Kinesin light chain

Overview
NameKinesin light chain
Smed IDSMED30018861
Length (bp)2384
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin light chain (SMED30018861) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin light chain (SMED30018861) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin light chain (SMED30018861) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin light chain (SMED30018861) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018861

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30018861SMESG000010732.1 dd_Smed_v4_8806_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018861SMESG000010732.1 dd_Smed_v6_8806_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018861SMESG000024267.1 SMESG000010732.1 OX_Smed_1.0.11088ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30018861SMESG000010732.1 dd_Smed_v4_8806_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 474.552 bits (1220), Expect = 8.778e-159
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 474.552 bits (1220), Expect = 8.778e-159
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 474.552 bits (1220), Expect = 8.778e-159
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 474.167 bits (1219), Expect = 1.109e-158
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 474.937 bits (1221), Expect = 1.527e-158
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 446.047 bits (1146), Expect = 1.393e-148
Identity = 276/492 (56.10%), Postives = 351/492 (71.34%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD----CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD--TPDSGKDPSINGSDKVDNLS-SDLGFTDEDKDQEPNDXXXXXXXXXXXHGS---GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            ++K SN+S D++ +  ++    LE+L+ +H  +I+N  E     G   D       K+     +L+K+  G++E  L++ +++  Q  +++  K + Q  RL QEN WLRDEL++TQ +L+ SE+ V QLEEENK + +M  ++++D  T    K     G   V N +  +LGF  ED++        Q   ++    S   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLN+AL+IREK LG  H AVAATLNNLAVL+GKRG++K+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K GPDDPNVAKTK NL++AYLKQ K+ +AE LYK+ILTR HE+EFG+ + + KPIW +AEER+E   K  E    +    W K++++D+ TV TTLKNL ALYRRQ K EAAET+E+   R+K
Sbjct:   19 LAKMSNMSQDDVTTGLRTVQQGLEALREEHS-TISNTLE-TSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAK 507          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 446.047 bits (1146), Expect = 1.393e-148
Identity = 276/492 (56.10%), Postives = 351/492 (71.34%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD----CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD--TPDSGKDPSINGSDKVDNLS-SDLGFTDEDKDQEPNDXXXXXXXXXXXHGS---GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            ++K SN+S D++ +  ++    LE+L+ +H  +I+N  E     G   D       K+     +L+K+  G++E  L++ +++  Q  +++  K + Q  RL QEN WLRDEL++TQ +L+ SE+ V QLEEENK + +M  ++++D  T    K     G   V N +  +LGF  ED++        Q   ++    S   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLN+AL+IREK LG  H AVAATLNNLAVL+GKRG++K+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K GPDDPNVAKTK NL++AYLKQ K+ +AE LYK+ILTR HE+EFG+ + + KPIW +AEER+E   K  E    +    W K++++D+ TV TTLKNL ALYRRQ K EAAET+E+   R+K
Sbjct:   19 LAKMSNMSQDDVTTGLRTVQQGLEALREEHS-TISNTLE-TSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAK 507          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 443.351 bits (1139), Expect = 7.795e-148
Identity = 275/488 (56.35%), Postives = 348/488 (71.31%), Query Frame = 3
Query:   15 SNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD----CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD--TPDSGKDPSINGSDKVDNLS-SDLGFTDEDKDQEPNDXXXXXXXXXXXHGS---GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            SN+S D++ +  ++    LE+L+ +H  +I+N  E     G   D       K+     +L+K+  G++E  L++ +++  Q  +++  K + Q  RL QEN WLRDEL++TQ +L+ SE+ V QLEEENK + +M  ++++D  T    K     G   V N +  +LGF  ED++        Q   ++    S   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLN+AL+IREK LG  H AVAATLNNLAVL+GKRG++K+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K GPDDPNVAKTK NL++AYLKQ K+ +AE LYK+ILTR HE+EFG+ + + KPIW +AEER+E   K  E    +    W K++++D+ TV TTLKNL ALYRRQ K EAAET+E+   R+K
Sbjct:    2 SNMSQDDVTTGLRTVQQGLEALREEHS-TISNTLE-TSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAK 486          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 443.351 bits (1139), Expect = 7.795e-148
Identity = 275/488 (56.35%), Postives = 348/488 (71.31%), Query Frame = 3
Query:   15 SNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD----CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD--TPDSGKDPSINGSDKVDNLS-SDLGFTDEDKDQEPNDXXXXXXXXXXXHGS---GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            SN+S D++ +  ++    LE+L+ +H  +I+N  E     G   D       K+     +L+K+  G++E  L++ +++  Q  +++  K + Q  RL QEN WLRDEL++TQ +L+ SE+ V QLEEENK + +M  ++++D  T    K     G   V N +  +LGF  ED++        Q   ++    S   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLN+AL+IREK LG  H AVAATLNNLAVL+GKRG++K+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K GPDDPNVAKTK NL++AYLKQ K+ +AE LYK+ILTR HE+EFG+ + + KPIW +AEER+E   K  E    +    W K++++D+ TV TTLKNL ALYRRQ K EAAET+E+   R+K
Sbjct:    2 SNMSQDDVTTGLRTVQQGLEALREEHS-TISNTLE-TSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAK 486          
BLAST of Kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 444.121 bits (1141), Expect = 1.399e-147
Identity = 275/488 (56.35%), Postives = 348/488 (71.31%), Query Frame = 3
Query:   15 SNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD----CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD--TPDSGKDPSINGSDKVDNLS-SDLGFTDEDKDQEPNDXXXXXXXXXXXHGS---GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            SN+S D++ +  ++    LE+L+ +H  +I+N  E     G   D       K+     +L+K+  G++E  L++ +++  Q  +++  K + Q  RL QEN WLRDEL++TQ +L+ SE+ V QLEEENK + +M  ++++D  T    K     G   V N +  +LGF  ED++        Q   ++    S   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLN+AL+IREK LG  H AVAATLNNLAVL+GKRG++K+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K GPDDPNVAKTK NL++AYLKQ K+ +AE LYK+ILTR HE+EFG+ + + KPIW +AEER+E   K  E    +    W K++++D+ TV TTLKNL ALYRRQ K EAAET+E+   R+K
Sbjct:    2 SNMSQDDVTTGLRTVQQGLEALREEHS-TISNTLE-TSVKGVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQPVTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENKPIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEDVALRAK 486          
BLAST of Kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0075951)

HSP 1 Score: 462.996 bits (1190), Expect = 2.845e-155
Identity = 285/480 (59.38%), Postives = 352/480 (73.33%), Query Frame = 3
Query:   15 SNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDP-SINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKE-IPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + +S DEI+++TK+ L  LE+L+ +H   +N      E   DN   D       +++  IELG+ EA++++ L   LQ  E+E++KLK Q+ RL+QEN WLRDEL  TQ + +ASE+ V QLEEE K + FM  ++KYD      D    + +D V  L     F DE+ +++ +++     S   +  SG+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE+ SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDAL+IR KTLG  H AVAATLNNLAVLYGKRG+YK+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKY+EVE YYQRAL+IY  K GPDDPNVAKTK NLA  YLKQ ++++AE LYK++LTR HE+EFG  + + KPIW +AEER+E    N+E  PY      WHK++++D+ TV TTLKNL ALYRRQ   EAAET+E+   RSK
Sbjct:    2 TQMSQDEIITNTKTVLQGLEALRVEHVSIMNGI---AEVQKDNEKSD----MLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVEL-----FPDEE-NEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPY-GEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSK 467          
BLAST of Kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331555)

HSP 1 Score: 462.996 bits (1190), Expect = 2.845e-155
Identity = 285/480 (59.38%), Postives = 352/480 (73.33%), Query Frame = 3
Query:   15 SNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDP-SINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKE-IPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + +S DEI+++TK+ L  LE+L+ +H   +N      E   DN   D       +++  IELG+ EA++++ L   LQ  E+E++KLK Q+ RL+QEN WLRDEL  TQ + +ASE+ V QLEEE K + FM  ++KYD      D    + +D V  L     F DE+ +++ +++     S   +  SG+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE+ SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDAL+IR KTLG  H AVAATLNNLAVLYGKRG+YK+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKY+EVE YYQRAL+IY  K GPDDPNVAKTK NLA  YLKQ ++++AE LYK++LTR HE+EFG  + + KPIW +AEER+E    N+E  PY      WHK++++D+ TV TTLKNL ALYRRQ   EAAET+E+   RSK
Sbjct:    2 TQMSQDEIITNTKTVLQGLEALRVEHVSIMNGI---AEVQKDNEKSD----MLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVEL-----FPDEE-NEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPY-GEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSK 467          
BLAST of Kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331556)

HSP 1 Score: 462.996 bits (1190), Expect = 2.936e-155
Identity = 285/480 (59.38%), Postives = 352/480 (73.33%), Query Frame = 3
Query:   15 SNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDP-SINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKE-IPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + +S DEI+++TK+ L  LE+L+ +H   +N      E   DN   D       +++  IELG+ EA++++ L   LQ  E+E++KLK Q+ RL+QEN WLRDEL  TQ + +ASE+ V QLEEE K + FM  ++KYD      D    + +D V  L     F DE+ +++ +++     S   +  SG+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE+ SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDAL+IR KTLG  H AVAATLNNLAVLYGKRG+YK+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKY+EVE YYQRAL+IY  K GPDDPNVAKTK NLA  YLKQ ++++AE LYK++LTR HE+EFG  + + KPIW +AEER+E    N+E  PY      WHK++++D+ TV TTLKNL ALYRRQ   EAAET+E+   RSK
Sbjct:    2 TQMSQDEIITNTKTVLQGLEALRVEHVSIMNGI---AEVQKDNEKSD----MLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVEL-----FPDEE-NEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPY-GEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSK 467          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 462.225 bits (1188), Expect = 1.196e-153
Identity = 281/467 (60.17%), Postives = 337/467 (72.16%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC---SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDK--VDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE-CFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            LS DE++  T+  +  LE+L+ +H   +        C   S +    + K    ++S+  +ELG+ EA++++ L   L   E+E+ KL+ Q+ RL QEN WLRDEL  TQ RL+ SE++V QLEEE K + FMN+++KYD   S  D   + S +  +D+L     F DE  +  P      S + + +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+E    K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   24 LSQDELLCRTREVMQGLEALRAEHQAILEGLMGTLRCLKQSQEGRAVEEKTAMIQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPSDDKDSDSSRETLDDL-----FPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREEQSKIKQKDGTPFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 485          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 462.611 bits (1189), Expect = 1.371e-153
Identity = 281/467 (60.17%), Postives = 337/467 (72.16%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC---SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDK--VDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE-CFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            LS DE++  T+  +  LE+L+ +H   +        C   S +    + K    ++S+  +ELG+ EA++++ L   L   E+E+ KL+ Q+ RL QEN WLRDEL  TQ RL+ SE++V QLEEE K + FMN+++KYD   S  D   + S +  +D+L     F DE  +  P      S + + +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+E    K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   24 LSQDELLCRTREVMQGLEALRAEHQAILEGLMGTLRCLKQSQEGRAVEEKTAMIQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPSDDKDSDSSRETLDDL-----FPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREEQSKIKQKDGTPFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 485          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 456.833 bits (1174), Expect = 3.670e-151
Identity = 280/482 (58.09%), Postives = 353/482 (73.24%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDT---KVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEI+S TK  +  LE+LK++H   + +  E  +C   + +      K     +S+  IELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +++ SE++V QLEEE K + FMN+++KYD   TP+  K+ S    D +D+L     F +++ DQ  +     + +++     G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDAL+IREKTLG  + AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG +HPDVAKQLNNLALLCQNQGKYEEVE YY RAL+IY ++ GPDDPNVAKTK NLA+ YLKQ K+ +AE LYKEILTR HE+EFG  + + KPIW+ AEER+E   K  +  +      W+K+ ++++ TV TTL+NL ALYR+Q K EAAET+E    RS+
Sbjct:   15 LTQDEIISSTKLVIQGLEALKSEHNSILQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKN-SDTPKDSLDDL-----FPNDEDDQVSHQHNSAAVAAAQQ--GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGREHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGCVDAENKPIWMHAEEREESKGKLADGNHYGEYGGWYKACKVNSPTVNTTLRNLGALYRKQGKLEAAETLEECAMRSR 488          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 456.833 bits (1174), Expect = 3.670e-151
Identity = 280/482 (58.09%), Postives = 353/482 (73.24%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDT---KVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEI+S TK  +  LE+LK++H   + +  E  +C   + +      K     +S+  IELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +++ SE++V QLEEE K + FMN+++KYD   TP+  K+ S    D +D+L     F +++ DQ  +     + +++     G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDAL+IREKTLG  + AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG +HPDVAKQLNNLALLCQNQGKYEEVE YY RAL+IY ++ GPDDPNVAKTK NLA+ YLKQ K+ +AE LYKEILTR HE+EFG  + + KPIW+ AEER+E   K  +  +      W+K+ ++++ TV TTL+NL ALYR+Q K EAAET+E    RS+
Sbjct:   15 LTQDEIISSTKLVIQGLEALKSEHNSILQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKN-SDTPKDSLDDL-----FPNDEDDQVSHQHNSAAVAAAQQ--GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGREHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGCVDAENKPIWMHAEEREESKGKLADGNHYGEYGGWYKACKVNSPTVNTTLRNLGALYRKQGKLEAAETLEECAMRSR 488          
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Match: klc3 (kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-060929-772])

HSP 1 Score: 386.726 bits (992), Expect = 1.255e-125
Identity = 254/453 (56.07%), Postives = 323/453 (71.30%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFRE--QFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSG---KDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEE------------RQECFTKNKEIPYLSSDNCWHK 1328
            LS +EI+  T+  +  LE+L+ ++   +++ +E  Q + S ++S    K     +SL +IELG+ EA++++ L   L   E+E+ KL+ Q+ RL QEN WLRDEL+  Q +L+  E+ V  LEE+N+ + FM+ +RKYD  ++    KD S +G + +D+L     F  E+++Q  +     S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK+SGH HPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG+DHPDVAKQLNNLALLCQNQGKY+EVE YY+RAL IY  + GPDD NVAKTK NLA+ YLKQ K+ +AE+LYKEILTR HE+EFG      +P+W+  EE            R   FTK +E    SS+    K
Sbjct:    2 LSGEEILCSTQQVIAGLEALRGENRTLLDSLQETLQSQTSSESSLEQEKTSIILESLERIELGLGEAQVMMALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSRAQQQLQEREQEVVTLEEQNRHLQFMSSIRKYDHEETSLEDKD-STSGKESLDDL-----FPTEEEEQ-THMSQPHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHSHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSQLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEKEFGSVEGDGRPVWIHTEEGSSRPDGLGNLKRSGSFTKLRESIRRSSEKLVRK 447          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 461.07 bits (1185), Expect = 7.148e-154
Identity = 292/483 (60.46%), Postives = 353/483 (73.08%), Query Frame = 3
Query:    9 KKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            K   L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   S  D   + S K    + D  F ++D D         S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+Y+EAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER++   K K+  +      W+K+ ++D+ TV TTLKNL ALYRRQ K EAA+T+E    RS+
Sbjct:   15 KLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSDDKDSDSSKE---TLDDLFPNDDDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQKDGTF-GEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSR 493          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 461.455 bits (1186), Expect = 4.383e-153
Identity = 291/479 (60.75%), Postives = 352/479 (73.49%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   S  D   + S K    + D  F ++D D         S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+Y+EAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER++   K K+  +      W+K+ ++D+ TV TTLKNL ALYRRQ K EAA+T+E    RS+
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSDDKDSDSSKE---TLDDLFPNDDDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQKDGTF-GEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSR 493          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 461.455 bits (1186), Expect = 4.666e-153
Identity = 291/479 (60.75%), Postives = 352/479 (73.49%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   S  D   + S K    + D  F ++D D         S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+Y+EAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER++   K K+  +      W+K+ ++D+ TV TTLKNL ALYRRQ K EAA+T+E    RS+
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSDDKDSDSSKE---TLDDLFPNDDDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQKDGTF-GEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSR 493          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 462.225 bits (1188), Expect = 5.127e-153
Identity = 291/479 (60.75%), Postives = 352/479 (73.49%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   S  D   + S K    + D  F ++D D         S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+Y+EAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER++   K K+  +      W+K+ ++D+ TV TTLKNL ALYRRQ K EAA+T+E    RS+
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSDDKDSDSSKE---TLDDLFPNDDDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQKDGTF-GEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSR 493          
BLAST of Kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 460.299 bits (1183), Expect = 1.133e-152
Identity = 292/483 (60.46%), Postives = 353/483 (73.08%), Query Frame = 3
Query:    9 KKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            K   L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   S  D   + S K    + D  F ++D D         S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+Y+EAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER++   K K+  +      W+K+ ++D+ TV TTLKNL ALYRRQ K EAA+T+E    RS+
Sbjct:   11 KLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSDDKDSDSSKE---TLDDLFPNDDDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREKFKGKQKDGTF-GEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSR 489          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 473.781 bits (1218), Expect = 8.529e-159
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED+  +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRAL IY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 473.781 bits (1218), Expect = 1.296e-158
Identity = 290/471 (61.57%), Postives = 343/471 (72.82%), Query Frame = 3
Query:    9 KKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            K   L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED+  +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRAL IY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   15 KLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 474.167 bits (1219), Expect = 4.561e-158
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED+  +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRAL IY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 473.396 bits (1217), Expect = 1.041e-157
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED+  +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRAL IY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 474.167 bits (1219), Expect = 1.094e-157
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED+  +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRAL IY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|P46825|KLC_DORPE (Kinesin light chain OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 2.553e-165
Identity = 297/488 (60.86%), Postives = 364/488 (74.59%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC----SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGF-TDEDKDQEPNDXXXXXXXXXXXHGSGF-EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + K + LS +EI+S+TK+ +  L++LKN+H Q +N+     +     +GD +  + K    ++S++ IELG+ EA++++ L   LQ +E+E+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V  +EEE K + FMNEM+KYDT ++     +N   + +  S DLGF  D+D   +P  +     S+     SG  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQGKY+EAANLLNDAL IREKTLGP H AVAATLNNLAVLYGKRG+YK+AEPLCKRAL+IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY ++ GPDDPNVAKTK NLA+AYLKQ K+ +AE LYKE+LTR HE+EFGK +   KPIW+ AEER+E   K K+         W K+ ++D+ TV TTLKNL ALYRRQ K EAAET+E    RS+
Sbjct:   18 IGKMTALSQEEIISNTKTVIQGLDTLKNEHNQILNSLLTSMKTIRKENGDTNLVEEKANILKKSVDSIELGLGEAQVMMALANHLQHTEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQMSEQKVATIEEEKKHLEFMNEMKKYDTNEA----QVNEEKESEQSSLDLGFPDDDDDGGQPEVLSPTQPSAMAQAASGGCEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALVIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVERYYQRALEIYQKELGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDDDNKPIWMQAEEREENKAKYKDGAPQPDYGSWLKAVKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECALRSR 501          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|P37285|KLC1_RAT (Kinesin light chain 1 OS=Rattus norvegicus OX=10116 GN=Klc1 PE=1 SV=2)

HSP 1 Score: 474.937 bits (1221), Expect = 3.219e-158
Identity = 290/467 (62.10%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|Q07866|KLC1_HUMAN (Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2)

HSP 1 Score: 473.396 bits (1217), Expect = 2.018e-157
Identity = 289/467 (61.88%), Postives = 342/467 (73.23%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|Q5R581|KLC1_PONAB (Kinesin light chain 1 OS=Pongo abelii OX=9601 GN=KLC1 PE=2 SV=3)

HSP 1 Score: 471.085 bits (1211), Expect = 1.166e-156
Identity = 288/467 (61.67%), Postives = 341/467 (73.02%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            L+ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     +D       DL   DED   +       S +++   G  +EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   19 LTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----TDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGD-YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 479          
BLAST of Kinesin light chain vs. UniProt/SwissProt
Match: sp|O88447|KLC1_MOUSE (Kinesin light chain 1 OS=Mus musculus OX=10090 GN=Klc1 PE=1 SV=3)

HSP 1 Score: 465.307 bits (1196), Expect = 1.025e-154
Identity = 289/472 (61.23%), Postives = 341/472 (72.25%), Query Frame = 3
Query:    9 KKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC--SGDNSD-CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPD-DPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            K  N++ DEI+S TK  +  LE+LKN+H   + +  E  +C    D S+  + K     +SL  +ELG+ EA++++ L   L   ESE+  ++ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   DED   EP   +  S SS+ +   G+EIPARLRTLHNLVIQYASQGRYEVAVP CKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY++AANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRAL IY  K GPD  PNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE EFG  + + KPIW+ AEER+EC  K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   15 KLENVTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQNVRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKD-----SDSSKEPLDDLFPNDED---EPGQGIQHSDSSAAAARQGYEIPARLRTLHNLVIQYASQGRYEVAVPSCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDRTPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEAEFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 478          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A2T7NXK4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13563 PE=4 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 6.809e-166
Identity = 308/497 (61.97%), Postives = 367/497 (73.84%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC----SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSS---DLGF-TDEDKDQEPNDXXXXXXXXXXXHGSG-FEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSD 1466
            + K + LS DEIVS TK+ +  LE+LKN+H Q +N+     +     SGD +  + K    ++SL  IELGI EA+++I L +  Q  E+E+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V  L+EE + + FMNEM+KYDT DS    +++  +K     S   DLGF  D+D    P  +      +  S  SG +EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQGKY+EAANLLNDAL IREKTLGP H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY RALEIY ++ GPDD NV KT+ NLA+AYLKQ K+ +AE+LYKE+LTR HE+EFGK   + KPIW+ AEER+E   KNKE   L     WHK+S++D+STV TTLKNL ALYRRQ K EAAET+E    R+K +  +D
Sbjct:   17 IGKMTALSQDEIVSSTKTVIQGLETLKNEHHQILNSLLSSLKTIKRESGDTNLVEEKTNILKKSLETIELGIGEAQVMIALTQHFQSVEAEKQKLRAQVRRLCQENGWLRDELANTQQKLQFSEQKVATLDEEKRHLEFMNEMKKYDTGDS----NVSTEEKEAEPPSQPLDLGFPDDDDDGHSPEVLSPTQPGAMASAASGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEKYYLRALEIYKKRLGPDDTNVVKTQNNLASAYLKQGKYKQAETLYKEVLTRAHEKEFGKVEGENKPIWMRAEEREENKGKNKEGEPLPDYGSWHKASKVDSSTVTTTLKNLGALYRRQGKYEAAETLEECAMRTKKMGPAD 509          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1S3IGZ4 (kinesin light chain isoform X10 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.548e-165
Identity = 306/496 (61.69%), Postives = 367/496 (73.99%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC----SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD-------TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXX---XXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + K + L+ +EI+S+TK+ +  L++LKN+H Q +N+     E      GD +  + K    ++SL  I+LG+ EA++++ L   LQ  E+E+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V ++EE+NK + FM EMRKYD       TPD  ++P I+      NL  DLGF D+D+D +  D MM        S +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQGKY+EAANLLNDAL IREKTLGP H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+AYLKQ K+ +AE LYKE+LTR HE+EFGK +   KPIW+ AEER+E   K K+         WHK++++D+ TV TTLKNL ALYRRQ K EAAET+E    RS+
Sbjct:   20 IGKMTALTQEEIISNTKTVVQGLDTLKNEHHQILNSLLSSLEAIKAEHGDTNLVEEKTGILKKSLEMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDEEDTTQTTPD--QEP-ISSEKDSKNLPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDGDNKPIWMQAEEREENKGKFKDNAPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECAIRSR 512          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1S3IGY9 (kinesin light chain isoform X5 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 8.230e-165
Identity = 306/496 (61.69%), Postives = 367/496 (73.99%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC----SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD-------TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXX---XXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + K + L+ +EI+S+TK+ +  L++LKN+H Q +N+     E      GD +  + K    ++SL  I+LG+ EA++++ L   LQ  E+E+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V ++EE+NK + FM EMRKYD       TPD  ++P I+      NL  DLGF D+D+D +  D MM        S +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQGKY+EAANLLNDAL IREKTLGP H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+AYLKQ K+ +AE LYKE+LTR HE+EFGK +   KPIW+ AEER+E   K K+         WHK++++D+ TV TTLKNL ALYRRQ K EAAET+E    RS+
Sbjct:   20 IGKMTALTQEEIISNTKTVVQGLDTLKNEHHQILNSLLSSLEAIKAEHGDTNLVEEKTGILKKSLEMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDEEDTTQTTPD--QEP-ISSEKDSKNLPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDGDNKPIWMQAEEREENKGKFKDNAPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECAIRSR 512          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1W7RAA6 (Kinesin light chain OS=Hadrurus spadix OX=141984 PE=4 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 1.182e-163
Identity = 294/509 (57.76%), Postives = 366/509 (71.91%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC----SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXH-GSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKE-IPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQF 1511
            + K + ++ +EI+++TK+ +  L++LKN+H   +N      +      GD++  + K     ++L  IEL + EA++++ L   LQ  E+E+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V QLEEE KQ+ FMN ++KYD+ + G +     +      S DLGF D+D   +P  +         +   +G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YK+AEPLCKRAL IRE  LG DHPDVAKQLNNLALLCQNQ KYEEVE YYQRALEIY +  GPDDPNVAKTK NLA+AYLKQ K+ +AE LYK++LTR HE+EFG  + + KPIW LAEER++   K+K+ +PY+     WHK++++D+ TV TTLKNL ALYRRQ K EAA+T+E+  SR+K           N  QS  P F
Sbjct:   16 IGKMTQMTQEEIITNTKTVIQGLDALKNEHNSILNGLMSSLKAVQQEKGDSNLMEEKALLVRKNLESIELSLGEAQVMMTLAGHLQTVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQTSEQVVAQLEEEKKQLEFMNTLKKYDSIEMGGEEPATENKNESEPSLDLGFPDDDDSVQPEALSPMPSGQMTTSISAGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIRERVLGKDHPDVAKQLNNLALLCQNQAKYEEVEHYYQRALEIYEKTLGPDDPNVAKTKNNLASAYLKQGKYKEAEILYKQVLTRAHEREFGSIDGENKPIWQLAEEREDNKNKSKDFVPYIEYGG-WHKAAKVDSPTVATTLKNLGALYRRQGKYEAADTLEDCASRAKKEAIE------NARQSKSPHF 517          
BLAST of Kinesin light chain vs. TrEMBL
Match: A0A1S3IGT9 (kinesin light chain isoform X3 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 1.686e-163
Identity = 306/500 (61.20%), Postives = 367/500 (73.40%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC----SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD-------TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXX---XXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE----CFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + K + L+ +EI+S+TK+ +  L++LKN+H Q +N+     E      GD +  + K    ++SL  I+LG+ EA++++ L   LQ  E+E+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V ++EE+NK + FM EMRKYD       TPD  ++P I+      NL  DLGF D+D+D +  D MM        S +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQGKY+EAANLLNDAL IREKTLGP H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+AYLKQ K+ +AE LYKE+LTR HE+EFGK +   KPIW+ AEER+E       K K+         WHK++++D+ TV TTLKNL ALYRRQ K EAAET+E    RS+
Sbjct:   18 IGKMTALTQEEIISNTKTVVQGLDTLKNEHHQILNSLLSSLEAIKAEHGDTNLVEEKTGILKKSLEMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDEEDTTQTTPD--QEP-ISSEKDSKNLPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDGDNKPIWMQAEEREENKHLYVGKFKDNAPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECAIRSR 514          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: ENSAMXT00000044075.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 471.855 bits (1213), Expect = 3.727e-157
Identity = 292/476 (61.34%), Postives = 348/476 (73.11%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEIV +TK+ +  LE+L+ +H Q +N+     +C+   +    K     +SL  IELG+ EA++II L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+NV QLEEE K + FMN++RK+D  D+       G  + DNL  DL F ++D DQ P     +  +       G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG  HPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K G DDPNVAKTK NLAT YLKQ KF  AE+LYKEILTR HE++FG  N   KPIW+ AEER+E   K K+  +      W+K+ ++D+ TV  TLK+L ALYRRQ K EAAET+E   ++++
Sbjct:   15 LTQDEIVLNTKAVMQGLETLRGEHAQLLNSL---LDCAQPPA-AQEKSGVLRKSLEAIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDD-DASPSEEKPGEKEKDNLD-DL-FPNDD-DQGPAQPSGEVAAQQ----GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLATCYLKQGKFKDAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEEREESKGKTKDSGFYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLEECATKNR 478          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:103045712])

HSP 1 Score: 467.618 bits (1202), Expect = 2.103e-156
Identity = 283/468 (60.47%), Postives = 339/468 (72.44%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC---SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE-CFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            LS DE++  T+  +  LE+L+ +H   +        C   S +    + K    ++SL  +ELG+ EA++++ L   L   E+E+ KL+ Q+ RL QEN WLRDEL  TQ RL+ SE++V QLEEE K + FMN+++KYD   +P   KD S +  + +D+L     F DE  +  P      S + + +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YYQRALEIY  K GPDDPNVAKTK NLA+ YLKQ KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+E    K K+         W+K+ ++D+ TV TTLKNL ALYRRQ K
Sbjct:   24 LSQDELLCRTREVMQGLEALRAEHQVILEGLMGTLRCLKQSQEGRAVEEKTTMIQRSLEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPTDDKD-SDSSRETLDDL-----FPDEQDEPGPGIQPPHSSAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREEQSKGKQKDGSPFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGK 485          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: ENSAMXT00000055945.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 469.544 bits (1207), Expect = 3.105e-156
Identity = 292/476 (61.34%), Postives = 347/476 (72.90%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEIV +TK+ +  LE+L+ +H Q +N+     +C+   +    K     +SL  IELG+ EA++II L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+NV QLEEE K + FMN++RK+D  D+       G  + DNL  DL F ++D DQ P     +  +       G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG  HPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K G DDPNVAKTK NLAT YLKQ KF  AE+LYKEILTR HE++FG  N   KPIW+ AEER+E   K K+         W+K+ ++D+ TV  TLK+L ALYRRQ K EAAET+E   ++++
Sbjct:   15 LTQDEIVLNTKAVMQGLETLRGEHAQLLNSL---LDCAQPPA-AQEKSGVLRKSLEAIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDD-DASPSEEKPGEKEKDNLD-DL-FPNDD-DQGPAQPSGEVAAQQ----GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLATCYLKQGKFKDAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEEREESKGKKKDSGPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLEECATKNR 478          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: ENSAMXT00000055398.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 469.544 bits (1207), Expect = 3.105e-156
Identity = 292/476 (61.34%), Postives = 347/476 (72.90%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEIV +TK+ +  LE+L+ +H Q +N+     +C+   +    K     +SL  IELG+ EA++II L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+NV QLEEE K + FMN++RK+D  D+       G  + DNL  DL F ++D DQ P     +  +       G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG  HPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K G DDPNVAKTK NLAT YLKQ KF  AE+LYKEILTR HE++FG  N   KPIW+ AEER+E   K K+         W+K+ ++D+ TV  TLK+L ALYRRQ K EAAET+E   ++++
Sbjct:   15 LTQDEIVLNTKAVMQGLETLRGEHAQLLNSL---LDCAQPPA-AQEKSGVLRKSLEAIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDD-DASPSEEKPGEKEKDNLD-DL-FPNDD-DQGPAQPSGEVAAQQ----GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLATCYLKQGKFKDAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEEREESKGKKKDSGPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLEECATKNR 478          
BLAST of Kinesin light chain vs. Ensembl Cavefish
Match: ENSAMXT00000032282.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 469.544 bits (1207), Expect = 3.105e-156
Identity = 292/476 (61.34%), Postives = 347/476 (72.90%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L+ DEIV +TK+ +  LE+L+ +H Q +N+     +C+   +    K     +SL  IELG+ EA++II L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+NV QLEEE K + FMN++RK+D  D+       G  + DNL  DL F ++D DQ P     +  +       G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG  HPDVAKQLNNLALLCQNQGKYEEVE YY+RALEIY  K G DDPNVAKTK NLAT YLKQ KF  AE+LYKEILTR HE++FG  N   KPIW+ AEER+E   K K+         W+K+ ++D+ TV  TLK+L ALYRRQ K EAAET+E   ++++
Sbjct:   15 LTQDEIVLNTKAVMQGLETLRGEHAQLLNSL---LDCAQPPA-AQEKSGVLRKSLEAIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDD-DASPSEEKPGEKEKDNLD-DL-FPNDD-DQGPAQPSGEVAAQQ----GGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLATCYLKQGKFKDAEALYKEILTRAHEKQFGSVNNDNKPIWMHAEEREESKGKKKDSGPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLEECATKNR 478          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009139.1 (pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 gene:ENSPMAG00000008222.1 transcript:ENSPMAT00000009139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 480.715 bits (1236), Expect = 6.049e-161
Identity = 289/479 (60.33%), Postives = 344/479 (71.82%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFEC---SGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            LS +EI+S+T+  +  LE+L+N+H   + +      C   + + S    K    + SL+ IELG+ EA++I+ L   L   E+E+ KL+ Q+ RL QEN WLR+EL T Q RL+ SE++V QLEEEN+ + FM ++RKYD  D    P     +       DL   DED+             ++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EA NLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKYEEVE YY+RAL+IYL + G DDPNVAKTK NLA+ YLKQ K+  AE+LYKEILTR HE+EFG  + + KPIWV AEER++   K KE         W+KS +ID+ TV  TLKNLSALYRRQ K EAAET+E   SRS+
Sbjct:   15 LSQEEILSNTRVVMQGLEALRNEHHSILESLITTLSCLNRADEGSLVSEKTGIIQHSLDSIELGLSEAQVIVALASHLGSVEAEKQKLRAQVRRLCQENAWLREELATAQQRLQRSEQSVAQLEEENRHLQFMGQLRKYD--DEASPPEEKDGESSKEPLDDLFPNDEDEQSSSMTQSRGMSGAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAGNLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVETYYRRALDIYLLQLGTDDPNVAKTKNNLASCYLKQGKYKDAEALYKEILTRAHEREFGSVDGENKPIWVHAEEREQSKGKQKEALPCGEYGGWYKSGKIDSYTVTNTLKNLSALYRRQGKFEAAETLEECASRSR 491          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 453.366 bits (1165), Expect = 2.956e-151
Identity = 265/408 (64.95%), Postives = 312/408 (76.47%), Query Frame = 3
Query:  243 LQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDX---XXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+ V QLEEE K + FMN+M+KYD   +P   +  S    + +D+L     F +E+ +QE          + +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG  HPDVAKQLNNLALLCQNQ KYEEVE YYQRAL+IY  + GPDDPNVAKTK NLA+ YLKQ K+ +AE LYK+ILTR HE+EFG  + + KPIW+ AEER+E   K+KE P       W+K+ ++D+ TV TTLKNLSALYRRQ K EAAET+E   +RS+
Sbjct:   50 LNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQAVAQLEEEKKHLEFMNQMKKYDDDISPSQEEKVSEPCKEPLDDL-----FPNEEDEQEQGSQPSHNAVNSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKVHPDVAKQLNNLALLCQNQSKYEEVEHYYQRALDIYQSQLGPDDPNVAKTKNNLASCYLKQGKYKEAEGLYKDILTRAHEKEFGSVDGENKPIWMHAEEREEQKGKHKESPPYGEYGSWYKACKVDSPTVGTTLKNLSALYRRQGKLEAAETLEECAARSR 452          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001329.1 (pep scaffold:Pmarinus_7.0:GL484789:104:2647:1 gene:ENSPMAG00000001191.1 transcript:ENSPMAT00000001329.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 9.724e-43
Identity = 99/175 (56.57%), Postives = 119/175 (68.00%), Query Frame = 3
Query:  957 LGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE---CF----TKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIF 1460
            LG DHPDVAKQLNNLALLCQNQ KY EVE YYQRAL+IY  + GPDDPNVAKTK N         K+  AE+LYKEILTR HE+EFG  N + KPIW+ AEER+E   C      +  +      +N W+++  I++ T+ TTLKNL ALYRRQ K EAAET+E + S S+   F
Sbjct:    1 LGKDHPDVAKQLNNLALLCQNQSKYGEVEHYYQRALDIYEGRLGPDDPNVAKTKNN--------RKYKAAEALYKEILTRAHEREFGAINGENKPIWMHAEEREETKVCVAGGAVRQGKGWNAVKENGWYRTCSINSPTLATTLKNLGALYRRQGKLEAAETLEEFASHSRKQDF 167          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: nphp3 (nephronophthisis 3 [Source:NCBI gene;Acc:562601])

HSP 1 Score: 85.5001 bits (210), Expect = 1.721e-17
Identity = 72/192 (37.50%), Postives = 104/192 (54.17%), Query Frame = 3
Query:  606 RTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYK 1181
            R+L+ L + Y  QG  +      +++L   EK  G DHPD A  LN LA +  ++G+   A  L   AL  R++ L   H A+A T+  LA+LY K G+ ++A PL +  + IRE+A G +HP VA  L NLA++     +++E    Y+RAL  Y    GP  P VA+T  NLA    +Q   + A  LYK
Sbjct:  467 RSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALRTYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAELYK 658          

HSP 2 Score: 81.2629 bits (199), Expect = 3.816e-16
Identity = 81/241 (33.61%), Postives = 114/241 (47.30%), Query Frame = 3
Query:  582 GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNS------------------------GHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQ 1232
            G + P   R L  L   +   GR E A  L +QAL+  +K +                        G +  D A  LN L ++Y  QG           +L +REK LGP H   A +LNNLA L G+RG  + A+ L +RAL  R+ AL  +HP +A  +  LALL +  GK E+    YQ  +EI  + SGP+ P+VA    NLA  Y +  +  +A  LY+  L R +E   G  +P+
Sbjct:  393 GHDDPRVARHLDALAALHHKHGRLEQAESLRRQALKIRQKAAAERGNVSGFELLRRRLLQLEEAPPGGESADAARSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERAL-RTYEDSLGPLHPR 632          

HSP 3 Score: 73.1738 bits (178), Expect = 1.290e-13
Identity = 93/302 (30.79%), Postives = 137/302 (45.36%), Query Frame = 3
Query:  594 PARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTL------------------------GPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWV-LAEERQECFTKNKEIP-YLSSDNCWHKSSRIDNSTVYTTLKNLSAL-YRRQNKTEAAE 1418
            P+   TLH L   Y S  +   A  L +QAL  ++   GHD P VA  L+ LA ++   G+  +A +L   AL IR+K                          G + +  A +LN L VLY  +G         +R+L +RE+ LG DHPD A+ LNNLA LC  +G+ E  +  Y+RAL    +    + P +A T   LA  Y K  K  KA  LY ++     E+  G ++P      V LA    +    ++ +P Y  +   +  S    +  V  TL+NL+ L Y + +   AAE
Sbjct:  355 PSVAGTLHRLAAVYLSWRKPGPAQQLYEQALALVQNAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQALKIRQKAAAERGNVSGFELLRRRLLQLEEAPPGGESADAARSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLY-QLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALRTYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAE 655          

HSP 4 Score: 68.5514 bits (166), Expect = 3.686e-12
Identity = 62/154 (40.26%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  609 TLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEI 1070
            +L+NL      +G  E A  L ++AL   ++    +HP +A  +  LAL+Y+  GK  +A  L    + IREK  GP H +VA  L NLAV+Y +  R+ EA PL +RAL   E++LG  HP VA+ L NLA+L   QG        Y+RA EI
Sbjct:  510 SLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALRTYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAELYKRATEI 663          

HSP 5 Score: 49.2914 bits (116), Expect = 3.594e-6
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  909 EAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEIL 1190
            +A  + +R+L +RE AL  DHP VA  L+ LA +  +  K    +  Y++AL +     G DDP VA+    LA  + K  +  +AESL ++ L
Sbjct:  334 QAVLMLQRSLELRETALDPDHPSVAGTLHRLAAVYLSWRKPGPAQQLYEQALALVQNAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQAL 427          
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000963.1 (pep scaffold:Pmarinus_7.0:GL483251:4541:9289:1 gene:ENSPMAG00000000877.1 transcript:ENSPMAT00000000963.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 5.927e-10
Identity = 35/70 (50.00%), Postives = 46/70 (65.71%), Query Frame = 3
Query: 1254 AEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFS 1463
            AEER E   K  E  +L   N W+K SR D+ TV  TLKNL+ALYRRQ + EAA+T+E +I+RS   + +
Sbjct:    2 AEER-EYNVKRCEGSHLELGN-WYKVSREDSPTVTNTLKNLAALYRRQGRVEAAQTLEQYIARSHCRVVT 69          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO43009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV0])

HSP 1 Score: 440.654 bits (1132), Expect = 1.532e-147
Identity = 277/477 (58.07%), Postives = 345/477 (72.33%), Query Frame = 3
Query:   24 STDEIVSHTKSSLMVLESLKNDHCQSINNFR--EQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            + DEI+++TK+ +  LE+LKN+H   +N     E  +    +   + K    + SL+KIELG+ EA++++ L   L   E+E+ KL+ Q+ RL QEN WLR+EL+ TQ +L+ SE++V QLEEE K + FMN ++KYD  D G +         +++SSD+   DED     ++ + Q+ + S S    +EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLL+DAL IREKTLG  H AVAATLNNLAVLYGKRG+YK+AEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKY+EVE YYQRALEIY  K GPDDPNVAKTK NLA+AYLKQ K+  AE+LYK++LTR HE+EFG             E  ++   + K+         WHK++++D+ TV TTL+NL ALYRRQ K EAAET+E+   RS+
Sbjct:   11 TQDEIINNTKNVVRGLETLKNEHSGILNGLALYEDTKTESQSELEEAKAGVVQDSLDKIELGLGEAQVLMALCSHLSTVEAEKQKLRAQVKRLCQENAWLREELSVTQQKLQESEQSVAQLEEEKKHLEFMNSLKKYD-DDEGIE---------NDISSDILSQDEDDHDVDDETLSQTSNVSASTSGVYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLHDALTIREKTLGEDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEQYYQRALEIYTTKLGPDDPNVAKTKNNLASAYLKQGKYKAAETLYKQVLTRAHEREFGTS----------GESLEDDGKRGKDNAPYGEYGGWHKAAKVDSPTVTTTLRNLGALYRRQGKFEAAETLEDCALRSR 467          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO37603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFC9])

HSP 1 Score: 115.546 bits (288), Expect = 2.612e-26
Identity = 83/212 (39.15%), Postives = 121/212 (57.08%), Query Frame = 3
Query:  606 RTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKP 1241
            R+L+ + + Y  Q  +E +    +++L   E+  G DHP+VA  L+ LA +Y D  +Y +A  L   AL IR K   P+HS VA+T+ +LA LY K+G++ +AEPL ++AL  RE+  G +HP V   L+NLA++   Q K E+    Y+RAL IY +  GP  P VA+   NLA  Y  Q    +A  LYKE       Q+ G  +PQ +P
Sbjct: 1107 RSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERALRIYEESLGPQHPRVAEVLVNLAKVYYDQGALGEAVRLYKE---ASDIQQNGPRSPQSRP 1315          

HSP 2 Score: 101.679 bits (252), Expect = 5.145e-22
Identity = 80/232 (34.48%), Postives = 124/232 (53.45%), Query Frame = 3
Query:  594 PARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKT--------------------LGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNP 1229
            P   ++LH L   Y+  G +  A    KQA+E  +   G DH  +   L  L+++Y+   KY  A +    A+AIR+K+                    LGP    ++ +LN + VLY  +  ++ ++   +R+L +REE LG DHP+VA+ L+NLA L  +  +Y++ E  Y+RAL+I L+   P+   VA T  +LAT Y KQ KF KAE LY++ L    E+ FG ++P
Sbjct:  999 PLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSILYKKNEKYSLAESCHKRAIAIRQKSGVLIGVQAMKRKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQAL-EAREKIFGDNHP 1229          

HSP 3 Score: 81.6481 bits (200), Expect = 7.513e-16
Identity = 68/169 (40.24%), Postives = 95/169 (56.21%), Query Frame = 3
Query:  594 PARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDP 1100
            P   ++LHNL   Y    +Y+ A PL K+AL+   K    +H  VA+ +  LA +YR QGK+ +A  L   AL  REK  G  H  V   L+NLAV+   + + ++A PL +RAL I EE+LG  HP VA+ L NLA +  +QG   E    Y+ A +I  Q++GP  P
Sbjct: 1145 PEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERALRIYEESLGPQHPRVAEVLVNLAKVYYDQGALGEAVRLYKEASDI--QQNGPRSP 1311          

HSP 4 Score: 78.9518 bits (193), Expect = 5.624e-15
Identity = 70/213 (32.86%), Postives = 110/213 (51.64%), Query Frame = 3
Query:  615 HNLVIQYASQGRYEVAVPLCKQALEDLEKNS-GHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWV 1250
            H   I    +    + V   K+ +  +E+ S G    +++  LN + ++Y  Q  +  + +    +LA+RE+ LG  H  VA +L+NLA LY    +Y +AEPL KRAL IR +A   +H  VA  + +LA L + QGK+++ E  Y++ALE   +  G + P V     NLA     QNK   A  LY+  L R +E+  G  +P+   + V
Sbjct: 1067 HKRAIAIRQKSGVLIGVQAMKRKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERAL-RIYEESLGPQHPRVAEVLV 1278          

HSP 5 Score: 74.7146 bits (182), Expect = 1.179e-13
Identity = 80/296 (27.03%), Postives = 127/296 (42.91%), Query Frame = 3
Query:  645 GRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIR--------------------EEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSN 1472
            G    A P  ++ALE  E     DHP VA  L+ LA +Y   G +  A      A+ I +  LG  H ++   L  L++LY K  +Y  AE   KRA+ IR                    E +LG    ++++ LN + +L   Q  +E  + ++QR+L +  +  G D P VA++  NLA  Y    ++ KAE LYK  L                      + R + F+                    ++S V +T+K+L+ LYR+Q K + AE +      ++  IF D++
Sbjct:  974 GLLSQAAPSLQKALEIRESVLDPDHPLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSILYKKNEKYSLAESCHKRAIAIRQKSGVLIGVQAMKRKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRAL----------------------DIRLKAFSP-------------------EHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNH 1228          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO36593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI60])

HSP 1 Score: 67.0106 bits (162), Expect = 1.135e-12
Identity = 59/194 (30.41%), Postives = 95/194 (48.97%), Query Frame = 3
Query:  609 TLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEIL 1190
            +L NL + Y+ QG+Y  A+ L  Q+LE L   +G  H  V  +LN + +VY   G +  A       L I E   G  H  VA  LN L  +Y   G  ++A+ + + +L I+E+   ++H  V + LN+L ++    G+ E+      RAL+ + +  G     V  T+ +L  A+    K  KA  L++E L
Sbjct:    1 SLLNLAVVYSRQGKYSKALALYNQSLEILADINGPRHVSVGRVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSLEIKEKVFNAEHFIVGEALNDLGVVYTRLGETEKAVKVLGRALDTFKRTWGEKHTAVLTTQNSLGAAFCAIGKPEKAIELHQEAL 194          

HSP 2 Score: 64.3142 bits (155), Expect = 8.369e-12
Identity = 51/153 (33.33%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  606 RTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRAL 1064
            R L+ + I Y   G +  A+   ++ LE LE   G  HP VA  LN L  +YRD G   +A  +L  +L I+EK    +H  V   LN+L V+Y + G  ++A  +  RAL   +   G  H  V    N+L       GK E+    +Q AL
Sbjct:   42 RVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSLEIKEKVFNAEHFIVGEALNDLGVVYTRLGETEKAVKVLGRALDTFKRTWGEKHTAVLTTQNSLGAAFCAIGKPEKAIELHQEAL 194          

HSP 3 Score: 50.447 bits (119), Expect = 5.547e-7
Identity = 48/156 (30.77%), Postives = 76/156 (48.72%), Query Frame = 3
Query:  732 TMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRF 1199
            ++LN LA+VY  QGKY +A  L N +L I     GP+H +V   LN + ++Y + G +  A    +R L I E   G  HP VA+ LN L  + ++ G  E+ +   + +LEI  +    +   V +   +L   Y +  +  KA  +    L  F
Sbjct:    1 SLLN-LAVVYSRQGKYSKALALYNQSLEILADINGPRHVSVGRVLNTIGIVYYRLGDFPYAICYSERGLEILEAGHGKYHPHVAEALNFLGFMYRDHGNLEKAKKVLEHSLEIKEKVFNAEHFIVGEALNDLGVVYTRLGETEKAVKVLGRALDTF 155          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO28760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5K1])

HSP 1 Score: 56.225 bits (134), Expect = 4.737e-8
Identity = 56/205 (27.32%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  642 QGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLA 1256
            QG+YE A+   K+AL   +K S       A +L  +   +  QGKY EA     +AL + +KT              +   + ++G+Y+EA    K AL + ++   SD     +    +      QGKYEE   +Y+ AL +Y + S  DD    K    +   + +Q K+ +A   YKE L  +  Q+   D  Q K   ++ 
Sbjct:  524 QGKYEEAIGHYKEALRLYQKTSDDQGQGEAHLL--IGKTHYQQGKYEEARGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHNQQGKYEEARGHYKEALRLYQKT--SDDQGQGEAHLLIGNTHYQQGKYEEAIGHYKEALRLYQKTS--DDQGQGKAHLLIGNTHYQQGKYEEARGHYKEALRLY--QKTSDDQGQGKAHLLIG 718          

HSP 2 Score: 54.6842 bits (130), Expect = 1.683e-7
Identity = 55/196 (28.06%), Postives = 88/196 (44.90%), Query Frame = 3
Query:  618 NLVI--QYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRF 1199
            NL+I   +  QG+YE A+   K+AL   +K S       A +L  +   +  QGKY EA     +AL + +KT              +   + ++G+Y+EA    K AL + ++   SD     +    +      QGKYEE   +Y+ AL +Y + S  DD    K    +   + +Q K+ +A   YKE L  +
Sbjct:  434 NLLIGKTHYQQGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLL--IGNTHDQQGKYEEARGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHDQQGKYEEAIGHYKEALRLYQKT--SDDQGQGEAHLLIGKTHYQQGKYEEARGHYKEALRLYQKTS--DDQGQGKAHLLIGNTHNQQGKYEEARGHYKEALRLY 621          

HSP 3 Score: 53.1434 bits (126), Expect = 4.078e-7
Identity = 57/205 (27.80%), Postives = 89/205 (43.41%), Query Frame = 3
Query:  642 QGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLA 1256
            QG+YE A    K+AL   +K S       A +L  +   +  QGKY EA     +AL + +KT              +   + ++G+Y+EA    K AL + ++   SD     K    +      QGKYEE   +Y+ AL +Y + S  DD    K    +   + +Q K+ +A   YKE L  +  Q+   D  Q K   ++ 
Sbjct:  564 QGKYEEARGHYKEALRLYQKTSDDQGQGKAHLL--IGNTHNQQGKYEEARGHYKEALRLYQKT--SDDQGQGEAHLLIGNTHYQQGKYEEAIGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHYQQGKYEEARGHYKEALRLYQKTS--DDQGQGKAHLLIGNTHYQQGKYEEAIGHYKEALRLY--QKTSDDQGQGKAHLLIG 758          

HSP 4 Score: 52.373 bits (124), Expect = 7.149e-7
Identity = 52/186 (27.96%), Postives = 83/186 (44.62%), Query Frame = 3
Query:  642 QGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRF 1199
            QG+YE A+   K+AL   +K S       A +L  +   +  QGKY EA     +AL + +KT              +   + ++G+Y+EA    K AL + ++   SD     +    +      QGKYEE   +Y+ AL +Y + S  DD    K    +   + +Q K+ +A   YKE L  +
Sbjct:  844 QGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLL--IGNTHNQQGKYEEAIGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHYQQGKYEEAIGHSKEALRLYQKT--SDDQGQGEAHLLIGKTHYQQGKYEEAIGHYKEALRLYQKTS--DDQGQGKAHLLIGDIHYQQGKYEEAIGHYKEALRLY 1021          

HSP 5 Score: 51.2174 bits (121), Expect = 1.885e-6
Identity = 56/205 (27.32%), Postives = 90/205 (43.90%), Query Frame = 3
Query:  642 QGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLA 1256
            QG+YE A+   K+AL   +K S       A +L  +   +  QGKY EA     +AL + +KT              +   + ++G+Y+EA    K AL + ++   SD     +    +      QGKYEE   +Y+ AL +Y + S  DD    K    +   + +Q K+ +A   YKE L  +  Q+   D  Q K   ++ 
Sbjct:  724 QGKYEEAIGHYKEALRLYQKTSDDQGQGKAHLL--IGNTHYQQGKYEEARGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHYQQGKYEEAIGHYKEALRLYQKT--SDDQGQGEAHLLIGNTHYQQGKYEEAIGHYKEALRLYQKTS--DDQGQGKAHLLIGNTHNQQGKYEEAIGHYKEALRLY--QKTSDDQGQGKAHLLIG 918          

HSP 6 Score: 51.2174 bits (121), Expect = 1.918e-6
Identity = 55/202 (27.23%), Postives = 87/202 (43.07%), Query Frame = 3
Query:  651 YEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLA 1256
            YE A+   K+AL   +K S       A +L  +   +  QGKY EA     +AL + +KT              +   + ++G+Y+EA    K AL + ++   SD     K    +      QGKYEE   +Y+ AL +Y + S  DD    K    +   + +Q K+ +A   YKE L  +  Q+   D  Q K   ++ 
Sbjct:  287 YEEAIGHSKEALRLYQKTSDDQGQGKAHLL--IGTTHDQQGKYEEAIGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHDQQGKYEEAIGHYKEALRLYQKT--SDDQGQGKAHLLIGNTHDQQGKYEEAIGHYKEALRLYQKTS--DDQGQGKANLLIGKTHYQQGKYEEAIGHYKEALRLY--QKTSDDQGQGKAHLLIG 478          
BLAST of Kinesin light chain vs. Ensembl Nematostella
Match: EDO45510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS2])

HSP 1 Score: 55.8398 bits (133), Expect = 6.704e-8
Identity = 58/215 (26.98%), Postives = 100/215 (46.51%), Query Frame = 3
Query:  597 ARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKP 1241
             + +  H +   ++SQG+YE A+   + AL   +K    D    A     +  V+  QGKY +A N    AL++ +KT      A A        +   +G+Y++A    +RAL +  +    D    AK  + +  + ++QGKYE+    YQ AL ++ QK+G D+         +  A+  Q K+  A + Y+  L+ FH+   G ++ Q K 
Sbjct:  259 GQAKAYHGMGNLHSSQGKYEDAMNNYQHALSLFQKTG--DESGQANAYLGMGDVHSSQGKYEDAMNNYQHALSLFQKTGDESGQANAYLGMGEVHMLSGQGKYEDAMNNYQRALSLFHKT--GDESSQAKAYHGMGNMHKSQGKYEDALNNYQHALSLF-QKTG-DESGQGDAYLGMGDAHRSQGKYEDAMNNYQHALSLFHKT--GDESSQAKA 465          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000010217.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 464.537 bits (1194), Expect = 2.389e-154
Identity = 294/483 (60.87%), Postives = 352/483 (72.88%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSIN---GSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEI-PYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            LS DEIV +TK+ +  LE+L+++H Q +N+     +CS        K     +SL  IELG+ EA++II L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L  SE++V QLEEE K + FMN+++K+D   +P   K+ S     G+ +    S D  F ++D DQ P     Q      +  +G+EIP RLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK+SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IR + LG  HPDVAKQLNNLALLCQNQGKY+EVE YY +ALEIY+ + GPDDPNVAKTK NLAT YLKQ KF  AE LYKEILTR HE+EFG  N   KPIW+ AEER+E     K+  PY+   + W+K+ ++D+ TV TTLK+L+ALYRRQ K EAAET+E   SRS+
Sbjct:   15 LSQDEIVLNTKAVMQGLETLRSEHTQLLNSL---LDCS-QPPVAQEKSGLLRKSLEDIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGEASKDSLDDLFPNDD-DQGP----AQPSGDVAAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVLGKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLATCYLKQGKFKDAEVLYKEILTRAHEKEFGSVNNDNKPIWMHAEEREESKGLRKDSGPYVEYGS-WYKACKVDSPTVNTTLKSLAALYRRQGKLEAAETLEECASRSR 487          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000010213.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 464.922 bits (1195), Expect = 2.803e-154
Identity = 294/483 (60.87%), Postives = 351/483 (72.67%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSIN---GSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEI-PYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            LS DEIV +TK+ +  LE+L+++H Q +N+     +CS        K     +SL  IELG+ EA++II L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L  SE++V QLEEE K + FMN+++K+D   +P   K+ S     G+ +    S D  F ++D DQ P     Q      +  +G+EIP RLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK+SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IR + LG  HPDVAKQLNNLALLCQNQGKY+EVE YY +ALEIY+ + GPDDPNVAKTK NLAT YLKQ KF  AE LYKEILTR HE+EFG  N   KPIW+ AEER+E     K+  PY+     W+K+ ++D+ TV TTLK+L+ALYRRQ K EAAET+E   SRS+
Sbjct:   15 LSQDEIVLNTKAVMQGLETLRSEHTQLLNSL---LDCS-QPPVAQEKSGLLRKSLEDIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGEASKDSLDDLFPNDD-DQGP----AQPSGDVAAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKSSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVLGKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLATCYLKQGKFKDAEVLYKEILTRAHEKEFGSVNNDNKPIWMHAEEREESKGLRKDSGPYVEY-GSWYKACKVDSPTVNTTLKSLAALYRRQGKLEAAETLEECASRSR 487          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000016251.2 (kinesin light chain 1 [Source:NCBI gene;Acc:101171520])

HSP 1 Score: 462.225 bits (1188), Expect = 2.878e-153
Identity = 285/482 (59.13%), Postives = 349/482 (72.41%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDT---KVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKE---IPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSK 1448
            LS +EI+S+TK  +  LE+LKN+H   +++  E  +C   + + +    K     +S+  IELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE+NV QLEEE K + FMN+++KYD   S      +     D+L       DE+ +Q        +  ++   G G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAA+LLNDAL+IREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG +HPDVAKQLNNLALLCQNQGKYEEVE YY RALEIY  + GPDDPNVAKTK NLA+ +LKQ K+ +AE LYKEILTR HE+EFG  + + KPIW+ AEER+E  +K K     PY      W+K+ ++++ TV TTL+NL ALYRRQ K EAAET+E    RS+
Sbjct:   15 LSQEEIISNTKLVIQGLEALKNEHNSILHSLLETIKCLKKDEEANLVHEKANLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQNVAQLEEEKKHLEFMNQLKKYDEDVSPTQEEKDRETPKDSLDDLFPNEDEENNQGMQHQHNSAAVAAAQQG-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKEHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALEIYECRLGPDDPNVAKTKNNLASCFLKQGKYKEAEILYKEILTRAHEKEFGSVDAENKPIWMHAEEREE-MSKGKHRDNTPY-GEYGGWYKACKVNSPTVNTTLRNLGALYRRQGKLEAAETLEECAVRSR 493          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:101163537])

HSP 1 Score: 450.284 bits (1157), Expect = 7.223e-150
Identity = 280/477 (58.70%), Postives = 336/477 (70.44%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD---CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGS---------GFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE-CFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            LS DEI+S TK  +  LE+LK +H   ++       C   + +    + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD   + S +  +        D+    +P            +HGS         G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKY+EVE YY RALEIY  + GPDDPNVAKTK NLA+ YLKQ+KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+E    K K+         W+K+ ++D+ TV TTLKNL ALY+RQ K
Sbjct:   19 LSQDEIISQTKQVIQGLEALKQEHHSILDGLLGTLRCLKQDEEGVLVEEKSHMIRKSLEMLELGLSEAQVMMALSTHLSSVESEKQKLRAQVRRLCQENQWLRDELAGTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDEDLSPSEEKDS--DSSKETLDDLFPDDQDDQAPGIQP------------AHGSAAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYMRALEIYQTQLGPDDPNVAKTKNNLASCYLKQSKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREEKSKGKQKDSSPFGEYGGWYKACKVDSPTVTTTLKNLGALYKRQGK 481          
BLAST of Kinesin light chain vs. Ensembl Medaka
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:101163537])

HSP 1 Score: 451.44 bits (1160), Expect = 6.096e-149
Identity = 281/468 (60.04%), Postives = 336/468 (71.79%), Query Frame = 3
Query:   21 LSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSD---CDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD---TPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQE-CFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNK 1403
            LS DEI+S TK  +  LE+LK +H   ++       C   + +    + K     +SL  +ELG+ EA++++ L   L   ESE+ KL+ Q+ RL QEN WLRDEL  TQ +L+ SE++V QLEEE K + FMN+++KYD   +P   KD     SD       DL   D+D           S +++ +   G+EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEK SGHDHPDVATMLNILALVYRDQ KY+EAANLLNDALAIREKTLG  H AVAATLNNLAVLYGKRG+YKEAEPLCKRAL IRE+ LG DHPDVAKQLNNLALLCQNQGKY+EVE YY RALEIY  + GPDDPNVAKTK NLA+ YLKQ+KF +AE+LYKEILTR HE+EFG  + + KPIW+ AEER+E    K K+         W+K+ ++D+ TV TTLKNL ALY+RQ K
Sbjct:   19 LSQDEIISQTKQVIQGLEALKQEHHSILDGLLGTLRCLKQDEEGVLVEEKSHMIRKSLEMLELGLSEAQVMMALSTHLSSVESEKQKLRAQVRRLCQENQWLRDELAGTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDEDLSPSEEKD-----SDSSKETLDDLFPDDQDDQAPGIQPAHGSAAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYMRALEIYQTQLGPDDPNVAKTKNNLASCYLKQSKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREEKSKGKQKDSSPFGEYGGWYKACKVDSPTVTTTLKNLGALYKRQGK 481          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 560/561 (99.82%), Postives = 560/561 (99.82%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQFTLKPKVVLNGDSNNIQQNLIIETGNDLLFKKICSHPLSSSISRYEKSQFNVNPGWKQH 1685
            MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFE SGDNSDCDTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQFTLKPKVVLNGDSNNIQQNLIIETGNDLLFKKICSHPLSSSISRYEKSQFNVNPGWKQH
Sbjct:    1 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFESSGDNSDCDTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQFTLKPKVVLNGDSNNIQQNLIIETGNDLLFKKICSHPLSSSISRYEKSQFNVNPGWKQH 561          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 527/537 (98.14%), Postives = 529/537 (98.51%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQFTLKPKVVLNGDSNNIQQNLIIETGNDLLFKKICS 1613
            MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFE SGDNSDCDTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQFTLKPKVVLNGDSNNIQQNLIIET   +  K+  S
Sbjct:    1 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFESSGDNSDCDTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCKPQFTLKPKVVLNGDSNNIQQNLIIETAALVDMKRASS 537          

HSP 2 Score: 81.6481 bits (200), Expect = 8.217e-16
Identity = 40/44 (90.91%), Postives = 42/44 (95.45%), Query Frame = 1
Query: 1612 VIL*VAALVDMKRASSMSTLVGNNIESEDLKNIQKPIQSSFFKK 1743
            +I+  AALVDMKRASSMSTLVGNNIESEDLKNIQKPIQSSFFKK
Sbjct:  522 LIIETAALVDMKRASSMSTLVGNNIESEDLKNIQKPIQSSFFKK 565          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 482/483 (99.79%), Postives = 482/483 (99.79%), Query Frame = 3
Query:    3 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKVPWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKM 1451
            MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFE SGDNSDCDTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKM
Sbjct:    1 MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFESSGDNSDCDTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKM 483          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000018116.1 (SMESG000018116.1)

HSP 1 Score: 381.719 bits (979), Expect = 3.010e-124
Identity = 235/408 (57.60%), Postives = 288/408 (70.59%), Query Frame = 3
Query:  240 FLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDLG-FTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLS-SDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISRSKMVI 1457
             + + ESE      Q  RL QEN+WLR+E+   Q +LE S+    QL  + + + +MN+++  +        +IN     D+   DL    D DK++    ++     S V   S  EIP +L+TL+NLV+ YASQGRYEVAVPLCKQA++DLE+N+GHD+ DVATMLNILALVYRDQG ++EA+ LL DAL IR+K LGPK  AVAATLNNLAVLYGK+GRYKEAEPLCK ALLI+EE LGSDHPDVAKQLNNLALLCQNQGK+EEVE+YYQRALEIYL K+G DDPNVAKTK NLA AYLKQ K++KAE LYKEIL R HE +FG      KPIW +AEE  E   K + I   +  D    +S++ID  T+ TTLKNL ALYRRQ K  AAE VE +++  K +I
Sbjct:   72 LIALVESENVNNSYQTKRLRQENDWLREEINNLQQKLEISDAENIQLGTKLEHLEYMNDLKNVEN-------NINLETVPDDKKGDLQCLIDYDKEE---SMIQSQSISMVQSTSSHEIPTKLKTLYNLVLVYASQGRYEVAVPLCKQAIDDLERNNGHDNADVATMLNILALVYRDQGNFKEASKLLMDALHIRKKVLGPKDPAVAATLNNLAVLYGKKGRYKEAEPLCKEALLIKEERLGSDHPDVAKQLNNLALLCQNQGKFEEVEIYYQRALEIYLSKNGEDDPNVAKTKNNLAAAYLKQGKYAKAELLYKEILNRAHENQFGIITDGNKPIWKIAEEMDEKKEKPENIVTSNIGDKSLFQSNKIDKLTIATTLKNLGALYRRQGKFTAAEVVEEYMNNQKSII 469          
BLAST of Kinesin light chain vs. Planmine SMEST
Match: SMESG000043408.1 (SMESG000043408.1)

HSP 1 Score: 363.614 bits (932), Expect = 3.930e-115
Identity = 244/504 (48.41%), Postives = 330/504 (65.48%), Query Frame = 3
Query:   45 HTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDCDTKV-----PWFEQSLNKXXXXXXXXXXXXXXYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYD--TPDSGKDPS--INGSDKVDNLS-SDLGFTDEDKDQEPNDXXXXXXXXXXXHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSXXXXXXXXXXXXYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKXXXXXXXXXXXXGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNSTVYTTLKNLSALYRRQNKTEAAETVENWISR-SKMVIFSDSNDSCNESQSCKPQFTLKP 1523
            H  + +   ESL+++H   ++  +++ E     +DC+  +     P  + S +K+ L IE+A ++  L E+L++ ++ER    V I +LN+E+NWLR+E+T  Q  L  SE+ + +LEEENK + F+ E++  D    D+G++ S  +   +K+DN + SD  F   D + E  +        + S+ SGFE+P RL+TLHNLVIQYASQGRYEVA+PLCKQ LEDLE+ SG +HPDVATMLNILALVYRDQ K+ +A  LL +ALAIRE TLGP H AVAA LNNLAVLYGK+ ++ +AEPLCKR+L+IRE+ LG DHPDVAKQLNNLALLCQNQ KY EVE YY RA++IY    G    +V KTK NLATAY+KQ+K+ +AE +YKEI+   HEQ+ G   P  KPIW+LAEERQ                 W      D S +Y+++KNL+A+YR QNKTEAA+ +E + +  S+    S  N+S     S +  F  KP
Sbjct:    7 HIVNQIKTFESLRDEHLLILSISQQELELL---NDCEADLLRKDFPLIQHSTDKVNLAIEDANVLKLLSEYLKVIDAERQNHSVNIIKLNEESNWLREEVTNLQSNLRKSEEKIVELEEENKHLHFLLELKSIDDMGADTGQEKSKDLFELNKLDNTNPSDGEFKFPDTEFENKESPNAENVVNPSNASGFELPPRLKTLHNLVIQYASQGRYEVAIPLCKQTLEDLERTSGRNHPDVATMLNILALVYRDQNKFPDAITLLKEALAIRENTLGPVHVAVAANLNNLAVLYGKQKKFNDAEPLCKRSLIIREQLLGPDHPDVAKQLNNLALLCQNQNKYSEVESYYLRAIKIYTNAYGQQHEDVIKTKINLATAYMKQSKYKEAELIYKEIINEIHEQQCGGIAPNNKPIWMLAEERQHGNIGGNFNTQKDEHESWKNIRSHDWSLIYSSMKNLAAIYRIQNKTEAADIIETFANENSQNQNKSQINESVRSDTSSEKNFIPKP 507          
The following BLAST results are available for this feature:
BLAST of Kinesin light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLC18.778e-15961.88kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC18.778e-15961.88kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC18.778e-15961.88kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC11.109e-15861.88kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC11.527e-15861.88kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc-21.393e-14856.10Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-21.393e-14856.10Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-27.795e-14856.35Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-27.795e-14856.35Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-21.399e-14756.35Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Klc2.845e-15559.38gene:FBgn0010235 transcript:FBtr0075951[more]
Klc2.845e-15559.38gene:FBgn0010235 transcript:FBtr0331555[more]
Klc2.936e-15559.38gene:FBgn0010235 transcript:FBtr0331556[more]
back to top
BLAST of Kinesin light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc1a1.196e-15360.17kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc1a1.371e-15360.17kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc43.670e-15158.09kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc43.670e-15158.09kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc31.255e-12556.07kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hira7.148e-15460.46histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira4.383e-15360.75histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira4.666e-15360.75histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira5.127e-15360.75histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira1.133e-15260.46histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klc18.529e-15961.88kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc11.296e-15861.57kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc14.561e-15861.88kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc11.041e-15761.88kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc11.094e-15761.88kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Kinesin light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46825|KLC_DORPE2.553e-16560.86Kinesin light chain OS=Doryteuthis pealeii OX=1051... [more]
sp|P37285|KLC1_RAT3.219e-15862.10Kinesin light chain 1 OS=Rattus norvegicus OX=1011... [more]
sp|Q07866|KLC1_HUMAN2.018e-15761.88Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=K... [more]
sp|Q5R581|KLC1_PONAB1.166e-15661.67Kinesin light chain 1 OS=Pongo abelii OX=9601 GN=K... [more]
sp|O88447|KLC1_MOUSE1.025e-15461.23Kinesin light chain 1 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of Kinesin light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NXK46.809e-16661.97Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3IGZ43.548e-16561.69kinesin light chain isoform X10 OS=Lingula unguis ... [more]
A0A1S3IGY98.230e-16561.69kinesin light chain isoform X5 OS=Lingula unguis O... [more]
A0A1W7RAA61.182e-16357.76Kinesin light chain OS=Hadrurus spadix OX=141984 P... [more]
A0A1S3IGT91.686e-16361.20kinesin light chain isoform X3 OS=Lingula unguis O... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044075.13.727e-15761.34kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
klc1a2.103e-15660.47kinesin light chain 1 [Source:NCBI gene;Acc:103045... [more]
ENSAMXT00000055945.13.105e-15661.34kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000055398.13.105e-15661.34kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000032282.13.105e-15661.34kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009139.16.049e-16160.33pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 ge... [more]
klc1a2.956e-15164.95kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000001329.19.724e-4356.57pep scaffold:Pmarinus_7.0:GL484789:104:2647:1 gene... [more]
nphp31.721e-1737.50nephronophthisis 3 [Source:NCBI gene;Acc:562601][more]
ENSPMAT00000000963.15.927e-1050.00pep scaffold:Pmarinus_7.0:GL483251:4541:9289:1 gen... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430091.532e-14758.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376032.612e-2639.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365931.135e-1230.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287604.737e-827.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455106.704e-826.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010217.22.389e-15460.87kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
ENSORLT00000010213.22.803e-15460.87kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
ENSORLT00000016251.22.878e-15359.13kinesin light chain 1 [Source:NCBI gene;Acc:101171... [more]
klc1a7.223e-15058.70kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
klc1a6.096e-14960.04kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
back to top
BLAST of Kinesin light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010732.10.000e+099.82SMESG000010732.1[more]
SMESG000010732.18.217e-1698.14SMESG000010732.1[more]
SMESG000010732.10.000e+099.79SMESG000010732.1[more]
SMESG000018116.13.010e-12457.60SMESG000018116.1[more]
SMESG000043408.13.930e-11548.41SMESG000043408.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018861 ID=SMED30018861|Name=Kinesin light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2384bp
TGATGTCCAAAAAATCAAATTTATCAACAGATGAAATTGTTTCTCATACA
AAATCCTCATTAATGGTTTTAGAGTCACTAAAAAATGATCATTGTCAGAG
TATAAATAATTTTCGAGAACAATTCGAATGTTCCGGTGATAACTCTGATT
GCGATACTAAAGTTCCTTGGTTTGAGCAATCATTAAATAAAATAGAACTT
GGAATTGAAGAAGCTGAACTTATTATTCAGTTGTATGAATTTCTGCAAAT
TAGTGAATCTGAACGTAATAAGTTAAAAGTTCAAATCGGTCGACTAAATC
AAGAAAATAATTGGTTGCGAGATGAACTCACAACAACTCAATTTCGACTA
GAAGCTAGTGAAAAAAATGTTTGTCAGTTAGAAGAAGAAAATAAACAAAT
ATCTTTCATGAATGAAATGAGAAAATATGATACACCAGACAGTGGAAAAG
ATCCATCAATTAATGGATCTGATAAAGTTGATAATTTGTCGTCAGACCTT
GGATTTACAGATGAAGATAAAGACCAAGAACCAAATGATGTGATGATGCA
AAGTCAGTCGTCATCCGTGTCTCATGGAAGTGGCTTTGAAATTCCAGCTC
GATTACGGACTCTTCATAATCTTGTAATCCAATATGCCAGCCAAGGGCGT
TATGAAGTCGCCGTTCCGTTATGTAAACAGGCTTTAGAAGATTTAGAAAA
AAACAGTGGCCATGACCATCCAGACGTAGCAACTATGCTTAACATACTGG
CATTAGTATACCGAGATCAAGGAAAGTATAGAGAAGCTGCCAACCTTCTC
AACGATGCGTTAGCAATCAGAGAAAAAACACTTGGACCAAAACATTCAGC
GGTTGCTGCTACTCTAAATAATTTGGCTGTGTTATATGGTAAAAGAGGTC
GGTATAAAGAAGCTGAACCCTTGTGTAAAAGAGCACTTCTTATACGAGAA
GAGGCACTTGGATCTGATCATCCAGATGTAGCAAAACAATTGAATAATTT
AGCTTTACTTTGCCAGAATCAAGGAAAATACGAAGAAGTTGAAATGTATT
ATCAACGGGCATTGGAAATTTATTTACAAAAATCTGGCCCAGATGATCCT
AATGTTGCTAAAACAAAAACAAATTTAGCCACAGCATATTTGAAGCAAAA
TAAATTCAGTAAAGCTGAATCATTGTACAAAGAAATTTTGACCAGATTCC
ACGAGCAAGAGTTTGGAAAAGACAATCCTCAGCAGAAACCAATTTGGGTT
TTGGCAGAAGAACGACAAGAATGCTTTACAAAGAATAAAGAAATTCCATA
TTTATCCAGTGACAATTGTTGGCACAAGTCTTCAAGAATCGACAACTCGA
CTGTTTACACAACTCTCAAGAATCTCAGTGCACTTTATCGCCGTCAAAAT
AAAACTGAAGCAGCCGAAACTGTGGAAAATTGGATTAGTCGGAGCAAAAT
GGTGATTTTTTCTGATTCAAATGACAGTTGCAACGAATCACAGTCTTGTA
AGCCCCAATTTACTTTGAAACCGAAGGTTGTCCTTAATGGTGACTCGAAT
AATATTCAACAGAATTTAATAATTGAGACTGGTAATGATTTATTGTTCAA
AAAGATATGTAGTCATCCTTTGAGTAGCAGCATTAGTCGATATGAAAAGA
GCCAGTTCAATGTCAACCCTGGTTGGAAACAACATTGAATCAGAAGATTT
GAAGAACATTCAGAAACCAATACAGTCATCATTTTTCAAGAAAGGTAACA
ATATTAGTATAGAAAATTTGAAAAAAATGTTTTCGCGGTTTGTTTGATCT
GATAAAATTTTGTTGTAAAATTTACATTATCATTATTATCTAGTCACTGA
TATCTATATATTATGGTCTTTTTGTTCATTATCGATATCTCTGTTGAAAA
TCTCTATAAATTATTATTCTTATTATTCCTATAATTATATATATATATAT
ATATTATACATTTAATGTTGATATCATCATTTCTACTGTTATGATTGATT
TTTAGTGATCTTTTATATCAAAAACTTGAACGCCTTCTTGCTAGACATTC
CAATTTGAATATTTTACCGAATAATTTGTCCAGCATCCCTAATTTGATTT
TTTTTATTATTACATCTTTAATAAATCTTTAGTGGTTATGACGGAATCTT
TATAGTGTTCATTTTATTTTTCTAAACTTGTAATGTTTGTTATGATTTTT
AAGTCCATATTTGGCAATAGTTTGTATATATTCCAGGATAAATTTTGATA
TGGAATCAGTGTTCTTTAGAAATAGATATTTATGTTTACATTTTGCACTT
TTAAAAGCATTTGCTTTTCTTTCGTTGTGTTGAGTATCTGTTTACTTTCA
TAGGCGATTTATTTGAATATATTATTTTGTTTTG
back to top

protein sequence of SMED30018861-orf-1

>SMED30018861-orf-1 ID=SMED30018861-orf-1|Name=SMED30018861-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MSKKSNLSTDEIVSHTKSSLMVLESLKNDHCQSINNFREQFECSGDNSDC
DTKVPWFEQSLNKIELGIEEAELIIQLYEFLQISESERNKLKVQIGRLNQ
ENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKD
PSINGSDKVDNLSSDLGFTDEDKDQEPNDVMMQSQSSSVSHGSGFEIPAR
LRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKNSGHDHPDVATMLNILA
LVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGR
YKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYY
QRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFH
EQEFGKDNPQQKPIWVLAEERQECFTKNKEIPYLSSDNCWHKSSRIDNST
VYTTLKNLSALYRRQNKTEAAETVENWISRSKMVIFSDSNDSCNESQSCK
PQFTLKPKVVLNGDSNNIQQNLIIETGNDLLFKKICSHPLSSSISRYEKS
QFNVNPGWKQH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002151Kinesin_light
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: cellular component
TermDefinition
GO:0005871kinesin complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 81..108
NoneNo IPR availablePFAMPF13424TPR_12coord: 201..275
e-value: 3.6E-17
score: 62.4
coord: 284..358
e-value: 3.0E-19
score: 69.1
NoneNo IPR availablePFAMPF13374TPR_10coord: 368..409
e-value: 1.5E-5
score: 24.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 143..191
NoneNo IPR availablePANTHERPTHR45783:SF7KINESIN LIGHT CHAIN 1coord: 3..482
NoneNo IPR availablePANTHERPTHR45783FAMILY NOT NAMEDcoord: 3..482
IPR002151Kinesin light chainPRINTSPR00381KINESINLIGHTcoord: 194..213
score: 91.0
coord: 281..298
score: 92.22
coord: 93..110
score: 65.56
coord: 216..234
score: 91.58
coord: 325..345
score: 94.76
coord: 360..381
score: 75.45
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 243..276
e-value: 0.11
score: 21.5
coord: 369..402
e-value: 0.057
score: 22.5
coord: 201..234
e-value: 230.0
score: 3.0
coord: 285..318
e-value: 7.0E-4
score: 28.9
coord: 327..360
e-value: 0.051
score: 22.7
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 201..234
score: 5.753
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 369..402
score: 7.405
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 327..360
score: 7.11
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 243..276
score: 8.496
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 285..318
score: 7.523
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 180..484
e-value: 8.1E-131
score: 437.6
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 280..399
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 201..315
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 201..402
score: 19.4