y YIIFES+  V  LLS C    ++++ G   FFKISS + +SKDV+VIPWI  DS + R+ S K D  KTVFVGALHG +TA  L N+M++LFD V++  +DTDKYKYPIGSGRVTFS+ +SYM+AV+A FI ++T KF+K +Q+DPYLED++C+ C    G Y+CR   CFRYFC  CWQ W + C+ + NHKPL R  K
Sbjct:  159 SAGGSSLMTEMA------GNVGGIITTNDGHLDRVAKFYKSSAALC----DATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKG--------YVYIIFESDKQVKALLSACVLQVDDSHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRYFCRSCWQ-WQHSCDIVKNHKPLTRNSK 463          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Fly
Match: orb (gene:FBgn0004882 transcript:FBtr0100228)

HSP 1 Score: 299.286 bits (765), Expect = 9.686e-92
Identity = 152/324 (46.91%), Postives = 206/324 (63.58%), Query Frame = 1
Query: 1057 SANPISLKDEIAMLSMSYRNMMGILESD---IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCC--KNEANGGE--FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            SA   SL  E+A       N+ GI+ ++   +++ A  Y++SA       +A   WSG LP  S+++  YS KVFLGG+PWD +E  L+  F  FG + V +P K+  +             Y YIIFES+  V  LLS C    ++++ G   FFKISS + +SKDV+VIPWI  DS + R+ S K D  KTVFVGALHG +TA  L N+M++LFD V++  +DTDKYKYPIGSGRVTFS+ +SYM+AV+A FI ++T KF+K +Q+DPYLED++C+ C    G Y+CR   CFRYFC  CWQ W + C+ + NHKPL R  K
Sbjct:  159 SAGGSSLMTEMA------GNVGGIITTNDGHLDRVAKFYKSSAALC----DATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKG--------YVYIIFESDKQVKALLSACVLQVDDSHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRYFCRSCWQ-WQHSCDIVKNHKPLTRNSK 463          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Fly
Match: orb (gene:FBgn0004882 transcript:FBtr0301491)

HSP 1 Score: 300.442 bits (768), Expect = 1.687e-91
Identity = 152/324 (46.91%), Postives = 206/324 (63.58%), Query Frame = 1
Query: 1057 SANPISLKDEIAMLSMSYRNMMGILESD---IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCC--KNEANGGE--FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            SA   SL  E+A       N+ GI+ ++   +++ A  Y++SA       +A   WSG LP  S+++  YS KVFLGG+PWD +E  L+  F  FG + V +P K+  +             Y YIIFES+  V  LLS C    ++++ G   FFKISS + +SKDV+VIPWI  DS + R+ S K D  KTVFVGALHG +TA  L N+M++LFD V++  +DTDKYKYPIGSGRVTFS+ +SYM+AV+A FI ++T KF+K +Q+DPYLED++C+ C    G Y+CR   CFRYFC  CWQ W + C+ + NHKPL R  K
Sbjct:  217 SAGGSSLMTEMA------GNVGGIITTNDGHLDRVAKFYKSSAALC----DATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKG--------YVYIIFESDKQVKALLSACVLQVDDSHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRYFCRSCWQ-WQHSCDIVKNHKPLTRNSK 521          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Fly
Match: orb (gene:FBgn0004882 transcript:FBtr0100227)

HSP 1 Score: 300.827 bits (769), Expect = 6.118e-89
Identity = 152/324 (46.91%), Postives = 206/324 (63.58%), Query Frame = 1
Query: 1057 SANPISLKDEIAMLSMSYRNMMGILESD---IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCC--KNEANGGE--FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            SA   SL  E+A       N+ GI+ ++   +++ A  Y++SA       +A   WSG LP  S+++  YS KVFLGG+PWD +E  L+  F  FG + V +P K+  +             Y YIIFES+  V  LLS C    ++++ G   FFKISS + +SKDV+VIPWI  DS + R+ S K D  KTVFVGALHG +TA  L N+M++LFD V++  +DTDKYKYPIGSGRVTFS+ +SYM+AV+A FI ++T KF+K +Q+DPYLED++C+ C    G Y+CR   CFRYFC  CWQ W + C+ + NHKPL R  K
Sbjct:  513 SAGGSSLMTEMA------GNVGGIITTNDGHLDRVAKFYKSSAALC----DATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKG--------YVYIIFESDKQVKALLSACVLQVDDSHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRYFCRSCWQ-WQHSCDIVKNHKPLTRNSK 817          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Fly
Match: orb (gene:FBgn0004882 transcript:FBtr0084385)

HSP 1 Score: 300.827 bits (769), Expect = 6.118e-89
Identity = 152/324 (46.91%), Postives = 206/324 (63.58%), Query Frame = 1
Query: 1057 SANPISLKDEIAMLSMSYRNMMGILESD---IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCC--KNEANGGE--FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            SA   SL  E+A       N+ GI+ ++   +++ A  Y++SA       +A   WSG LP  S+++  YS KVFLGG+PWD +E  L+  F  FG + V +P K+  +             Y YIIFES+  V  LLS C    ++++ G   FFKISS + +SKDV+VIPWI  DS + R+ S K D  KTVFVGALHG +TA  L N+M++LFD V++  +DTDKYKYPIGSGRVTFS+ +SYM+AV+A FI ++T KF+K +Q+DPYLED++C+ C    G Y+CR   CFRYFC  CWQ W + C+ + NHKPL R  K
Sbjct:  513 SAGGSSLMTEMA------GNVGGIITTNDGHLDRVAKFYKSSAALC----DATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKG--------YVYIIFESDKQVKALLSACVLQVDDSHCGRNYFFKISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAEGLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRYFCRSCWQ-WQHSCDIVKNHKPLTRNSK 817          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Zebrafish
Match: cpeb1b (cytoplasmic polyadenylation element binding protein 1b [Source:NCBI gene;Acc:30702])

HSP 1 Score: 285.419 bits (729), Expect = 2.264e-86
Identity = 141/293 (48.12%), Postives = 192/293 (65.53%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A+     NEA + WSG+LP   Y+   YS KVFLGGVPWD TE  L++ F  +G LSV +P KD          +     Y Y++FES+ SV  LL  C ++    E     +FK+SS + R KD QVIPW+  DS Y    S + D + TVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLED++C +C + PG +FCR   CF+Y+C  CW   H+  + L NH+PL R  K
Sbjct:  268 IEREAWLHRQAASI----NEATFTWSGQLPPRHYQNPVYSCKVFLGGVPWDITEAGLINTFKCYGPLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESDKSVRALLQDCTEDLLHPEGYSEYYFKMSSRRMRCKDAQVIPWVISDSNYVSCPSQRLDPRNTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTPKFTKKVQIDPYLEDAICQSCSREPGPFFCRDKTCFKYYCRSCWHRQHSM-DILSNHRPLMRNQK 554          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Zebrafish
Match: cpeb1a (cytoplasmic polyadenylation element binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-080723-42])

HSP 1 Score: 281.182 bits (718), Expect = 3.206e-85
Identity = 140/295 (47.46%), Postives = 186/295 (63.05%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEF----FKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPI 2013
            IE+ A L++ +A      NEA+Y W G LP   YK   YS KVFLGGVPWD TE  L S F  FG L V +P KD                Y Y++F+ E SV  LL  C ++     ++    +K+SS +  SKDVQVIPW+  DS + R  S +    KTVFVGALHGM+ A  LA++M+ELF  V++  +DTDK+KYPIGSGRVTF SQ+SY++AVTA F+ +KT+KF+K +QIDPYL+DS+C  C   PG +FCR+  CF+Y+C  CW  W +  + L +H+PL R  K +
Sbjct:  236 IEREAKLHKQAAAV----NEASYSWEGSLPPRHYKTPVYSCKVFLGGVPWDITEASLQSTFSVFGPLKVEWPGKDGKHPRCPPQG------YVYLLFDWEKSVKSLLLACTQHRLQADDYLQFYYKLSSRRIHSKDVQVIPWVISDSNFIRCPSQRLCRNKTVFVGALHGMLNAEGLAHIMDELFGGVMYAGIDTDKHKYPIGSGRVTFRSQRSYLKAVTAAFVQIKTSKFTKKVQIDPYLDDSICQICSSQPGPFFCRAQACFKYYCRSCWH-WRHSLDVLSSHQPLMRNQKSL 519          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Zebrafish
Match: cpeb2 (cytoplasmic polyadenylation element binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-130530-639])

HSP 1 Score: 174.096 bits (440), Expect = 2.882e-47
Identity = 94/257 (36.58%), Postives = 149/257 (57.98%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            ++ ++SRKVF+GG+P D  E+++ S+F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  127 RIERFSRKVFVGGLPPDIDEDEITSSFRRFGHLVVDWPHK------AESKSYFPPKGYAFLLFQEETSVQALIEACL--EEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREF-HKPL 374          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Zebrafish
Match: cpeb2 (cytoplasmic polyadenylation element binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-130530-639])

HSP 1 Score: 173.711 bits (439), Expect = 5.327e-47
Identity = 94/257 (36.58%), Postives = 149/257 (57.98%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            ++ ++SRKVF+GG+P D  E+++ S+F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  144 RIERFSRKVFVGGLPPDIDEDEITSSFRRFGHLVVDWPHK------AESKSYFPPKGYAFLLFQEETSVQALIEACL--EEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREF-HKPL 391          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Zebrafish
Match: cpeb4a (cytoplasmic polyadenylation element binding protein 4a [Source:NCBI gene;Acc:393956])

HSP 1 Score: 177.948 bits (450), Expect = 1.038e-46
Identity = 94/257 (36.58%), Postives = 150/257 (58.37%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            ++ +YSRKVF+GG+P D  E+++ ++F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  372 RIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHK------AESKSYFPPKGYAFLLFQDESSVQALIDACM--EEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 619          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Xenopus
Match: cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:550084])

HSP 1 Score: 294.664 bits (753), Expect = 3.824e-90
Identity = 147/293 (50.17%), Postives = 192/293 (65.53%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KTAKF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  236 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKG------YVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 517          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Xenopus
Match: cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:550084])

HSP 1 Score: 293.893 bits (751), Expect = 2.262e-89
Identity = 147/293 (50.17%), Postives = 193/293 (65.87%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KTAKF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  273 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 559          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Xenopus
Match: cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:550084])

HSP 1 Score: 293.893 bits (751), Expect = 2.550e-89
Identity = 147/293 (50.17%), Postives = 192/293 (65.53%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KTAKF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  277 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKG------YVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 558          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Xenopus
Match: cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:550084])

HSP 1 Score: 293.123 bits (749), Expect = 4.525e-89
Identity = 147/293 (50.17%), Postives = 193/293 (65.87%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KTAKF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  268 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 554          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Xenopus
Match: cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:550084])

HSP 1 Score: 209.92 bits (533), Expect = 2.244e-59
Identity = 122/293 (41.64%), Postives = 161/293 (54.95%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++           F++             P+  +S           Y      CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  201 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKG------YVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNHA---------FLY-------------PFGSNSSA---------YHLLDNVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 451          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Mouse
Match: Cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:MGI Symbol;Acc:MGI:108442])

HSP 1 Score: 280.796 bits (717), Expect = 1.047e-84
Identity = 143/293 (48.81%), Postives = 186/293 (63.48%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS +  + S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AVTA F+ +KT KF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  269 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG------YVYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVWSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 550          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Mouse
Match: Cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:MGI Symbol;Acc:MGI:108442])

HSP 1 Score: 280.796 bits (717), Expect = 1.426e-84
Identity = 143/293 (48.81%), Postives = 187/293 (63.82%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS +  + S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AVTA F+ +KT KF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  274 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVWSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 560          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Mouse
Match: Cpeb1 (cytoplasmic polyadenylation element binding protein 1 [Source:MGI Symbol;Acc:MGI:108442])

HSP 1 Score: 280.796 bits (717), Expect = 1.574e-84
Identity = 143/293 (48.81%), Postives = 187/293 (63.82%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS +  + S + D  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AVTA F+ +KT KF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  275 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVWSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 561          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Mouse
Match: Cpeb4 (cytoplasmic polyadenylation element binding protein 4 [Source:MGI Symbol;Acc:MGI:1914829])

HSP 1 Score: 174.481 bits (441), Expect = 1.825e-47
Identity = 95/257 (36.96%), Postives = 149/257 (57.98%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            +V +YSRKVF+GG+P D  E+++ ++F +FG L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  129 RVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHK------AESKSYFPPKGYAFLLFQDESSVQALIDACI--EEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 376          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Mouse
Match: Cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:MGI Symbol;Acc:MGI:2443075])

HSP 1 Score: 173.711 bits (439), Expect = 6.354e-47
Identity = 96/257 (37.35%), Postives = 148/257 (57.59%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            +V +YSRKVF+GG+P D  E+++ ++F +FG L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D MC+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  152 RVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHK------AESKSYFPPKGYAFLLFQEESSVQALIDACL--EEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREF-HKPL 399          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q91572|CPE1A_XENLA (Cytoplasmic polyadenylation element-binding protein 1-A OS=Xenopus laevis OX=8355 GN=cpeb1-a PE=1 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 1.317e-88
Identity = 147/293 (50.17%), Postives = 193/293 (65.87%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KTAKF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  277 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESEKSVRALLQACSQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 563          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q52KN7|CPE1B_XENLA (Cytoplasmic polyadenylation element-binding protein 1-B OS=Xenopus laevis OX=8355 GN=cpeb1-b PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 1.606e-88
Identity = 147/293 (50.17%), Postives = 193/293 (65.87%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD          +     Y Y++FESE SV  LL  C ++    +     +FK+SS + R K+VQVIPW+  DS + R+ S + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KTAKF+K +QIDPYLEDS+C  C   PG +FCR   CF+YFC  CW  W +  E L +H+PL R  K
Sbjct:  277 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESEKSVRALLQACTQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWH-WQHSMEILRHHRPLMRNQK 563          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q5R733|CPEB1_PONAB (Cytoplasmic polyadenylation element-binding protein 1 OS=Pongo abelii OX=9601 GN=CPEB1 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.054e-85
Identity = 143/293 (48.81%), Postives = 188/293 (64.16%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGE----FFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA   WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG LSV +P KD                Y Y++FE E SV  LL  C  +  +       +FK+SS + R K+VQVIPW+  DS + R+ S + +  +TVFVGALHGM+ A ALA ++N+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AVTA F+ +KT KF+K +QIDPYLEDS+C+ C   PG +FCR   CF+YFC  CW  W +  E L +H PL R  K
Sbjct:  200 IEREARLHRQAAAV----NEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG------YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLNPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWH-WRHSMEGLRHHSPLMRNQK 481          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q967R6|CPEB_APLCA (Cytoplasmic polyadenylation element-binding protein OS=Aplysia californica OX=6500 PE=1 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.521e-85
Identity = 139/289 (48.10%), Postives = 190/289 (65.74%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            I++AA L+R +A       EA+  WSG LP  +++   YS KVFLGGVPWD TE+ L +AF K+G+L + +P KD                Y +++F+ E SV  LL  C  + +NG  F+KISS + RSK+VQVIPW+  DS +    S + +S KTVFVGALHGM+TA AL  +M++LF NV++  +DTDK+KYPIGSGRVTFSS+KSYM+AV A F+ +KT KF+K +Q+DPYL D++C+ C    G YFCR   CF+Y C  CW  W +  +++  H+PL R  K
Sbjct:  414 IDRAARLHRNAAAV----GEASCTWSGHLPPRNHENPVYSPKVFLGGVPWDITESGLQAAFSKYGHLKIEWPGKDG---------------YVHLLFDVEKSVRSLLQACTHDFSNGDYFYKISSRRMRSKEVQVIPWVLADSNHVFQPSQRLESNKTVFVGALHGMITAEALGRIMSDLFGNVVYAGIDTDKHKYPIGSGRVTFSSRKSYMKAVQAAFVEIKTPKFTKKLQVDPYLGDAICSLCNSHQGNYFCRDLLCFKYLCRSCW-YWQHAPDSMRQHRPLTRNTK 682          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9YGX5|CPEB1_DANRE (Cytoplasmic polyadenylation element-binding protein 1 OS=Danio rerio OX=7955 GN=cpeb1 PE=1 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.709e-85
Identity = 141/293 (48.12%), Postives = 192/293 (65.53%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A+     NEA + WSG+LP   Y+   YS KVFLGGVPWD TE  L++ F  +G LSV +P KD          +     Y Y++FES+ SV  LL  C ++    E     +FK+SS + R KD QVIPW+  DS Y    S + D + TVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLED++C +C + PG +FCR   CF+Y+C  CW   H+  + L NH+PL R  K
Sbjct:  268 IEREAWLHRQAASI----NEATFTWSGQLPPRHYQNPVYSCKVFLGGVPWDITEAGLINTFKCYGPLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESDKSVRALLQDCTEDLLHPEGYSEYYFKMSSRRMRCKDAQVIPWVISDSNYVSCPSQRLDPRNTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTPKFTKKVQIDPYLEDAICQSCSREPGPFFCRDKTCFKYYCRSCWHRQHSM-DILSNHRPLMRNQK 554          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. TrEMBL
Match: A0A1W6I184 (Cytoplasmic polyadenylation element-binding protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1184.09 bits (3062), Expect = 0.000e+0
Identity = 582/582 (100.00%), Postives = 582/582 (100.00%), Query Frame = 1
Query:  280 MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKNDGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 2025
            MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKNDGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDLNSGSKYSASSNSLKGYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ
Sbjct:    1 MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKNDGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDLNSGSKYSASSNSLKGYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 582          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. TrEMBL
Match: A0A172M654 (CPEB1-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 3.888e-178
Identity = 252/252 (100.00%), Postives = 252/252 (100.00%), Query Frame = 1
Query:  433 GQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMA 1188
            GQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMA
Sbjct:    1 GQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMA 252          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. TrEMBL
Match: A0A4S2M7I8 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003395 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 4.307e-139
Identity = 206/351 (58.69%), Postives = 263/351 (74.93%), Query Frame = 1
Query:  973 NQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 2025
            NQ   +S HE    P +PT+QP +  S      +L +EIA L+  Y+  +  LESDIE+AA +YRTSA+ +AQK EAAY WSGKLP+   +   +SRKVFLGGVPWDST  DL+ AF +FG ++V +PQ+D +  +   + + S KGYCY+IF+ E SV  L+  C ++   GG+++ ISS +FR+KDVQVIPW+  DSQY ++G  +PD+K+TVF+GALHGM+TA AL  +MN+LF NVIF ALDTDKYKYPIGSGRV FSS KSY++AVTANF+ ++T+KF KTIQIDPYLEDS+CN+C  SPGIYFCR FECFRYFC  CWQ+WHN   +LF HKPLRRTFKPI + Q
Sbjct:  482 NQLNLSSYHETGILP-NPTQQPMASTS------NLNEEIARLAEPYKRFLCSLESDIERAANVYRTSASTLAQKREAAYHWSGKLPVRVCRSMAFSRKVFLGGVPWDSTSEDLIMAFSRFGNVTVSWPQQDGSQFNAIRSRNPSPKGYCYLIFDHESSVTDLIDACIRDPTRGGDYYTISSSRFRAKDVQVIPWVISDSQYTKSGPYRPDTKRTVFIGALHGMITAEALVTIMNDLFGNVIFAALDTDKYKYPIGSGRVAFSSYKSYLKAVTANFVDIRTSKFIKTIQIDPYLEDSLCNSCQHSPGIYFCRDFECFRYFCPACWQLWHNSTGSLFAHKPLRRTFKPIPERQ 825          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. TrEMBL
Match: A0A4S2M6A6 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003395 PE=4 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 3.783e-138
Identity = 206/351 (58.69%), Postives = 263/351 (74.93%), Query Frame = 1
Query:  973 NQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 2025
            NQ   +S HE    P +PT+QP +  S      +L +EIA L+  Y+  +  LESDIE+AA +YRTSA+ +AQK EAAY WSGKLP+   +   +SRKVFLGGVPWDST  DL+ AF +FG ++V +PQ+D +  +   + + S KGYCY+IF+ E SV  L+  C ++   GG+++ ISS +FR+KDVQVIPW+  DSQY ++G  +PD+K+TVF+GALHGM+TA AL  +MN+LF NVIF ALDTDKYKYPIGSGRV FSS KSY++AVTANF+ ++T+KF KTIQIDPYLEDS+CN+C  SPGIYFCR FECFRYFC  CWQ+WHN   +LF HKPLRRTFKPI + Q
Sbjct:  547 NQLNLSSYHETGILP-NPTQQPMASTS------NLNEEIARLAEPYKRFLCSLESDIERAANVYRTSASTLAQKREAAYHWSGKLPVRVCRSMAFSRKVFLGGVPWDSTSEDLIMAFSRFGNVTVSWPQQDGSQFNAIRSRNPSPKGYCYLIFDHESSVTDLIDACIRDPTRGGDYYTISSSRFRAKDVQVIPWVISDSQYTKSGPYRPDTKRTVFIGALHGMITAEALVTIMNDLFGNVIFAALDTDKYKYPIGSGRVAFSSYKSYLKAVTANFVDIRTSKFIKTIQIDPYLEDSLCNSCQHSPGIYFCRDFECFRYFCPACWQLWHNSTGSLFAHKPLRRTFKPIPERQ 890          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. TrEMBL
Match: A0A3R7JXC8 (Cytoplasmic polyadenylation element-binding protein 1 OS=Clonorchis sinensis OX=79923 GN=CPEB1 PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 8.613e-138
Identity = 200/333 (60.06%), Postives = 252/333 (75.68%), Query Frame = 1
Query: 1027 TEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 2025
            T+QP +  S      +L +EIA L+  Y+  +  LESDIE+AA  YRTSA+ +AQK EAAY WSGKLP+   +   +SRKVFLGGVPWDST  DL+ AF +FG ++V +PQ+D +  +   + + S KGYCY+IF+ E SV  L+  C ++   GG+++ ISS +FRSKDVQVIPW+  DSQY ++G  +PD+K+TVF+GALHGM+TA AL  +MN+LF NVIF ALDTDKYKYPIGSGRV FSS KSY++AVTANF+ ++T+KF KTIQIDPYLEDS+CN C  SPGIYFCR FECFRYFC  CWQ+WHN   +LF HKPLRRTFKPI + Q
Sbjct:  470 TQQPMASTS------NLNEEIARLAEPYKRFLCSLESDIERAANFYRTSASTLAQKREAAYHWSGKLPVRVCRSMAFSRKVFLGGVPWDSTSEDLIMAFSRFGNVTVSWPQQDGSQFNAIRSRNPSPKGYCYLIFDHESSVTDLIDACVRDPTRGGDYYTISSSRFRSKDVQVIPWVISDSQYTKSGPYRPDTKRTVFIGALHGMITAEALVTIMNDLFGNVIFAALDTDKYKYPIGSGRVAFSSYKSYLKAVTANFVDIRTSKFIKTIQIDPYLEDSLCNGCQHSPGIYFCRDFECFRYFCPACWQLWHNSTGSLFAHKPLRRTFKPIPERQ 796          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Cavefish
Match: cpeb1b (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:103023253])

HSP 1 Score: 295.819 bits (756), Expect = 3.008e-90
Identity = 147/293 (50.17%), Postives = 193/293 (65.87%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A+     NEA + WSG+LP  +YK   YS KVFLGGVPWD TE  L++ F  +G LSV +P KD          +     Y Y++FESE SV  LL  C ++    E     +FK+SS + R KDVQVIPW+  DS Y R  S + D   TVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDSMC  C + PG +FCR   CF+Y+C  CW  W +  + L NH+PL R  K
Sbjct:  278 IEREARLHRQAASI----NEATFTWSGQLPSRNYKNPVYSCKVFLGGVPWDITEAGLINTFNCYGPLSVEWPGKDGKHPRCPPKGNMPKG-YVYLVFESERSVRGLLQACTQDLLHPEGYSEYYFKMSSRRMRCKDVQVIPWVISDSNYVRCPSQRLDPSNTVFVGALHGMLNAEALASIMNDLFGGVMYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTPKFTKKVQIDPYLEDSMCQVCSRQPGPFFCRDQACFKYYCRSCWH-WQHSMDILSNHRPLMRNQK 564          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Cavefish
Match: cpeb1a (cytoplasmic polyadenylation element-binding protein 1 [Source:NCBI gene;Acc:103045388])

HSP 1 Score: 280.411 bits (716), Expect = 1.340e-84
Identity = 140/290 (48.28%), Postives = 185/290 (63.79%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEF----FKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRR 1998
            IE+ A L+R +A      NEA   W+G+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG L V +P KD                Y Y++FESE SV  LL  C +   +  ++    +K+SS + RSK VQVIPW+  DS + R  S +    +TVFVGALHGM+ A ALA++M ELF  V +  +DTDK+KYPIGSGRVTF +QKSY++AV+A F+ +KT+KF+K +QIDPYL+DSMC  C   PG +FCR   CF+Y+C  CW  W +  + L +H+PL R
Sbjct:  265 IERKAQLHRQAAAT----NEATCTWTGQLPPRNYKNPLYSCKVFLGGVPWDVTEASLLNTFSVFGPLKVEWPGKDGKHPRCPPQG------YVYLVFESEKSVKALLQACTQQHLHPADYLEYYYKMSSKRIRSKTVQVIPWVITDSNFVRCPSLRLFPSRTVFVGALHGMLNAEALAHIMEELFGGVTYAGIDTDKHKYPIGSGRVTFRNQKSYLKAVSAAFVEIKTSKFTKKVQIDPYLDDSMCQVCNSQPGPFFCRDQACFKYYCRSCWH-WQHSMDLLNSHRPLMR 543          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Cavefish
Match: cpeb1a (cytoplasmic polyadenylation element-binding protein 1 [Source:NCBI gene;Acc:103045388])

HSP 1 Score: 279.641 bits (714), Expect = 3.025e-84
Identity = 140/290 (48.28%), Postives = 185/290 (63.79%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEF----FKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRR 1998
            IE+ A L+R +A      NEA   W+G+LP  +YK   YS KVFLGGVPWD TE  L++ F  FG L V +P KD                Y Y++FESE SV  LL  C +   +  ++    +K+SS + RSK VQVIPW+  DS + R  S +    +TVFVGALHGM+ A ALA++M ELF  V +  +DTDK+KYPIGSGRVTF +QKSY++AV+A F+ +KT+KF+K +QIDPYL+DSMC  C   PG +FCR   CF+Y+C  CW  W +  + L +H+PL R
Sbjct:  272 IERKAQLHRQAAAT----NEATCTWTGQLPPRNYKNPLYSCKVFLGGVPWDVTEASLLNTFSVFGPLKVEWPGKDGKHPRCPPQG------YVYLVFESEKSVKALLQACTQQHLHPADYLEYYYKMSSKRIRSKTVQVIPWVITDSNFVRCPSLRLFPSRTVFVGALHGMLNAEALAHIMEELFGGVTYAGIDTDKHKYPIGSGRVTFRNQKSYLKAVSAAFVEIKTSKFTKKVQIDPYLDDSMCQVCNSQPGPFFCRDQACFKYYCRSCWH-WQHSMDLLNSHRPLMR 550          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000057037.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000743.1:747:25198:1 gene:ENSAMXG00000013453.2 transcript:ENSAMXT00000057037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 2.544e-47
Identity = 95/257 (36.96%), Postives = 149/257 (57.98%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            +V +YSRKVF+GG+P D  E+++ ++F +FG L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  136 RVERYSRKVFVGGLPPDIDEDEITASFRRFGPLFVDWPHK------AESKSYFPPKGYAFLLFQDESSVQALIDACI--EEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 383          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Cavefish
Match: cpeb4a (cytoplasmic polyadenylation element-binding protein 4 [Source:NCBI gene;Acc:103023840])

HSP 1 Score: 177.563 bits (449), Expect = 2.933e-46
Identity = 94/257 (36.58%), Postives = 150/257 (58.37%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            ++ +YSRKVF+GG+P D  E+++ ++F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C + E  G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  454 RIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHK------AESKSYFPPKGYAFLLFQEESSVQALIDACMEEE--GKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 701          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009811.1 (pep scaffold:Pmarinus_7.0:GL480497:1015:8265:1 gene:ENSPMAG00000008870.1 transcript:ENSPMAT00000009811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.263 bits (726), Expect = 1.347e-88
Identity = 143/293 (48.81%), Postives = 186/293 (63.48%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      +EA   WSG+LP  S+K   +S KVFLGGVPWD TE  L++ F  FG +SV +P KD                Y YI+FESE SV  LL  C  +    +  G  ++K+SS + R K+VQVIPW+  DS Y R+ S + D  KTVFVGALHGM+ A  L  +MN+LF  V++  +DTDK++YPIGSGRVTF++ KSYM+AV A FI +KT KF+K +Q+DPYLE+S+C  C    G YFCR   CF+YFC  CW  W +  ETL +H+PL R  K
Sbjct:  114 IEQQARLHRQAAAV----SEATCTWSGQLPPRSHKSPIFSPKVFLGGVPWDITEAGLINCFKMFGSVSVEWPGKDGKHPRYPPKG------YVYILFESEKSVRALLQACTHDFRSSDGCGDYYYKVSSRRMRCKEVQVIPWVLSDSNYVRSQSQRLDPSKTVFVGALHGMLNAEGLTTIMNDLFGGVVYAGIDTDKHRYPIGSGRVTFNNHKSYMKAVNAAFIEIKTPKFTKKLQVDPYLEESICQLCCSQAGPYFCREMACFKYFCKSCWH-WQHSLETLRHHQPLMRNQK 395          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Sea Lamprey
Match: cpeb4a (cytoplasmic polyadenylation element binding protein 4a [Source:NCBI gene;Acc:393956])

HSP 1 Score: 173.326 bits (438), Expect = 1.680e-48
Identity = 96/256 (37.50%), Postives = 146/256 (57.03%), Query Frame = 1
Query: 1246 VCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            V +YSRKVF+GG+P D  E+++ ++F +FG L V +P K        S S    KGY +++F+ E SV  L+  C K E     +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D MC+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:   60 VERYSRKVFVGGLPPDIDEDEITASFRRFGMLVVDWPHK------AESKSYFPPKGYAFLLFQEESSVQALIDACIKEEDK--LYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEHCWASIHSRAGREF-HKPL 306          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Nematostella
Match: EDO46538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN2])

HSP 1 Score: 196.438 bits (498), Expect = 1.162e-58
Identity = 84/156 (53.85%), Postives = 111/156 (71.15%), Query Frame = 1
Query: 1525 RSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            R K+VQVIPW+  D+ Y R    + D+  TVFVG LHGM+ A  LA +MNELF  V++  +DTDK++YPIGSGRVTF + KS+M AV A FI ++T KF+K +Q+DPYLEDS+C  C  +PG +FCR   CFRY+C  CW +WH+  E   +H+PL
Sbjct:    2 RCKEVQVIPWVLSDTNYVRGPHQRLDTSWTVFVGGLHGMLNAEGLAYIMNELFGGVVYAGIDTDKHRYPIGSGRVTFDNHKSFMNAVRAGFIEIETPKFTKKVQVDPYLEDSLCETCHSTPGPFFCREESCFRYYCHSCW-LWHHSIEGFRDHRPL 156          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Nematostella
Match: EDO48703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIG6])

HSP 1 Score: 166.392 bits (420), Expect = 1.918e-46
Identity = 90/259 (34.75%), Postives = 149/259 (57.53%), Query Frame = 1
Query: 1237 SYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            S  + ++SRKVF+GG+P D  E+++ ++F +FG L+V +P K        S S    KGY ++++  E SV +L+S C + +     +  +SSP  + K VQ+ PW   D+ +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +D D + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW + H+R    F HKPL
Sbjct:    6 SEHIPRFSRKVFVGGLPPDIDEDEIHASFCRFGSLTVDWPHK------AESKSYFPPKGYAFLLYLEEISVQKLISACFRQDDK--LYLCVSSPTIKDKPVQIRPWNLADADFVMDGSQALDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYAGIDVDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECHGARCAGKFAPFFCANVTCLQYYCEQCWAIIHSRAGREF-HKPL 255          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Nematostella
Match: EDO28156 (pep supercontig:ASM20922v1:NEMVEscaffold_2549:12231:13210:-1 gene:NEMVEDRAFT_v1g148668 transcript:EDO28156 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 1.465e-6
Identity = 21/62 (33.87%), Postives = 34/62 (54.84%), Query Frame = 1
Query: 1825 KTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW + H+R    F HKPL
Sbjct:    9 KRVEVKPYVLDDQLCDECHGARCAGKFAPFFCANVTCLQYYCEQCWAIIHSRAGREF-HKPL 69          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Medaka
Match: cpeb1b (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:100049325])

HSP 1 Score: 293.893 bits (751), Expect = 1.820e-89
Identity = 145/293 (49.49%), Postives = 194/293 (66.21%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA + WSG+LP  + K   YS KVFLGGVPWD TE  L++ F  +G L+V +P KD          + +   Y Y++FE+E SV  LL  C ++    E N   +FK+SS + R KDVQVIPW+  DS Y R  + + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDSMC  C + PG +FCR   CF+Y+C  CW  W +  + L NH+PL R  K
Sbjct:  286 IEREARLHRQAAAV----NEATFTWSGQLPPRNNKDPLYSCKVFLGGVPWDITEAGLINTFSGYGPLTVEWPGKDGKHPRCPPKGNVAKG-YVYLVFENEKSVRSLLQACSQDPFHPEDNREYYFKMSSRRMRCKDVQVIPWVISDSNYVRCPAQRLDPCKTVFVGALHGMLNAEALASIMNDLFGGVMYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTPKFTKKVQIDPYLEDSMCQICLRQPGPFFCRDQACFKYYCRSCWH-WQHSMDILSNHRPLMRNQK 572          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Medaka
Match: cpeb1b (cytoplasmic polyadenylation element binding protein 1 [Source:NCBI gene;Acc:100049325])

HSP 1 Score: 293.893 bits (751), Expect = 2.829e-89
Identity = 145/293 (49.49%), Postives = 192/293 (65.53%), Query Frame = 1
Query: 1141 IEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKN----EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFK 2007
            IE+ A L+R +A      NEA + WSG+LP  + K   YS KVFLGGVPWD TE  L++ F  +G L+V +P KD                Y Y++FE+E SV  LL  C ++    E N   +FK+SS + R KDVQVIPW+  DS Y R  + + D  KTVFVGALHGM+ A ALA++MN+LF  V++  +DTDK+KYPIGSGRVTF++Q+SY++AV+A F+ +KT KF+K +QIDPYLEDSMC  C + PG +FCR   CF+Y+C  CW  W +  + L NH+PL R  K
Sbjct:  298 IEREARLHRQAAAV----NEATFTWSGQLPPRNNKDPLYSCKVFLGGVPWDITEAGLINTFSGYGPLTVEWPGKDGKHPRCPPKG------YVYLVFENEKSVRSLLQACSQDPFHPEDNREYYFKMSSRRMRCKDVQVIPWVISDSNYVRCPAQRLDPCKTVFVGALHGMLNAEALASIMNDLFGGVMYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTPKFTKKVQIDPYLEDSMCQICLRQPGPFFCRDQACFKYYCRSCWH-WQHSMDILSNHRPLMRNQK 579          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Medaka
Match: cpeb4a (cytoplasmic polyadenylation element-binding protein 4-like [Source:NCBI gene;Acc:101160327])

HSP 1 Score: 174.481 bits (441), Expect = 3.267e-48
Identity = 94/261 (36.02%), Postives = 151/261 (57.85%), Query Frame = 1
Query: 1231 ITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            +   +V +YSRKVF+GG+P D  E+++ ++F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C +   +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:   56 LNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHK------AESKSYFPPKGYAFLLFQDESSVQALIDACIQE--DGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 307          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Medaka
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:NCBI gene;Acc:101172999])

HSP 1 Score: 177.563 bits (449), Expect = 3.767e-46
Identity = 95/257 (36.96%), Postives = 150/257 (58.37%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            +V +YSRKVF+GG+P D  E+++ ++F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  479 RVERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHK------AESKSYFPPKGYAFLLFQDESSVQALIDACI--EEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 726          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Medaka
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:NCBI gene;Acc:101172999])

HSP 1 Score: 177.563 bits (449), Expect = 3.767e-46
Identity = 95/257 (36.96%), Postives = 150/257 (58.37%), Query Frame = 1
Query: 1243 KVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 1992
            +V +YSRKVF+GG+P D  E+++ ++F +FG+L V +P K        S S    KGY +++F+ E SV  L+  C   E +G  +  +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V +  +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++  +  K +++ PY L+D +C+ C  +        +FC +  C +Y+C  CW   H+R    F HKPL
Sbjct:  479 RVERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHK------AESKSYFPPKGYAFLLFQDESSVQALIDACI--EEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREF-HKPL 726          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Planmine SMEST
Match: SMESG000055011.1 (SMESG000055011.1)

HSP 1 Score: 1184.09 bits (3062), Expect = 0.000e+0
Identity = 582/582 (100.00%), Postives = 582/582 (100.00%), Query Frame = 1
Query:  280 MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKNDGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 2025
            MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKNDGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDLNSGSKYSASSNSLKGYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ
Sbjct:    1 MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKNDGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLTNHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANGINDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQNAVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPTEQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSATAMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDLNSGSKYSASSNSLKGYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ 582          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Planmine SMEST
Match: SMESG000055629.1 (SMESG000055629.1)

HSP 1 Score: 176.792 bits (447), Expect = 8.041e-46
Identity = 96/256 (37.50%), Postives = 149/256 (58.20%), Query Frame = 1
Query: 1252 QYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRR 1998
            +YSRKVF+GG+P D  E ++ +AF +FG L V +P K        S S    KGYC+++F+ E SV  L+  C  +E+    ++ +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V ++ +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D MC+ C  S        +FC +  C +Y+C  CW   H+R    + HKPL +
Sbjct:  574 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHK------AESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESK--YYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREY-HKPLVK 820          
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Planmine SMEST
Match: SMESG000055629.1 (SMESG000055629.1)

HSP 1 Score: 176.792 bits (447), Expect = 1.003e-45
Identity = 96/256 (37.50%), Postives = 149/256 (58.20%), Query Frame = 1
Query: 1252 QYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDXXXXXXXXXXXXXXXXYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPLRR 1998
            +YSRKVF+GG+P D  E ++ +AF +FG L V +P K        S S    KGYC+++F+ E SV  L+  C  +E+    ++ +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V ++ +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D MC+ C  S        +FC +  C +Y+C  CW   H+R    + HKPL +
Sbjct:  586 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHK------AESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESK--YYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREY-HKPLVK 832          
The following BLAST results are available for this feature:
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPEB17.421e-8748.81cytoplasmic polyadenylation element binding protei... [more]
CPEB17.421e-8748.81cytoplasmic polyadenylation element binding protei... [more]
CPEB11.112e-8648.81cytoplasmic polyadenylation element binding protei... [more]
CPEB11.112e-8648.81cytoplasmic polyadenylation element binding protei... [more]
CPEB11.112e-8648.81cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb-32.064e-6040.14Cytoplasmic polyadenylation element-binding protei... [more]
cpb-13.322e-3529.07Cytoplasmic polyadenylation element-binding protei... [more]
cpb-21.853e-2531.66Cytoplasmic polyadenylation element-binding protei... [more]
fog-13.975e-1932.27Feminization Of Germline [Source:UniProtKB/TrEMBL... [more]
fog-12.682e-1733.93Feminization Of Germline [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orb9.686e-9246.91gene:FBgn0004882 transcript:FBtr0084386[more]
orb9.686e-9246.91gene:FBgn0004882 transcript:FBtr0100228[more]
orb1.687e-9146.91gene:FBgn0004882 transcript:FBtr0301491[more]
orb6.118e-8946.91gene:FBgn0004882 transcript:FBtr0100227[more]
orb6.118e-8946.91gene:FBgn0004882 transcript:FBtr0084385[more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpeb1b2.264e-8648.12cytoplasmic polyadenylation element binding protei... [more]
cpeb1a3.206e-8547.46cytoplasmic polyadenylation element binding protei... [more]
cpeb22.882e-4736.58cytoplasmic polyadenylation element binding protei... [more]
cpeb25.327e-4736.58cytoplasmic polyadenylation element binding protei... [more]
cpeb4a1.038e-4636.58cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpeb13.824e-9050.17cytoplasmic polyadenylation element binding protei... [more]
cpeb12.262e-8950.17cytoplasmic polyadenylation element binding protei... [more]
cpeb12.550e-8950.17cytoplasmic polyadenylation element binding protei... [more]
cpeb14.525e-8950.17cytoplasmic polyadenylation element binding protei... [more]
cpeb12.244e-5941.64cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpeb11.047e-8448.81cytoplasmic polyadenylation element binding protei... [more]
Cpeb11.426e-8448.81cytoplasmic polyadenylation element binding protei... [more]
Cpeb11.574e-8448.81cytoplasmic polyadenylation element binding protei... [more]
Cpeb41.825e-4736.96cytoplasmic polyadenylation element binding protei... [more]
Cpeb36.354e-4737.35cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91572|CPE1A_XENLA1.317e-8850.17Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q52KN7|CPE1B_XENLA1.606e-8850.17Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q5R733|CPEB1_PONAB1.054e-8548.81Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q967R6|CPEB_APLCA1.521e-8548.10Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q9YGX5|CPEB1_DANRE1.709e-8548.12Cytoplasmic polyadenylation element-binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W6I1840.000e+0100.00Cytoplasmic polyadenylation element-binding protei... [more]
A0A172M6543.888e-178100.00CPEB1-like protein (Fragment) OS=Schmidtea mediter... [more]
A0A4S2M7I84.307e-13958.69RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2M6A63.783e-13858.69RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A3R7JXC88.613e-13860.06Cytoplasmic polyadenylation element-binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpeb1b3.008e-9050.17cytoplasmic polyadenylation element binding protei... [more]
cpeb1a1.340e-8448.28cytoplasmic polyadenylation element-binding protei... [more]
cpeb1a3.025e-8448.28cytoplasmic polyadenylation element-binding protei... [more]
ENSAMXT00000057037.12.544e-4736.96pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
cpeb4a2.933e-4636.58cytoplasmic polyadenylation element-binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009811.11.347e-8848.81pep scaffold:Pmarinus_7.0:GL480497:1015:8265:1 gen... [more]
cpeb4a1.680e-4837.50cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO465381.162e-5853.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487031.918e-4634.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281561.465e-633.87pep supercontig:ASM20922v1:NEMVEscaffold_2549:1223... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpeb1b1.820e-8949.49cytoplasmic polyadenylation element binding protei... [more]
cpeb1b2.829e-8949.49cytoplasmic polyadenylation element binding protei... [more]
cpeb4a3.267e-4836.02cytoplasmic polyadenylation element-binding protei... [more]
CPEB43.767e-4636.96cytoplasmic polyadenylation element binding protei... [more]
CPEB43.767e-4636.96cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055011.10.000e+0100.00SMESG000055011.1[more]
SMESG000055629.18.041e-4637.50SMESG000055629.1[more]
SMESG000055629.11.003e-4537.50SMESG000055629.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018862 ID=SMED30018862|Name=Cytoplasmic polyadenylation element-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2374bp
CAAATATACACGAAATATTATTCAATTTGGTGTTTTTCATTAAAATTTAT
ATAAATATCCCAATTAATTTAATTTTTTAAAAGGAAAAATAAGATTGCCA
TTTTTATCCTATCGTTGCTTATAATTATCTGCATTTTCATTGGTCGCACA
CGCATTGCACACGCACATGGCACACTCGCACATTTAGTAATAGACATGTT
AGTATTTCCATTGTTGTTTAAAAGACGTTTGGATTTGTGATAAGGTTTAT
TTTAAAAAAAATTGATTAACAAAACCAATATGGAGGAACCGAAATATTTA
AACTCCAGCCTTAAAGACATTTGGAATACATTTTCAGATAAAGAAATGCA
TCATGGATATGAAGAAACCAAGTTATCCACGAAAGAATCCATTGATGATA
TTTTGACAAGTTATAGAAGCTTTAAAAATGATGGACAAATCTCTTATGTG
AACAATAACAATTTGTATCCATTGAAAAACACTGGATGTTTACTTGATGA
CAGTCCAGATAGTTCTAGACTGAATTGGCAATCGTCATTAGAGAATTTAT
CTATGCCTACAGTAAAACCATCTTTAACAAATCATAGTTTTATTGAAACA
AATCCTCAACATTTTGACATACAAAAGCTGCTGAATTTTCATAAACCAGA
CAATATTGGCCGAGAAAATCGTCGTTTTAAATCAGAAACTGATGCTATGG
ATATCTTAACCGCGAGTTTAGCCAATGGAATAAACGACAAAGTCCTAAAT
ACTATATTAGAAAATTTTATTGCGTCATCCAACCAAAAGGACTTTTTTGC
CAAAAGCAATGTCGTCAAGACGATTAATAATATTCTACAAAAGCCCCTGA
CAAAGCATCAATATCAACGAGTACAAAATGCGGTTTTGACCATTTATGGA
AAGAGCAATAATTACTATAACGATCCGCTGCAAGGATTTTACAACCAAGA
ACTATTAATGCTTTTATTGAAAAATCAACAAACATTTAATTCTCAACACG
AAAGACTAAGTGAGCCGATTCATCCGACAGAACAGCCGAAGTCTCACATC
TCGACAAGTGCTAATCCAATTTCGTTGAAAGACGAAATTGCAATGCTGTC
AATGTCATATCGAAATATGATGGGGATATTAGAAAGCGACATTGAGAAAG
CGGCCACTCTCTATCGGACTTCAGCAACGGCAATGGCCCAGAAAAACGAG
GCAGCTTACCAGTGGTCAGGAAAATTACCGATTACATCGTACAAAGTATG
TCAATATTCACGAAAAGTATTCCTAGGCGGAGTCCCTTGGGATAGTACTG
AAAATGATCTTATGTCGGCCTTCATAAAATTTGGTTATCTATCCGTTATG
TTTCCACAGAAAGATTTGAACAGTGGTTCAAAATATAGCGCTTCATCGAA
TAGCTTAAAAGGATATTGCTATATCATATTTGAATCAGAAGATTCAGTCG
CTCGCTTGCTAAGTCAATGTTGTAAAAACGAAGCGAATGGAGGAGAATTT
TTCAAAATTTCCAGCCCGAAATTTCGATCAAAAGATGTCCAAGTGATTCC
ATGGATTACTCAAGACAGTCAGTATTGCCGGACCGGATCACCAAAGCCTG
ATTCTAAGAAAACGGTTTTTGTTGGTGCATTACATGGAATGATGACTGCA
TACGCTTTAGCCAATGTTATGAATGAATTATTTGACAATGTCATCTTTAC
TGCTCTCGATACTGACAAATATAAATATCCAATTGGATCCGGACGAGTAA
CTTTTTCCAGTCAAAAAAGTTATATGCGGGCAGTCACTGCAAATTTTATT
CACGTGAAAACTGCAAAATTTAGCAAAACGATCCAGATTGATCCTTATTT
AGAAGATTCAATGTGCAATAACTGCTTTCAATCTCCAGGTATTTATTTTT
GTCGATCGTTTGAGTGCTTCCGGTATTTCTGTTCCGGATGCTGGCAAGTG
TGGCACAATCGCTGTGAAACACTATTTAACCATAAACCCCTGCGGCGAAC
ATTTAAACCGATTTTTGATTTTCAATAATCACTTTATCTATGAATTCTGG
CACCGATTTGATTTATAACTTTGCCTTATATTTTACGCTTATTTTTATTA
GCTGAAATACTGTCTAATCTTTTTCGTTTATGCAAATTGTTTTATATTCA
ATTTTTATTTTTTTATTGATAAAAATGTTTCATTGAATCGCAAGTTCTAC
CATTGAACTTCAGTTTGGTTTCCTAGGTTTTATGACACTGATTTTTGTTG
ATTTTTATGACAATATGATTTTTAATGACATTGCATATGTAAGGGAAAAT
CTGGTTCCAGATTCATATGTATATTTCTATTGTATGATTTGGAATAAATT
TTTGGACAACTCGGTAAAAAAAAA
back to top

protein sequence of SMED30018862-orf-1

>SMED30018862-orf-1 ID=SMED30018862-orf-1|Name=SMED30018862-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=583bp
MEEPKYLNSSLKDIWNTFSDKEMHHGYEETKLSTKESIDDILTSYRSFKN
DGQISYVNNNNLYPLKNTGCLLDDSPDSSRLNWQSSLENLSMPTVKPSLT
NHSFIETNPQHFDIQKLLNFHKPDNIGRENRRFKSETDAMDILTASLANG
INDKVLNTILENFIASSNQKDFFAKSNVVKTINNILQKPLTKHQYQRVQN
AVLTIYGKSNNYYNDPLQGFYNQELLMLLLKNQQTFNSQHERLSEPIHPT
EQPKSHISTSANPISLKDEIAMLSMSYRNMMGILESDIEKAATLYRTSAT
AMAQKNEAAYQWSGKLPITSYKVCQYSRKVFLGGVPWDSTENDLMSAFIK
FGYLSVMFPQKDLNSGSKYSASSNSLKGYCYIIFESEDSVARLLSQCCKN
EANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGA
LHGMMTAYALANVMNELFDNVIFTALDTDKYKYPIGSGRVTFSSQKSYMR
AVTANFIHVKTAKFSKTIQIDPYLEDSMCNNCFQSPGIYFCRSFECFRYF
CSGCWQVWHNRCETLFNHKPLRRTFKPIFDFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003730mRNA 3'-UTR binding
GO:0045182translation regulator activity
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR038446CEBP_ZZ_sf
IPR034819CPEB
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR032296CEBP_ZZ
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 329..411
e-value: 5.5E-4
score: 29.2
coord: 445..521
e-value: 3.1
score: 2.1
IPR000504RNA recognition motif domainPFAMPF16367RRM_7coord: 327..424
e-value: 1.6E-26
score: 92.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 328..422
score: 11.759
IPR038446CEBP, ZZ domain superfamilyGENE3DG3DSA:3.30.40.130coord: 521..578
e-value: 2.0E-20
score: 74.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 328..424
e-value: 6.6E-20
score: 73.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 428..520
e-value: 1.7E-23
score: 84.6
IPR032296Cytoplasmic polyadenylation element-binding protein, ZZ domainPFAMPF16366CEBP_ZZcoord: 516..573
e-value: 6.6E-21
score: 74.3
NoneNo IPR availablePANTHERPTHR12566:SF9CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTEIN 1coord: 138..576
NoneNo IPR availableCDDcd12725RRM2_CPEB1coord: 441..526
e-value: 1.27864E-50
score: 167.186
IPR034819Cytoplasmic polyadenylation element-binding proteinPANTHERPTHR12566CYTOPLASMIC POLYADENYLATION ELEMENT BINDING PROTEIN CPEBcoord: 138..576
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 327..503