Cysteine and histidine-rich protein

Overview
NameCysteine and histidine-rich protein
Smed IDSMED30018854
Length (bp)2339
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018854

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30018854SMESG000023278.1 SMESG000023276.1 Contig35698newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018854SMESG000023278.1 SMESG000023276.1 Contig35698uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30018854SMESG000023276.1 PL06013A1A03_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cysteine and histidine-rich protein vs. Ensembl Human
Match: CYHR1 (cysteine and histidine rich 1 [Source:HGNC Symbol;Acc:HGNC:17806])

HSP 1 Score: 95.5153 bits (236), Expect = 2.743e-20
Identity = 61/176 (34.66%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  333 EIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++     D QS +  +QL+ +I S L  + +G
Sbjct:  103 ERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILD---GMD-QSHRKEMQLYNSIFSLLSFEKIG 272          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Human
Match: CYHR1 (cysteine and histidine rich 1 [Source:HGNC Symbol;Acc:HGNC:17806])

HSP 1 Score: 88.1965 bits (217), Expect = 8.648e-19
Identity = 57/185 (30.81%), Postives = 89/185 (48.11%), Query Frame = 3
Query:  303 IGPSEENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            + P     +   + +L+   + L  +  + +C NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++     D QS +  +QL+ +I S L  + +G
Sbjct:    1 MAPKPGAEWSTALSHLVLGVVSLHAAVSTAECTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILD---GMD-QSHRKEMQLYNSIFSLLSFEKIG 179          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Human
Match: CYHR1 (cysteine and histidine rich 1 [Source:HGNC Symbol;Acc:HGNC:17806])

HSP 1 Score: 85.5001 bits (210), Expect = 4.371e-17
Identity = 54/156 (34.62%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  390 NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            + C NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++     D QS +  +QL+ +I S L  + +G
Sbjct:   81 HWCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILD---GMD-QSHRKEMQLYNSIFSLLSFEKIG 230          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Celegans
Match: siah-1 (E3 ubiquitin-protein ligase siah-1 [Source:UniProtKB/Swiss-Prot;Acc:Q965X6])

HSP 1 Score: 48.9062 bits (115), Expect = 9.816e-6
Identity = 50/187 (26.74%), Postives = 80/187 (42.78%), Query Frame = 3
Query:  264 TVKRQRLNIVADKI----GPSEENSFMEIMKNLLSCSICLE--VSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDE---CTKRMVPCKYKMFGCNWIG-----IEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQS 782
            T   Q +  VA  I    G + ++S  EI+ ++  C +CLE  +  Y  QC +GHL+C  C  +LQ       CP CR        R+L  E++ + +   CKF  +   + +    +T+    C  R   C      C W G     +E L K H+   ++  + +  L   +N   A D   +QS
Sbjct:  122 TTTAQGIQSVAPHIPIGGGGATDDSSAEIL-SVFECPVCLEYMLPPYM-QCSSGHLVCSNCRPKLQ------CCPTCRGPTPS--VRNLGLEKIANTVRFPCKFSTSGCPLNFHHADKTEHEELCEFRPYCCPCPGASCKWQGGLSDVMEHLKKIHKSITTLQGEDIVFLATDINLPGAVDWVMMQS 298          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Fly
Match: CG32486 (gene:FBgn0266918 transcript:FBtr0073004)

HSP 1 Score: 89.7373 bits (221), Expect = 1.278e-18
Identity = 47/129 (36.43%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  339 MKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISL-KQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDEC 701
            + N L C++CL++   +  QC  GHL+C  C       GRL+       CP CR+ + K    R+L  E+  SELP+EC+FC+     K +++HE  EC +R   CKY   GC W G    + +HE  C
Sbjct:  107 ISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQIA--TCPNCRVEISKSTASRNLAVEKAASELPSECQFCNKEFPYKSLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNC 233          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Fly
Match: sinah (gene:FBgn0259794 transcript:FBtr0301683)

HSP 1 Score: 60.4622 bits (145), Expect = 2.187e-9
Identity = 50/160 (31.25%), Postives = 69/160 (43.12%), Query Frame = 3
Query:  333 EIMKNLLSCSICLE-VSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKF----CDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIG-----IEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQS 782
            + +  LL C +C   +     QCP GHLIC TC  +L        CPVCR+ +     RSL  E++ S+L   CK     C   ++     KHE D C  R   C Y    C+W G      + L   HE+  ++    +  L   VN   A D   +QS
Sbjct:   98 DFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTI------CPVCRVFMTN--IRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEED-CECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQS 248          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Zebrafish
Match: cyhr1 (cysteine/histidine-rich 1 [Source:NCBI gene;Acc:767773])

HSP 1 Score: 97.4413 bits (241), Expect = 3.699e-21
Identity = 66/188 (35.11%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  300 KIGPSEENSFMEIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIG-IEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            ++   E     E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC +C        + +H+T+EC  R+  CKYK  GC W G   ELS  HE EC   +KT   L  I++E      QS +  LQL+ +I S L  + +G
Sbjct:   70 RLQEGEAGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEE--QATCPNCRCEISKSLCCRNLAVEKAVSELPSECSYCLKQFPRSGLDRHQTEECQDRVTQCKYKRIGCPWQGPFHELSA-HEAECCHPSKTGMELMGILDEMD----QSHRRELQLYNSIFSLLCFEKIG 250          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Xenopus
Match: cntn2 (contactin 2 [Source:Xenbase;Acc:XB-GENE-6070188])

HSP 1 Score: 89.7373 bits (221), Expect = 5.962e-19
Identity = 55/155 (35.48%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  393 QCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
             C NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ DEC  R+  CKYK  GC W G       HE EC    KT   L EI++E      Q+ +  +QL+ +I S L  + +G
Sbjct:   29 HCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLKQFPRSLLERHKKDECQDRVTQCKYKRIGCPWQGPFHELTVHESECCHPTKTGNELMEILDEMD----QTHKKEMQLYNSIFSLLSFEKIG 177          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Mouse
Match: Cyhr1 (cysteine and histidine rich 1 [Source:MGI Symbol;Acc:MGI:1859320])

HSP 1 Score: 95.9005 bits (237), Expect = 1.886e-21
Identity = 61/176 (34.66%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  333 EIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++E      QS +  +QL+ +I S L  + +G
Sbjct:   98 ERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEE--QATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMD----QSHRKEMQLYNSIFSLLSFEKIG 267          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Mouse
Match: Cyhr1 (cysteine and histidine rich 1 [Source:MGI Symbol;Acc:MGI:1859320])

HSP 1 Score: 97.8265 bits (242), Expect = 3.963e-21
Identity = 65/205 (31.71%), Postives = 102/205 (49.76%), Query Frame = 3
Query:  333 EIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIR 923
            E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++E      QS +  +QL+ +I S L  + +G  + +    L  +  E+   ++   P+ R
Sbjct:   98 ERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEE--QATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMD----QSHRKEMQLYNSIFSLLSFEKIGYTVWVFGPYLWSTEQEE--HSIKSDPVYR 294          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Mouse
Match: Cyhr1 (cysteine and histidine rich 1 [Source:MGI Symbol;Acc:MGI:1859320])

HSP 1 Score: 93.5893 bits (231), Expect = 2.906e-20
Identity = 58/174 (33.33%), Postives = 87/174 (50.00%), Query Frame = 3
Query:  336 IMKNLLSCSICLEVSSYSNQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            ++ +L+   + L  +  S QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++E      QS +  +QL+ +I S L  + +G
Sbjct:   12 VLSHLVLAGVSLHAAVSSVQCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMD----QSHRKEMQLYNSIFSLLSFEKIG 179          
BLAST of Cysteine and histidine-rich protein vs. UniProt/SwissProt
Match: sp|Q08CH8|CYHR1_DANRE (Cysteine and histidine-rich protein 1 OS=Danio rerio OX=7955 GN=cyhr1 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.467e-20
Identity = 66/188 (35.11%), Postives = 97/188 (51.60%), Query Frame = 3
Query:  300 KIGPSEENSFMEIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIG-IEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            ++   E     E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC +C        + +H+T+EC  R+  CKYK  GC W G   ELS  HE EC   +KT   L  I++E      QS +  LQL+ +I S L  + +G
Sbjct:   63 RLQEGEAGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEE--QATCPNCRCEISKSLCCRNLAVEKAVSELPSECSYCLKQFPRSGLDRHQTEECQDRVTQCKYKRIGCPWQGPFHELSA-HEAECCHPSKTGMELMGILDEMD----QSHRRELQLYNSIFSLLCFEKIG 243          
BLAST of Cysteine and histidine-rich protein vs. UniProt/SwissProt
Match: sp|Q2TAD9|CYR1B_XENLA (Cysteine and histidine-rich protein 1-B OS=Xenopus laevis OX=8355 GN=cyhr1-b PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 3.669e-20
Identity = 60/176 (34.09%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  333 EIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP++C FC        +++H+ +EC  R+  CKYK  GC W G       HE EC    KT   L EI++E      Q+ +  +QL+ +I S L  + +G
Sbjct:   64 ERLYSVLCCAVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEE--QATCPNCRCEISKSLCCRNLAVEKAISELPSDCGFCLKQFPRSLLERHKKEECQDRVTQCKYKRIGCPWQGPYHELTVHESECCHPTKTGNELMEILDEMD----QTHKKEMQLYNSIFSLLSFEKIG 233          
BLAST of Cysteine and histidine-rich protein vs. UniProt/SwissProt
Match: sp|Q6GNX1|CYR1A_XENLA (Cysteine and histidine-rich protein 1-A OS=Xenopus laevis OX=8355 GN=cyhr1-a PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 4.099e-20
Identity = 60/176 (34.09%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  333 EIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP++C FC        +++H+ +EC  R+  CKYK  GC W G       HE EC    KT   L EI++E      Q+ +  +QL+ +I S L  + +G
Sbjct:   64 ERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEE--QATCPNCRCEISKSLCCRNLAVEKAVSELPSDCGFCLKQFPRSLLERHKKEECQDRVTQCKYKRIGCPWEGPYHELTVHESECCHPTKTGNELMEILDEMD----QTHKKEMQLYNSIFSLLSFEKIG 233          
BLAST of Cysteine and histidine-rich protein vs. UniProt/SwissProt
Match: sp|Q5BK76|CYHR1_RAT (Cysteine and histidine-rich protein 1 OS=Rattus norvegicus OX=10116 GN=Cyhr1 PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.594e-19
Identity = 59/179 (32.96%), Postives = 88/179 (49.16%), Query Frame = 3
Query:  321 NSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            N +   + +L+   + L  +  S QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++E      QS +  +QL+ +I S L  + +G
Sbjct:    7 NEWSTALSHLVLAGVSLHAAVSSVQCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMD----QSHRKEMQLYNSIFSLLSFEKIG 179          
BLAST of Cysteine and histidine-rich protein vs. UniProt/SwissProt
Match: sp|Q9QXA1|CYHR1_MOUSE (Cysteine and histidine-rich protein 1 OS=Mus musculus OX=10090 GN=Cyhr1 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.033e-19
Identity = 58/174 (33.33%), Postives = 87/174 (50.00%), Query Frame = 3
Query:  336 IMKNLLSCSICLEVSSYSNQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            ++ +L+   + L  +  S QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP+EC FC        +++H+ +EC  R+  CKYK  GC W G       HE  C+   KT   L EI++E      QS +  +QL+ +I S L  + +G
Sbjct:   12 VLSHLVLAGVSLHAAVSSVQCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMD----QSHRKEMQLYNSIFSLLSFEKIG 179          
BLAST of Cysteine and histidine-rich protein vs. TrEMBL
Match: A0A183VZ63 (RING-type domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS5769 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 6.199e-37
Identity = 102/310 (32.90%), Postives = 160/310 (51.61%), Query Frame = 3
Query:  243 ISENPEITVKRQRLNIVADKIGPSEENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLN---CPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDL----QSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSS 1151
            I+ N E  +   R N +  K+    EN  ++ +K+LL+CS+CLE+   +NQCPNGHLIC  CS +L Q     N   CP CR++L+  L R LLAEQ+T+ELP EC +C  ++  + IK+HE + C  R V C+Y + GC W G  E    H  +C    KTV    E V  N+ R+L      L + +Q  K + +KL    +G R++ +Q     ++S D N                N     +++++      E  KL Y +++++    + +  L S K  + +  ++ D LHS HF++ +K SS
Sbjct:   77 INANDETFLHDHR-NYIKSKLN---ENDILDTLKSLLTCSVCLEIRDQTNQCPNGHLICSQCSIQLLQQSSQTNLAKCPSCRVNLQYKLRRCLLAEQMTAELPHECHYCFNIIPRRLIKQHEYELCPNRYVTCRYNLVGCVWKGKYEDLNSHISKCDYKQKTV----EDVESNLVRNLIHYELYLMNEIQFSKTLSTKLNNYPMGLRIIQKQIAAFHNDSSDVNANSVNYQANNTTL-LSNFKRLTVEIHIN----CELNKLDYSIKTKSNKTTDFLICLNSFKCGDIL-FNINDQLHSVHFDALNKQSS 372          
BLAST of Cysteine and histidine-rich protein vs. TrEMBL
Match: A0A504YZ88 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_07182 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.382e-35
Identity = 89/289 (30.80%), Postives = 152/289 (52.60%), Query Frame = 3
Query:  315 EENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRL--QQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNK-SNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLI 1172
            EE +  EI+++LL+C++CL+V   + QC NGHLIC+ C+ RL  QQ+P D  CP CRI L+ GL R LLAEQL +ELP+ C+FC + M  K  + HET  C  R V C++ + GC W G     + H   C+   K +  +  ++   + ++        Q  + ++++L     G +   +   +++ + S ++ + +         F CC L    L++ +  +      +L Y ++S++     ++F L  ++  +    DV D LH+  F S+ K+SS +  KLI
Sbjct:   84 EEQALQEIVRSLLTCAVCLDVPRQAFQCSNGHLICVHCATRLLQQQSPSDAVCPSCRIPLQFGLRRCLLAEQLAAELPSNCRFCGSKMVRKLTELHETTICPSRPVTCRFSVVGCPWSGKWNQLESHTVHCAYKEKRLHEVESVLVAALDQNQIWQAERNQFSRGLLTRLAKSPGGLKAFRKLVGVSRETQSLESEEGIATYQSTSNLFRCCGLKRVTLEVTINYIQ----GELRYRVKSKSEQASEILFCLCLVRCGD-AEFDVNDQLHNFRFTSNQKESSDYLTKLI 367          
BLAST of Cysteine and histidine-rich protein vs. TrEMBL
Match: A0A4E0QZJ7 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_008685 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.907e-34
Identity = 87/289 (30.10%), Postives = 148/289 (51.21%), Query Frame = 3
Query:  315 EENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRL--QQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNK-SNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLI 1172
            EE +  EI+++LL+C++CL+V   + QC NGHLICI C+ RL  Q +P D  CP CR  L+ GL R LLAEQL +ELP+ C+FC + M  K  + HET  C  R V C++ + GC W G     + H   C+   K +  +  ++   + ++        Q  + ++++L     G +   +   +++ + S ++ + +         F CC L    L++ +  +      +L Y ++S++     ++F L  ++  +    DV D LHS  F  + K+S  +  KLI
Sbjct:   84 EEQALQEIVRSLLTCAVCLDVPRQAFQCSNGHLICIHCATRLLQQHSPSDAVCPSCRTPLQFGLRRCLLAEQLAAELPSNCRFCGSKMVRKLTELHETTICPSRPVTCRFSVVGCPWSGKWNQLESHTVHCAYKEKRLHEVESVLVAALDQNQIWQAERNQFSRGLLTRLAKSPGGLKAFRKPVGVSRETQSPESEEGIATYQSTSNLFRCCGLKRVTLEVTINYIQ----GELRYRVKSKSEQASEILFCLCLVRCGD-AEFDVNDQLHSFRFSPNQKESPDYLTKLI 367          
BLAST of Cysteine and histidine-rich protein vs. TrEMBL
Match: A0A183AWV3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11438 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 5.107e-34
Identity = 96/323 (29.72%), Postives = 161/323 (49.85%), Query Frame = 3
Query:  228 ISERPISENPEITVKRQRLNIVADKIGPSEE----NSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLN--CPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKS--NSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLI 1172
            +SE P++ +P  +V+ +  N+    I  +E+     +  E +++L++C+ICL++   + QC NGHLICI C  RL Q   + N  CP CRI L  GL R LLAEQL SELP++C+FC   M  K I++HET  C  R V C++ + GC W G     + H   C   +K +  +  ++   + ++        Q  + ++++L   + G +   RQ  +++    +E             + F CC L    +D+ V    + +   LHY ++S+      + F L  +   + V  DV D L +  F S+ K+S  +  KL+
Sbjct:   52 VSEIPLTLSPN-SVESESSNVKESVIPNTEQEQGNQTLQEAVRSLITCAICLDIPKQAYQCSNGHLICIHCVTRLLQQHSNSNAVCPSCRIPLHFGLRRCLLAEQLASELPSDCRFCGLRMVRKQIEQHETTLCPVRPVTCRFSVIGCQWFGKWNQLEGHFKHCPYKDKPISEIEPLLVTALHQNQIWTSERNQFPRGLLAQLAKSSGGLKAFRRQIAVSREVPGTESCEGRAIYQSTSNL-FRCCGLKRITVDVTV----DHKQGDLHYCIKSKWEQTSEISFRLCLVHCGD-VEFDVNDQLRTFRFSSNQKESPTYSTKLM 367          
BLAST of Cysteine and histidine-rich protein vs. TrEMBL
Match: A0A0R3WGU8 (RING-type domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS10092 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.984e-33
Identity = 99/309 (32.04%), Postives = 151/309 (48.87%), Query Frame = 3
Query:  282 LNIVADKIGPSEENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRL----QQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSED-ANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETV-----NLDVQDSLHSHHFESSHKDSSLHEFKLISL 1178
             N    + G   E  FM I K LL C++CLE  + +NQC NGHLIC  C+ +L    QQ      CP CRI+L  G+ R LLA QL++ELP  C FCD       ++ HET+ C  R V CKY +FGC W G    +  HE  CS+S ++V  +  I+ E   +  +        W  I++  + + +G  + IR+TTL++   E+  N+  F+    ++  T     G +       +N  +  K +Y  +        + F LL+I   + V      L V  S HSH ++  H   ++ + KL++L
Sbjct:   30 WNDAISRSGLDSEQIFMAI-KKLLRCTVCLEYHTEANQCKNGHLICRQCTHQLERGLQQETNRGTCPTCRITLFPGISRCLLATQLSAELPTPCLFCDLYFRQSELEHHETNLCPMRPVKCKYNIFGCLWKGKANEASRHERNCSVSKRSVRDVETIIQEKFYQRSKRSNDSSNSWHEIVNLFKERPLGVFVCIRETTLHQVMRENRRNEFRFQCTTGQLSQT-----GQFNATIELTIN-LDDLKFYYRTKLHTGFTETVKFRLLTIHGYDLVIPTADRLRVPKSKHSHEWQKFHCHFNVCDSKLMAL 331          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Cavefish
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:103031594])

HSP 1 Score: 93.5893 bits (231), Expect = 5.772e-20
Identity = 63/188 (33.51%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  300 KIGPSEENSFMEIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIG-IEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            ++   E     E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP++C +C        +  H+T+EC  R+  CKYK  GC W G   EL   HE +C   +KT   L  I++E      QS +  LQL+ +I S L  + +G
Sbjct:   71 RLQEGEAGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSDCSYCLKQFPRSSLDHHQTEECQDRLTQCKYKRIGCPWQGPFHELCA-HEVDCCHPSKTGIELMGILDEMD----QSHRRELQLYNSIFSLLSFEKIG 251          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Cavefish
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:103031594])

HSP 1 Score: 82.8037 bits (203), Expect = 7.472e-17
Identity = 55/155 (35.48%), Postives = 78/155 (50.32%), Query Frame = 3
Query:  396 CPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIG-IEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            C NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP++C +C        +  H+T+EC  R+  CKYK  GC W G   EL   HE +C   +KT   L  I++E      QS +  LQL+ +I S L  + +G
Sbjct:   15 CTNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPSDCSYCLKQFPRSSLDHHQTEECQDRLTQCKYKRIGCPWQGPFHELCA-HEVDCCHPSKTGIELMGILDEMD----QSHRRELQLYNSIFSLLSFEKIG 162          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Sea Lamprey
Match: cyhr1 (cysteine/histidine-rich 1 [Source:NCBI gene;Acc:767773])

HSP 1 Score: 73.1738 bits (178), Expect = 2.220e-14
Identity = 49/156 (31.41%), Postives = 75/156 (48.08%), Query Frame = 3
Query:  393 QCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVP-CKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELPAEC FC        ++ H+ + C   ++  C+Y+  GC W G       HE EC    KT   L  +++E      Q+ +  +QL+  I + L ++ +G
Sbjct:    1 QCSNGHLMCAGCFIHLLADARLKEEQA--TCPNCRCEISKSLCCRNLAVEKAVSELPAECGFCLHQFPRSCLEHHQKELCNHFLLTNCRYQRIGCPWQGPFHEISAHEAECCHPKKTGSELMGVLDEMD----QNHKKEMQLFNDIFTLLSLEKIG 150          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Nematostella
Match: EDO46014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRI7])

HSP 1 Score: 87.4261 bits (215), Expect = 5.000e-19
Identity = 75/254 (29.53%), Postives = 110/254 (43.31%), Query Frame = 3
Query:  465 CPVCRISL-KQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVN---ENIARDLQSLQSPLQLW---KAIISKLRVQAVGSRMLIRQTTLNKSN-SEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETE---PEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLI-SLDCQK 1190
            CP CRI + +    R+L  E+  SELP  C+FCD          HE +EC+ R+V CKYK  GC W G       HE  C    KT   L E +N   E    +LQ+L + + L    K  I+ L+++   +   I Q     S  +    Q V K                      TK+N  E      L + L  + +  IN+ F +L        +L ++ SLH H F +  ++S  HE +L+ S++C K
Sbjct:   22 CPSCRIDISRNNCSRNLAVEKAVSELPTACQFCDNEFPRSIASIHEREECSDRLVRCKYKRLGCPWQGPHHELALHEGACPHPGKTGLELMEALNAIDEKNEMELQTLGTIVGLLSFEKIAINDLQLRPYRTDDFIPQLYYETSRFNALGQQWVVK----------------------TKVNGNEKSLKRGLMFQLAQKTKGPINIKFMMLQSPFG---DLTIKPSLHHHEFMTDKQESDFHEVQLLDSVECNK 250          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Medaka
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:101156262])

HSP 1 Score: 94.7449 bits (234), Expect = 2.350e-20
Identity = 62/187 (33.16%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  300 KIGPSEENSFMEIMKNLLSCSICLEVSSYS-NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
            +I   E     E + ++L C++CL++   S  QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP +C FC        +++H+ +EC  R+  CKYK  GC W G       HE ECS   KT   L  I+ E      QS +   QL+ +I   L  + +G
Sbjct:   78 RIQEGESGKLEERLYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQA--TCPNCRCEISKNLCCRNLAVEKAVSELPTDCTFCLKQFPRSSLERHQKEECQDRVTQCKYKRIGCPWQGPFHELPAHESECSHPTKTGTELMGILGEMD----QSHRRDTQLYNSIFGLLCYEKIG 258          
BLAST of Cysteine and histidine-rich protein vs. Ensembl Medaka
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:101156262])

HSP 1 Score: 84.3445 bits (207), Expect = 2.037e-17
Identity = 54/156 (34.62%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  390 NQCPNGHLICITC------SGRLQQTPGDLNCPVCRISLKQGLH-RSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVG 836
             QC NGHL+C  C        RL++      CP CR  + + L  R+L  E+  SELP +C FC        +++H+ +EC  R+  CKYK  GC W G       HE ECS   KT   L  I+ E      QS +   QL+ +I   L  + +G
Sbjct:   12 GQCTNGHLMCAGCFIHLLADSRLKEEQA--TCPNCRCEISKNLCCRNLAVEKAVSELPTDCTFCLKQFPRSSLERHQKEECQDRVTQCKYKRIGCPWQGPFHELPAHESECSHPTKTGTELMGILGEMD----QSHRRDTQLYNSIFGLLCYEKIG 161          
BLAST of Cysteine and histidine-rich protein vs. Planmine SMEST
Match: SMESG000023276.1 (SMESG000023276.1)

HSP 1 Score: 1434.08 bits (3711), Expect = 0.000e+0
Identity = 714/714 (100.00%), Postives = 714/714 (100.00%), Query Frame = 3
Query:   57 MTDGQSSRSISSFWRNLKRALISAPDIHNGSPVCLECGMRXXXXXXXXXXXXXXXXLISERPISENPEITVKRQRLNIVADKIGPSEENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLISLDCQKDVPKIYELDTIFVEVCILSERERSEKSHGILNSTDEDETNPFLSNGSDSNVVFTLFSPTTSASRSINTSNTMISANDDVNAANEVEPSHEEDIVITVTDNVDSGDDISNDNRDNITMRNNHGFVAVPSVFINPATSVFTYSPFSIDNSFVPNTFLQQSRLVRDGLNYEQPIQQLSQENQPIITSDQDLIRFQTINANRNGNPLLNESISLQDPNRAIREPIQMSFFYPPQTILSPYITNSVPPIAVRPTISPRTLGVRQRLNTYPMGSRQSNFPSNSEESGLNSFENRTSDSYVTDTSYNISSVQDIHDTRFQIPNNDESVNSSFAPNPAGTLLDR 2198
            MTDGQSSRSISSFWRNLKRALISAPDIHNGSPVCLECGMRVTNSSNVSNNVNNESVLISERPISENPEITVKRQRLNIVADKIGPSEENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLISLDCQKDVPKIYELDTIFVEVCILSERERSEKSHGILNSTDEDETNPFLSNGSDSNVVFTLFSPTTSASRSINTSNTMISANDDVNAANEVEPSHEEDIVITVTDNVDSGDDISNDNRDNITMRNNHGFVAVPSVFINPATSVFTYSPFSIDNSFVPNTFLQQSRLVRDGLNYEQPIQQLSQENQPIITSDQDLIRFQTINANRNGNPLLNESISLQDPNRAIREPIQMSFFYPPQTILSPYITNSVPPIAVRPTISPRTLGVRQRLNTYPMGSRQSNFPSNSEESGLNSFENRTSDSYVTDTSYNISSVQDIHDTRFQIPNNDESVNSSFAPNPAGTLLDR
Sbjct:    1 MTDGQSSRSISSFWRNLKRALISAPDIHNGSPVCLECGMRVTNSSNVSNNVNNESVLISERPISENPEITVKRQRLNIVADKIGPSEENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLISLDCQKDVPKIYELDTIFVEVCILSERERSEKSHGILNSTDEDETNPFLSNGSDSNVVFTLFSPTTSASRSINTSNTMISANDDVNAANEVEPSHEEDIVITVTDNVDSGDDISNDNRDNITMRNNHGFVAVPSVFINPATSVFTYSPFSIDNSFVPNTFLQQSRLVRDGLNYEQPIQQLSQENQPIITSDQDLIRFQTINANRNGNPLLNESISLQDPNRAIREPIQMSFFYPPQTILSPYITNSVPPIAVRPTISPRTLGVRQRLNTYPMGSRQSNFPSNSEESGLNSFENRTSDSYVTDTSYNISSVQDIHDTRFQIPNNDESVNSSFAPNPAGTLLDR 714          
BLAST of Cysteine and histidine-rich protein vs. Planmine SMEST
Match: SMESG000067104.1 (SMESG000067104.1)

HSP 1 Score: 201.83 bits (512), Expect = 1.559e-56
Identity = 123/392 (31.38%), Postives = 210/392 (53.57%), Query Frame = 3
Query:  252 NPEITVKRQRLNIVADKIGPS-EENSFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPG--DLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQDSLHSHHFESSHKDSSLHEFKLISLDCQKDVPKIYEL----DTIFVEVCILSERERSEKSHGILN-STDEDETNPFLSNGSDS------NVVFTLFSPTTSASRS 1385
            N +I  K+ +L+I+   +  + ++ +F+E+MK LL+CS+CLEV   +NQC NGHLICI C+  LQQ+    ++NCPVCR+ L     RSLLAEQL SELP +C+FC T M+V+ +++HE++ C  R + C+Y +FGC W G+ +  K HE  C++   TV +  E V+ N+       +     W+  ++KLR +  G ++ ++   L K   + + +T FK+  +         H F L   + K  ++  + + Y L+  ++  + + F+L SI+ ++    ++ D+LH H F    +++  +     S +  + V  + E     D++++E+ ++ E   S  S    N   D  ET     N S S      N+V  L S  + AS+S
Sbjct:   42 NYKILNKKPKLDIMTQSLQDNFDQTAFIEVMKKLLTCSVCLEVRKQANQCQNGHLICINCTLCLQQSSSSKEINCPVCRVPLTGYYQRSLLAEQLVSELPTKCRFCSTTMSVRQMQQHESEICPARTINCQYALFGCPWKGVAKQRKLHESLCNVGLSTVALACETVHSNLKNQFSYYEKRNSQWQNTVNKLRERNNGLKIYMKHLVLTKYKDQPSIKTCFKTTKLEFF-----RHQFQLKFNIGKDKKSATKSMFYKLKYVSKHNLTVNFFLHSIRYDDDT-FELDDNLHYHSFSEDEQNAGRYNIHF-SKNKPETVNSLLETLTTKDSLYIEIVLMIESNESLDSTNTNNLQIDTSETISQAINNSRSGTSNAGNLVVALISSNSLASQS 426          
BLAST of Cysteine and histidine-rich protein vs. Planmine SMEST
Match: SMESG000007190.1 (SMESG000007190.1)

HSP 1 Score: 112.464 bits (280), Expect = 2.102e-26
Identity = 76/322 (23.60%), Postives = 144/322 (44.72%), Query Frame = 3
Query:  231 SERPISENPEITVKRQRLNIVADKIGPSEEN---SFMEIMKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVC-RISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTV----FKSPMIRIPFTCCNLHGFYLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIK-INETVNLDVQDSLHSHHFESSHKDSSLHEFKL 1169
            ++R I+EN  +  K + +N +   I    +N    F   +K+   CS C     +  QC  GH+ C  C          + C  C ++     L    +     S + + C+FC+       +  H+ ++CT+R+  C + +FGC W+   +  + H   C   N  +    E+    I +    + +   ++   +SK++    G R+ I++  L KS     + T+    F S    +PF+CC  HGF  ++Y+        +K+ Y+++S+N   + L + L+S   I +  N    D  H H FE ++++S+ +E K+
Sbjct:   41 TKRNINENDAVKNKIRNINYIEVTILNMSKNDIEKFTNKIKSYFECSKCKMTDKFFKQCCYGHIFCYNCIKN-----NGIYCDECDKMIDSNELSLCTIPSNAHSFIKSICQFCNNQYYQDNLMTHQNEQCTRRITNCDFHIFGCLWLETVDKKRLHLQSCPFQNLKLKQSLELYQNFINKQKVIISNENAIFLDCLSKIKQLNNGLRLAIKEVILTKSQLSFVSNTIYCIKFASSTFYLPFSCCVSHGFNFELYLVIDKSRNTKKIRYIIKSDNEYLLKLYYCLISFSLIEDEENFPFSDMFHWHEFERNNEESAANEIKI 357          
BLAST of Cysteine and histidine-rich protein vs. Planmine SMEST
Match: SMESG000001532.1 (SMESG000001532.1)

HSP 1 Score: 107.842 bits (268), Expect = 5.044e-25
Identity = 81/270 (30.00%), Postives = 129/270 (47.78%), Query Frame = 3
Query:  339 MKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETE----PEKLHYVLRSEN---RTKINLMFYLLSIKINETVNLDVQDSLHSHHF 1127
            +KN+++CS C        +C NGHLIC +C   L+Q      CPVCRI L     + L+AE++ SELP  C  C  V+  K +  H+  +C KR V C Y   GC WIG  E S  H  +C +S  T   + EI  + +AR  QS     Q + +++ +L       R +    +  KS S+      F+S         CN   + L++   ++N++E     + + Y    EN    ++ +  F L+SIK ++ V + ++  L+   F
Sbjct:   67 IKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERP-QCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDT--SISEIA-DYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTV--ALSFIKSTSD---TFTFRSDQFH-----CNQSRWSLEVRFYQINDSEENYVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKF 322          
The following BLAST results are available for this feature:
BLAST of Cysteine and histidine-rich protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CYHR12.743e-2034.66cysteine and histidine rich 1 [Source:HGNC Symbol;... [more]
CYHR18.648e-1930.81cysteine and histidine rich 1 [Source:HGNC Symbol;... [more]
CYHR14.371e-1734.62cysteine and histidine rich 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
siah-19.816e-626.74E3 ubiquitin-protein ligase siah-1 [Source:UniPro... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG324861.278e-1836.43gene:FBgn0266918 transcript:FBtr0073004[more]
sinah2.187e-931.25gene:FBgn0259794 transcript:FBtr0301683[more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cyhr13.699e-2135.11cysteine/histidine-rich 1 [Source:NCBI gene;Acc:76... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cntn25.962e-1935.48contactin 2 [Source:Xenbase;Acc:XB-GENE-6070188][more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cyhr11.886e-2134.66cysteine and histidine rich 1 [Source:MGI Symbol;A... [more]
Cyhr13.963e-2131.71cysteine and histidine rich 1 [Source:MGI Symbol;A... [more]
Cyhr12.906e-2033.33cysteine and histidine rich 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08CH8|CYHR1_DANRE2.467e-2035.11Cysteine and histidine-rich protein 1 OS=Danio rer... [more]
sp|Q2TAD9|CYR1B_XENLA3.669e-2034.09Cysteine and histidine-rich protein 1-B OS=Xenopus... [more]
sp|Q6GNX1|CYR1A_XENLA4.099e-2034.09Cysteine and histidine-rich protein 1-A OS=Xenopus... [more]
sp|Q5BK76|CYHR1_RAT1.594e-1932.96Cysteine and histidine-rich protein 1 OS=Rattus no... [more]
sp|Q9QXA1|CYHR1_MOUSE2.033e-1933.33Cysteine and histidine-rich protein 1 OS=Mus muscu... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VZ636.199e-3732.90RING-type domain-containing protein OS=Trichobilha... [more]
A0A504YZ881.382e-3530.80Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4E0QZJ72.907e-3430.10Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A183AWV35.107e-3429.72Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A0R3WGU82.984e-3332.04RING-type domain-containing protein OS=Taenia asia... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyhr15.772e-2033.51cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
cyhr17.472e-1735.48cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cyhr12.220e-1431.41cysteine/histidine-rich 1 [Source:NCBI gene;Acc:76... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO460145.000e-1929.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyhr12.350e-2033.16cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
cyhr12.037e-1734.62cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cysteine and histidine-rich protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000023276.10.000e+0100.00SMESG000023276.1[more]
SMESG000067104.11.559e-5631.38SMESG000067104.1[more]
SMESG000007190.12.102e-2623.60SMESG000007190.1[more]
SMESG000001532.15.044e-2530.00SMESG000001532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018854 ID=SMED30018854|Name=Cysteine and histidine-rich protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2339bp
TAACGAAATTCAATAGACATGTTAATAATTTAATTTAAATTAAATATTAA
TCAATTATGACTGATGGTCAAAGTTCGAGGTCTATTTCATCATTTTGGAG
AAATTTAAAACGAGCTCTAATATCGGCTCCCGATATTCATAATGGTTCTC
CAGTTTGCTTAGAATGCGGTATGAGAGTTACAAATAGTAGCAATGTCAGT
AACAATGTCAACAATGAGTCGGTTTTAATTTCCGAACGTCCCATTTCAGA
AAACCCAGAAATAACTGTAAAACGCCAACGTTTGAATATAGTTGCCGATA
AAATAGGACCGTCCGAAGAAAACTCCTTTATGGAAATCATGAAAAATCTT
TTATCATGTTCGATTTGTCTTGAAGTTAGCAGTTATTCAAATCAATGTCC
TAATGGCCATTTGATCTGTATAACTTGTTCTGGACGTCTACAGCAAACAC
CTGGAGACCTTAATTGTCCAGTTTGTAGAATTTCACTGAAGCAAGGCTTA
CACAGATCTCTTTTAGCGGAGCAATTAACGTCAGAACTTCCAGCTGAATG
CAAATTTTGTGACACTGTAATGGCAGTGAAATACATTAAAAAGCATGAAA
CTGATGAATGTACGAAACGGATGGTTCCATGTAAATATAAGATGTTTGGT
TGCAATTGGATTGGAATTGAAGAACTAAGCAAAGACCACGAAGACGAGTG
TTCCATATCCAATAAAACAGTGGGGATGTTGCGTGAAATAGTAAACGAAA
ACATAGCCCGAGATTTACAATCTCTTCAATCTCCTTTACAGTTGTGGAAA
GCGATTATCTCTAAGCTAAGAGTTCAAGCGGTCGGATCAAGAATGCTTAT
TAGACAGACCACCCTCAACAAATCTAACAGTGAAGATGCAAACCAAACCG
TTTTCAAAAGTCCCATGATACGGATTCCATTTACTTGTTGCAATCTTCAT
GGGTTTTACTTAGACATGTATGTTACCAAAATGAATGAGACAGAACCCGA
AAAATTGCATTACGTTTTGAGATCCGAAAATCGCACGAAAATTAATTTGA
TGTTTTATTTATTAAGTATTAAAATCAATGAAACTGTAAACCTCGATGTT
CAAGATTCATTGCATAGTCATCACTTTGAATCAAGCCACAAAGATAGTTC
TTTGCATGAATTTAAATTAATCTCATTAGACTGTCAAAAGGATGTTCCAA
AGATATATGAATTGGATACGATCTTTGTTGAAGTATGCATTCTAAGTGAA
CGTGAGCGCAGTGAAAAGAGTCACGGAATACTAAATTCAACGGATGAAGA
TGAAACAAATCCCTTTCTAAGCAATGGATCCGATTCTAATGTGGTATTCA
CATTATTCTCACCGACTACTAGTGCATCACGGTCCATAAATACAAGCAAC
ACCATGATATCAGCCAACGATGACGTGAATGCTGCAAACGAAGTCGAGCC
ATCTCACGAAGAGGACATCGTTATTACGGTTACCGACAATGTTGATAGCG
GAGATGACATATCTAATGATAATCGTGACAATATAACTATGCGCAATAAT
CATGGTTTTGTTGCAGTTCCGAGTGTTTTTATTAATCCCGCCACTTCCGT
TTTTACATATTCACCGTTTTCAATTGATAATTCCTTTGTTCCAAATACTT
TCCTACAGCAGTCAAGACTAGTTCGTGATGGTTTGAATTACGAGCAACCG
ATCCAACAATTATCCCAAGAAAACCAACCAATTATTACTTCCGATCAAGA
TCTCATTAGATTTCAAACCATAAACGCAAACAGAAATGGAAATCCTTTGT
TAAATGAGTCGATTTCGCTCCAAGACCCCAATCGAGCAATTAGAGAACCT
ATTCAAATGTCCTTTTTCTATCCACCTCAAACCATTCTGTCCCCGTACAT
AACTAATTCGGTCCCACCGATTGCAGTTCGTCCTACCATTTCTCCAAGAA
CCTTAGGCGTCCGGCAAAGGTTAAACACCTACCCAATGGGTTCCAGACAA
TCAAATTTTCCCAGTAATTCGGAGGAAAGTGGATTAAACTCTTTCGAAAA
TAGAACCAGTGATTCGTATGTTACAGATACGTCATACAACATAAGCTCCG
TCCAGGATATACATGACACACGCTTTCAAATACCAAACAATGATGAAAGT
GTAAATTCGTCCTTTGCACCAAATCCCGCCGGCACCCTTTTAGACCGCAT
AATGCAAGAAGAAATTGAAAATTGAAATGAAATAATGGAAAGTGAATTTA
TTTTACTATTATTTCTGTTTGACTGCTAACTATTATCATTTCTCCTTTCA
ATCTAATGGCTCTAGGCAAAGATCCAAGCCATATCTAAT
back to top

protein sequence of SMED30018854-orf-1

>SMED30018854-orf-1 ID=SMED30018854-orf-1|Name=SMED30018854-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=723bp
MTDGQSSRSISSFWRNLKRALISAPDIHNGSPVCLECGMRVTNSSNVSNN
VNNESVLISERPISENPEITVKRQRLNIVADKIGPSEENSFMEIMKNLLS
CSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHR
SLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCN
WIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAI
ISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGF
YLDMYVTKMNETEPEKLHYVLRSENRTKINLMFYLLSIKINETVNLDVQD
SLHSHHFESSHKDSSLHEFKLISLDCQKDVPKIYELDTIFVEVCILSERE
RSEKSHGILNSTDEDETNPFLSNGSDSNVVFTLFSPTTSASRSINTSNTM
ISANDDVNAANEVEPSHEEDIVITVTDNVDSGDDISNDNRDNITMRNNHG
FVAVPSVFINPATSVFTYSPFSIDNSFVPNTFLQQSRLVRDGLNYEQPIQ
QLSQENQPIITSDQDLIRFQTINANRNGNPLLNESISLQDPNRAIREPIQ
MSFFYPPQTILSPYITNSVPPIAVRPTISPRTLGVRQRLNTYPMGSRQSN
FPSNSEESGLNSFENRTSDSYVTDTSYNISSVQDIHDTRFQIPNNDESVN
SSFAPNPAGTLLDRIMQEEIEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR039338CYHR1
IPR013083Znf_RING/FYVE/PHD
IPR013323SIAH-type
IPR001841Znf_RING
IPR001293Znf_TRAF
IPR008974TRAF-like
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 163..220
e-value: 1.0E-5
score: 27.6
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 64..162
e-value: 6.0E-7
score: 31.0
IPR039338Cysteine and histidine-rich protein 1PANTHERPTHR23059FAMILY NOT NAMEDcoord: 50..378
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 101..141
score: 9.288
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 149..199
score: 8.658
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 92..148
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 160..218