Tectonic-2

Overview
NameTectonic-2
Smed IDSMED30018843
Length (bp)2812
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tectonic-2 (SMED30018843) t-SNE clustered cells

Violin plots show distribution of expression levels for Tectonic-2 (SMED30018843) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tectonic-2 (SMED30018843) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tectonic-2 (SMED30018843) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018843

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018843SMESG000058258.1 SmedASXL_016433SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018843SMESG000058258.1 dd_Smed_v6_11318_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018843SMESG000058258.1 dd_Smed_v4_11318_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tectonic-2 vs. Ensembl Xenopus
Match: tctn2 (tectonic family member 2 [Source:NCBI gene;Acc:733954])

HSP 1 Score: 69.707 bits (169), Expect = 1.536e-11
Identity = 97/421 (23.04%), Postives = 158/421 (37.53%), Query Frame = 3
Query: 1035 FTQLASCPCDLTANICDQNCCCDPFCSCTTNITPI------SGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPNILGDYYPMQNIINDVNT-------FSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXXXXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSISFVQ-GNIPVFAFYKCFDGNTSSICTWDNGYNFPPSPAIANGTCXXXXXXXXXXXXXXXXLSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKTFSINPSGTCTTNGNNVLFLQDSLVQCTFTFNSSTCFDRRNAVKAYLDAMFPNNAVAVYGN 2255
            +  L  CPC+LTA +CD  CCCD    C +N+T +      +G +GG    P  + CS Q             T+N SP    D+YP   + + +N        +   ++ S +S  F +    +   S  S  Y   ++    +    +Y  +P+Q      C    P+  LQ F++TC  + T S C S           +L+  +  S   G      +  GN+ + A Y  +         W   Y                            +++ + A +NLTN      L QRF A+F++                 GS + +++SG  GY  G P++  + +               S    ++   VLF Q+S   C    N   C   RN V  +L A+ P + +A+ GN
Sbjct:  162 YQPLGPCPCNLTAGVCDVRCCCD--TDCNSNMTGLFNGFCYTGIFGGNVTPPFDQLCSVQ-------------TINRSP----DWYPFLCVQSSLNNSPFLGYFYQGSIAPSIQSVSFSLVSPSVP--SAISGFYKQGDAIMNPTGNN-QYFTIPQQS-TIGGCENNAPVAYLQDFNATC--VTTLSTCSS-----------ILNPDLNQSAIGGPALPQPIPCGNVILSADYTFY---------WQANY------------------------LILINVTVLMAQVNLTN--QGAQLTQRFTATFLN-----------------GSRSSASLSGNPGYQVGKPVIAANGSSTPVVRTEINLWKPVSNNICSSTTPVLFGQNSFSGCLLNLNELNCTQLRNTVITHLRALVPADFIAMRGN 494          
BLAST of Tectonic-2 vs. Ensembl Xenopus
Match: tctn2 (tectonic family member 2 [Source:NCBI gene;Acc:733954])

HSP 1 Score: 56.225 bits (134), Expect = 2.481e-7
Identity = 53/197 (26.90%), Postives = 83/197 (42.13%), Query Frame = 3
Query: 1035 FTQLASCPCDLTANICDQNCCCDPFCSCTTNITPI------SGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPNILGDYYPMQNIINDVNT-------FSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXXXXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRL 1586
            +  L  CPC+LTA +CD  CCCD    C +N+T +      +G +GG    P  + CS Q             T+N SP    D+YP   + + +N        +   ++ S +S  F +    +   S  S  Y       +     ++Y  +P+Q      C    P+  LQ F++TC  + T S C S  +P L
Sbjct:  162 YQPLGPCPCNLTAGVCDVRCCCD--TDCNSNMTGLFNGFCYTGIFGGNVTPPFDQLCSVQ-------------TINRSP----DWYPFLCVQSSLNNSPFLGYFYQGSIAPSIQSVSFSLVSPSV--PSAISGFY-KQGDAIMNPTGNNQYFTIPQQS-TIGGCENNAPVAYLQDFNATC--VTTLSTCSSILNPDL 333          
BLAST of Tectonic-2 vs. Ensembl Mouse
Match: Tctn2 (tectonic family member 2 [Source:MGI Symbol;Acc:MGI:1915228])

HSP 1 Score: 52.373 bits (124), Expect = 2.748e-6
Identity = 74/317 (23.34%), Postives = 122/317 (38.49%), Query Frame = 3
Query:  657 FKPNAIVTYSPIIKLNLVSNYNASTQVGLNCTIVTATS-----PTCPAIFNSTINW--SLYPNQ------VVFKDKTNVIEINMTRTGPIPNSMEQYTVVCCLDGSSSTXXXXXXXXXXXXTETNVTSNGTE--TQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTN----ITPISGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPN---ILGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKVK-DLSGSSQTSSMYXXXXXXXXXXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCS 1538
            F P  I   SP ++  LV     S  V ++ +++         PTC    N T++W  ++ P +      + +K   +    + T +   P  + Q  +V      +++ +  ++        T+VT N +E  T   +  +  L  CPCDLTA  CD  CCCD  C          +  SG +GG+ + P    C+         +  LLC V   P+    LG +Y             +  +S   S GF+  +  DL   +  S                  Y  +P QV  + +C    P+  L+ FDS C+
Sbjct:   29 FIPPFIRMSSPEVRATLV---GGSEDVAVSLSLLQVEEGVLPVPTCGGRRNETVDWNVTVSPRESTLEVTIRWKRGLDWCSADETASFSEPPCVLQMLLVSA--SHNASCLAHLLIQVEIYPNTSVTHNASENMTVIPNQVYQPLGPCPCDLTAKACDIQCCCDQDCQPEVRELFAQSCFSGVFGGHVSPPSHHHCAVSTTHQTPDWFPLLC-VQSPPSTSPFLGHFY-------------HGATSPRHSPGFEAHLHFDLRDFADAS------YKQGDPIMTTEGYFTIP-QVSLAGQCLQDAPVAFLRNFDSVCT 319          
BLAST of Tectonic-2 vs. TrEMBL
Match: A0A267E0U7 (DUF1619 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017666g2 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.271e-17
Identity = 151/608 (24.84%), Postives = 253/608 (41.61%), Query Frame = 3
Query: 1008 TETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTNITPI----SGPYGGYFND-PLPRSCSYQDELTRQSYQSLLCTVNESPNI-LGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXX-------------XXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSI--SFVQGNIPVFAFYKCF-------DGNTSSICTWDNGYNFPPSPAIANGTCXXXXXXXXXX-XXXXXXLSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKT------FSINPSGTC----TTNGNNVLFLQDSLVQCTFTF-NSSTCFDRRNAVKAYLDAMFPNNAVAVYG--NPSSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNSVTLTAYFEFVLVAANITG-AQNTSNNAQGVCLYDICLNELFYPWMYNYEG 2702
            +ETQ  D ++  +A CPCDL  + CD  CCCD   +CT N   +     G YGG  +   L R C+  D      Y    C + E+ N  LG Y+ +Q I  D     +  S S  S   Q  V+ + G  ++S          +                  +  L LP++ L +  C+    I  LQ    +C   V+ + C       + +  + ++    ++ C+ S     S    ++P+   Y           G T S  T   G   PPS    + TCN  V  V Y  ++  +S+  + A I + +V ++  + Q+F  +FV  SA +++              V+  SG  GYD G P++      +   VN  +      +     G C     T G+ VLF  D+   CT T  N + CF  R  ++A L   F    + V+G  N ++++D+    V+ L    T Y   +   S++ +       MP+ C+ +PT I +++ YA+QGKA +  I  +V    +Y+  +++     G    S   + L+   +FV V  +    +Q      +  C + IC +EL +P   ++EG
Sbjct:   27 SETQLLDPQYYNIAPCPCDLQPSTCDVGCCCD--TACTDNDKTLFDCAQGFYGGNTSSLELYRRCNSTDS-GNPDYHPFTCVLIENYNAYLGRYFTVQTIATDWQAKRS--SGSAASLAGQFPVQTILGLQESSPATEQRAGLLLLEVPGGVNPTWLNSGQAANNRLALPQRSL-AGGCDRSAGIAYLQDSSDSCDVAVSAAVCQGGVASPIDANIFAIACAGGSASCSVSVRTNRSASAQSVPITVTYLTLSSAVGYQKGLTGSSPTTSPGSLAPPSQT--STTCNNAVLDVQYRFVWSGSSIVSLTATIYMADVTVDSTVSQKFSVTFVHQSAASLA-------------TVTKRSGLVGYDTGAPLIGGVRGSS-GPVNASSSYWPTLWRATSGGACPAAGATGGDPVLFQFDATSYCTETVSNFTNCFSLRQQLQARLRQQFSAGVIGVFGSANTTTANDW----VNILEQNLTDYTGLDFAISNNNVTPA-WTEMPDLCLGLPTEIVLSVLYAQQGKANDSSIWQVVGAYLSYKQVHVA--ATCGPTGCSGTQLLLSTGVKFVRVPPDWADNSQAGLGPYKTPCWWGICWDELAFPLTTDFEG 605          
BLAST of Tectonic-2 vs. TrEMBL
Match: A0A1I8GJG6 (DUF1619 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.628e-16
Identity = 147/599 (24.54%), Postives = 248/599 (41.40%), Query Frame = 3
Query: 1008 TETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTNITPI----SGPYGGYFND-PLPRSCSYQDELTRQSYQSLLCTVNESPNI-LGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXX-------------XXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSISFVQGNIPVFAFYKCFDGNTSSICTWDNGYNFPPSPAIANGTCXXXXXXXXXX-XXXXXXLSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKT------FSINPSGTC----TTNGNNVLFLQDSLVQCTFTF-NSSTCFDRRNAVKAYLDAMFPNNAVAVYG--NPSSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNSVTLTAYFEFVLVAANITG-AQNTSNNAQGVCLYDICLNELFYPWMYNYEG 2702
            +ETQ  D ++  +A CPCDL  + CD  CCCD   +CT N   +     G YGG  +   L R C+  D      Y    C + E+ N  LG Y+ +Q I  D     +  S S  S   Q  V+ + G  ++S          +                  +  L LP++ L +  C+    I  LQ    +C   V+ + C       + +  + ++    ++ C+ S   +       V    +  +    S  T   G   PPS      TCN  V  V Y  ++  +S+  + A I + +V ++  + Q+F  +FV  SA +++              V+  SG  GYD G P++      +   VN  +      +     G C     T G+ VLF  D+   CT T  N + CF  R  ++A L   F    + V+G  N ++++D+    V+ L    T Y   +   S++ +       MP+ C+ +PT I +++ YA+QGKA +  I  +V    +Y+  +++     G    S   + L+   +FV V  +    +Q      +  C + IC +EL +P   ++EG
Sbjct:   14 SETQLLDPQYYNIAPCPCDLQPSTCDVGCCCD--TACTDNDKTLFDCAQGFYGGNTSSLELYRRCNSTDS-GNPDYHPFTCVLIENYNAYLGRYFTVQTIATDWQAKRS--SGSAASLAGQFPVQTILGLQESSPATEQRAGLLLLEVPGGVNPTWLNSGKAANNRLALPQRSL-AGGCDRSAGIAYLQDSSDSCDVTVSAAVCQGGVASPIDANIFAIACAGGSASCSVSVRTNRSASAQSVPLCRRLSERPEGSSPTTSPGSLAPPSQT--GTTCNNAVLDVQYRFVWSGSSIVSLTATIYMADVTVDSTVSQKFSVTFVHQSAASLA-------------TVTKRSGLVGYDTGAPLIGGVRGSS-GPVNASSSYWPTLWRATSGGACPAAGATGGDPVLFQFDATSYCTETVSNFTDCFSLRQQLQARLRQQFSAGVIGVFGSANTTTANDW----VNILEQNLTDYTGLDFAISNNNVTPA-WTEMPDLCLGLPTEIVLSVLYAQQGKANDSSIWQVVGAYLSYKQVHVA--ATCGPTGCSGTQLLLSTGVKFVRVPPDWADNSQAGLGPYKTPCWWGICWDELAFPLTTDFEG 583          
BLAST of Tectonic-2 vs. TrEMBL
Match: A0A504YAQ9 (DUF1619 domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_06986 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.182e-12
Identity = 99/367 (26.98%), Postives = 157/367 (42.78%), Query Frame = 3
Query: 1722 CTWDNGYNFPPSPAIANGTCXXXXXXXXXXXXXXXX-LSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILT--------------VSDTQNLAFVNMKTFSINPSGTCTTNGNN-VLFLQDSLVQCTFTFNSST---CFDRRNAVKAYLDAMFPNNAVAVYGNP--SSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSV-----VKNYQLSNISNFVPIGANASSTNSVTLT-----AYF-----EFVLV----AANITGAQNTSNNAQG------VCLYDICLNELFYPW 2684
            C WD+G+   P  +++N TC+  V  V Y  Y++   +   +ADI L +V  N  L QR+  SF      +V F   +   S  S + S  SG YGYD G  ++T              + D+ NL+   + T      G C  + +  V F ++S+  C    NS+    C   R+ VKA LD    ++ +AVYG+P  S+SSD+  +  + + +            +     + P+     +C  +P  + + ++YA QG+   E I  I+        +++ L+  S+  P      STN  T T      +F      F LV    A+ I+G+ N S            C YD C  E FY W
Sbjct:  631 CPWDDGFTLVPDVSLSNETCDNAVLRVDYRFYWSEGNIPRAEADIYLASV--NTSLGQRYYQSF------SVRFIHRSVRLSSFSDSNSKSSGVYGYDAGAQLVTGTISAPTTSGAFSVIVDSPNLSLPGIATIQPGLGGLCGNSRHRAVRFAENSIGTCRVNLNSAHFDDCTRLRSLVKAQLDQFVSSDVIAVYGSPSISTSSDWVRIQREQVQLFIDNKDSAEFLSTGLGPDAQPVAG---FCKQIPNSVKLDIFYAEQGRVDGEPILQIIGAQVKYKYEDWHLTCGSSDYPSVCRPPSTNKNTSTDSVSQGFFIHTKVVFTLVPRDWASQISGSANFSRRRADRIATTQACPYDACWREAFYAW 986          
BLAST of Tectonic-2 vs. TrEMBL
Match: A0A2H1CDQ9 (DUF1619 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_07180 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.550e-12
Identity = 96/367 (26.16%), Postives = 156/367 (42.51%), Query Frame = 3
Query: 1722 CTWDNGYNFPPSPAIANGTCXXXXXXXXXXXXXXXX-LSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILT--------------VSDTQNLAFVNMKTFSINPSGTCTTNGNN-VLFLQDSLVQCTFTFNSST---CFDRRNAVKAYLDAMFPNNAVAVYGNP--SSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSVVKNYQLSNI------SNF-----VPIGANASSTNSVTLTAYFE----FVLV----AANITGAQNTSNNAQG------VCLYDICLNELFYPW 2684
            C WD+G+   P  +++N TC+  V  V Y  Y++   +   +ADI L +V  N  L QR+  SF      +V F   +   S  S + S  SG YGYD G  ++T              + D+ NL+   + T      G C  + +  V F ++S+  C    NS+    C   R+ VKA LD    ++ +AVYG+P  S+SSD+  +  + + +                  + P+     +C  +P  + + ++YA QG+   E I  I+     Y+  +       S++      P     +ST+SV+   +      F +V    A+ I+G+ N S            C YD C  E FY W
Sbjct:  392 CPWDDGFTLVPDASLSNETCDNAVLRVDYRFYWSEGNIPRAEADIYLASV--NASLGQRYYQSF------SVGFIHRSVRLSSFSDSNSKSSGVYGYDAGAQLVTGTISAPTTSGAFSVIVDSPNLSLPGIATIQPGLGGLCGNSRHKAVRFAENSIGTCRVNLNSAHFDDCTRLRSLVKAQLDKFVSSDVIAVYGSPSISTSSDWVRIQREQVQLFIANNDSAEFLSIGLGPDAQPVAG---FCKQIPNSVKLDIFYAEQGRVDGEPILQIIGAQVRYKYEDWHLTCGSSDYPSVCRPPSPNQNTSTDSVSQGFFIHTKVIFTIVPWDWASQISGSANFSRRRADRIATTQACPYDACWREAFYAW 747          
BLAST of Tectonic-2 vs. TrEMBL
Match: A0A4E0RTE7 (DUF1619 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_004480 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.633e-12
Identity = 97/367 (26.43%), Postives = 156/367 (42.51%), Query Frame = 3
Query: 1722 CTWDNGYNFPPSPAIANGTCXXXXXXXXXXXXXXXX-LSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILT--------------VSDTQNLAFVNMKTFSINPSGTCTTNGNN-VLFLQDSLVQCTFTFNSST---CFDRRNAVKAYLDAMFPNNAVAVYGNP--SSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSVVKNYQLSNI------SNF-----VPIGANASSTNSVTLTAYFE----FVLV----AANITGAQNTSNNAQG------VCLYDICLNELFYPW 2684
            C WD+G+   P  +++N TC+  V  V Y  Y++   +   +ADI L +V  N  L QR+  SF      +V F   +   S  S + S  SG YGYD G  ++T              + D+ NL+   + T      G C  + +  V F ++S+  C    NS+    C   R+ VKA LD    ++ +AVYG+P  S+SSD+  +  + + +              SI        +  +C  +P  + + ++YA QG+   E I  I+     Y+  +       S++      P     +ST+SV+   +      F +V    A+ I+G+ N S            C YD C  E FY W
Sbjct:  720 CPWDDGFTLVPDASLSNETCDNAVLRVDYRFYWSEGNIPRAEADIYLASV--NASLGQRYYQSF------SVGFIHRSVRLSSFSDSNSKSSGVYGYDAGAQLVTGTISAPTTSGAFSVIVDSPNLSLPGIATIQPGLGGLCGNSRHKAVRFAENSIGTCRVNLNSAHFDDCTRLRSLVKAQLDKFVSSDVIAVYGSPSISTSSDWVRIQREQVQLFIANNDSAEFL---SIGLGPDAQPVAGFCKQIPNSVKLDIFYAEQGRVDGEPILQIIGAQVRYKYEDWHLTCGSSDYPSVCRPPSPNQNTSTDSVSQGFFIHTKVIFTIVPWDWASQISGSANFSRRRADRIATTQACPYDACWREAFYAW 1075          
BLAST of Tectonic-2 vs. Ensembl Medaka
Match: tctn2 (tectonic family member 2 [Source:NCBI gene;Acc:101155357])

HSP 1 Score: 51.6026 bits (122), Expect = 4.183e-6
Identity = 57/220 (25.91%), Postives = 88/220 (40.00%), Query Frame = 3
Query:  897 MEQYTVVCCLDGSSSTXXXXXXXXXXXXTETNVTSNGTETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTT----NITPISGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPN---ILGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXXXXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTC 1535
            +E   V  C+ G+   ++     I+     +N  S+  +T   +  F  L SCPCDLT  +CD  CCCD  CS           + GP+GG  +      CS Q       +   LC VN  P     LG +Y         +T  +VL  S     FQ   K +S +  ++S Y           +  ++  +P+ +L   +C    P+  L+ F   C
Sbjct:  130 LETLQVSACVGGAPQASLLVQAVIHAQLLPSNAGSD-NKTVIPNQVFQPLGSCPCDLTTGVCDVRCCCDKDCSSEDLKLFGSHCLPGPFGGQVSPTPEYQCSAQSSENSPDWFPFLC-VNSPPENNPFLGFFY-------HGSTKESVLGPS-----FQ---KAVSPAVASASPY---VQESPLIQLDGQFFVIPQVIL--GRCGSNTPVAFLRNFKVEC 327          
BLAST of Tectonic-2 vs. Planmine SMEST
Match: SMESG000058258.1 (SMESG000058258.1)

HSP 1 Score: 1634.77 bits (4232), Expect = 0.000e+0
Identity = 914/925 (98.81%), Postives = 920/925 (99.46%), Query Frame = 3
Query:   12 MNKFVLSLIIILKLLPFICPQGLISLNPDPVVVYLDSPNATLSFSITNFDSSKNYNVSCIFSEPSTGLSDATFTTVNINSALPTVVLNGFKVGRNRQFICSLNPLINVTKYLSVKPAIQAYICGTISAVNGLPVTFVVSFSAPLDVNSAVDCSIANLNNAISTTAVTGSSSLQVNLGVVNVSSVANPYTVNCSFTRLSHPSNFNGILIIAPQTIEFKPNAIVTYSPIIKLNLVSNYNASTQVGLNCTIVTATSPTCPAIFNSTINWSLYPNQVVFKDKTNVIEINMTRTGPIPNSMEQYTVVCCLDGSSSTXXXXXXXXXXXXTETNVTSNGTETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTNITPISGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPNILGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYXXXXXXXXXXXXXXKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSISFVQGNIPVFAFYKCFDGNTSSICTWDNGYNFPPSPAIANGTCXXXXXXXXXXXXXXXXLSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKTFSINPSGTCTTNGNNVLFLQDSLVQCTFTFNSSTCFDRRNAVKAYLDAMFPNNAVAVYGNPSSSSDFCVMNVDTLXXXXXXXXXXXXXXSDSILKSIPINSMPEYCVNMPTGITVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNSVTLTAYFEFVLVAANITGAQNTSNNAQGVCLYDICLNELFYPWMYNYEGKQGFYEEXXXXXXXXXXXXXXXTTYPWW 2786
            MNKFVLSLIIILKLLPFI PQGLISLNPDPVVVYL SPNATLSFSITNFDSSKNYNVSC+FSEPSTGLSDATFTTVNINSALPTVVLNGFKVGRNRQFICSLNPLINVTKYLSVKPAIQAYICGTISAVNGLPVTFVVSFSAPLDVNSAVDCSIANLNNAISTTAVTGSSSLQVNLGVVNVSSVANPYTVNCSFTRLS+PSNFNGILIIAPQTIEFKPNAIVTYSPIIKLNLVSNYNASTQVGLNCTIVTATSPTCPAIFNSTINWSLYPNQVVFKDKTNVIEINMTRTGPIPNSMEQYTVVCCLDGSSSTAINAVIQINNNATETNVTSNGTETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTNITPISGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPNILGDYY MQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYIPINSNFIFSFIPSKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSISFVQGNIPVFAFYKCFDGNTSSICTWDNGYNFPPSPAIANGTCNYVVSSVTYTIYYNTSLSYIKADINLTNVPLN ILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKTFSINPSGTCTTNGNNVLFLQDSLVQCTFTFNSSTCFDRRNAVKAYLDAMFPNNAVAVYGNPSSSSDFCVMNVDTLNIANTTYYPYNANYSDSILKSIPIN+MPEYCVNMPTG+TVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNS+TLTAYFEFVLV ANITGAQ+TSNNAQGVCLYDICLNELFYPWMYNYEGKQGFYEEAFGLFLLGLAVFLLVTTYPWW
Sbjct:    1 MNKFVLSLIIILKLLPFIYPQGLISLNPDPVVVYLYSPNATLSFSITNFDSSKNYNVSCLFSEPSTGLSDATFTTVNINSALPTVVLNGFKVGRNRQFICSLNPLINVTKYLSVKPAIQAYICGTISAVNGLPVTFVVSFSAPLDVNSAVDCSIANLNNAISTTAVTGSSSLQVNLGVVNVSSVANPYTVNCSFTRLSNPSNFNGILIIAPQTIEFKPNAIVTYSPIIKLNLVSNYNASTQVGLNCTIVTATSPTCPAIFNSTINWSLYPNQVVFKDKTNVIEINMTRTGPIPNSMEQYTVVCCLDGSSSTAINAVIQINNNATETNVTSNGTETQYGDLRFTQLASCPCDLTANICDQNCCCDPFCSCTTNITPISGPYGGYFNDPLPRSCSYQDELTRQSYQSLLCTVNESPNILGDYYSMQNIINDVNTFSNVLSSSTRSTGFQIKVKDLSGSSQTSSMYIPINSNFIFSFIPSKYLYLPRQVLDSSKCNLQNPIVMLQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSISFVQGNIPVFAFYKCFDGNTSSICTWDNGYNFPPSPAIANGTCNYVVSSVTYTIYYNTSLSYIKADINLTNVPLNTILDQRFIASFVSTSATNVSFQSVTSLESLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKTFSINPSGTCTTNGNNVLFLQDSLVQCTFTFNSSTCFDRRNAVKAYLDAMFPNNAVAVYGNPSSSSDFCVMNVDTLNIANTTYYPYNANYSDSILKSIPINAMPEYCVNMPTGVTVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNSLTLTAYFEFVLVTANITGAQSTSNNAQGVCLYDICLNELFYPWMYNYEGKQGFYEEAFGLFLLGLAVFLLVTTYPWW 925          
The following BLAST results are available for this feature:
BLAST of Tectonic-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tctn21.536e-1123.04tectonic family member 2 [Source:NCBI gene;Acc:733... [more]
tctn22.481e-726.90tectonic family member 2 [Source:NCBI gene;Acc:733... [more]
back to top
BLAST of Tectonic-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tctn22.748e-623.34tectonic family member 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Tectonic-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E0U75.271e-1724.84DUF1619 domain-containing protein OS=Macrostomum l... [more]
A0A1I8GJG62.628e-1624.54DUF1619 domain-containing protein OS=Macrostomum l... [more]
A0A504YAQ91.182e-1226.98DUF1619 domain-containing protein OS=Fasciola giga... [more]
A0A2H1CDQ92.550e-1226.16DUF1619 domain-containing protein OS=Fasciola hepa... [more]
A0A4E0RTE73.633e-1226.43DUF1619 domain-containing protein OS=Fasciola hepa... [more]
back to top
BLAST of Tectonic-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tectonic-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctn24.183e-625.91tectonic family member 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Tectonic-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058258.10.000e+098.81SMESG000058258.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018843 ID=SMED30018843|Name=Tectonic-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2812bp
TAACAAACTAAATGAATAAATTTGTGCTATCGTTAATTATAATATTAAAA
TTACTTCCATTTATTTGCCCTCAAGGCCTAATCTCATTGAATCCAGATCC
TGTTGTGGTTTACTTAGATTCGCCTAATGCTACTTTAAGTTTTAGTATTA
CAAATTTTGATTCCTCTAAAAATTATAATGTTTCTTGTATATTTTCTGAA
CCCAGTACAGGGCTTTCAGATGCGACTTTTACTACTGTCAATATAAATTC
TGCACTGCCCACTGTCGTTTTAAATGGCTTTAAAGTTGGACGCAATCGAC
AGTTCATTTGTAGCCTTAACCCCCTAATCAACGTGACAAAATATCTCTCC
GTCAAACCGGCAATCCAAGCATATATTTGTGGAACTATTTCAGCAGTCAA
CGGTTTACCAGTTACATTTGTTGTCAGTTTCTCAGCCCCGTTAGACGTAA
ATTCCGCTGTCGATTGTTCAATCGCAAATTTAAATAATGCGATTTCTACG
ACAGCTGTCACAGGAAGTTCTTCATTGCAGGTGAATCTTGGTGTGGTCAA
TGTGTCGAGTGTGGCGAATCCATACACAGTCAACTGCTCCTTTACAAGGC
TGTCACACCCCTCTAATTTCAATGGGATCCTTATAATCGCCCCACAGACA
ATTGAATTCAAACCCAATGCCATAGTTACCTATTCACCGATTATCAAGCT
GAATTTAGTATCAAATTACAATGCTAGCACTCAGGTCGGCCTCAATTGCA
CAATTGTAACTGCAACTTCACCAACTTGTCCCGCTATATTCAATTCAACA
ATAAATTGGTCTCTTTACCCCAACCAAGTCGTCTTTAAGGACAAGACTAA
TGTGATAGAAATTAATATGACTAGGACAGGTCCCATTCCAAATTCTATGG
AACAATATACAGTTGTTTGTTGTTTGGATGGGTCGAGCAGTACCGCTATT
AATGCTGTTATACAAATTAACAATAATGCCACAGAAACAAATGTAACATC
GAATGGCACTGAAACGCAATATGGGGATTTACGATTTACTCAATTGGCAA
GTTGTCCTTGTGATTTGACGGCTAATATATGCGATCAGAACTGCTGCTGT
GATCCGTTTTGTTCTTGTACTACCAACATCACTCCTATTAGTGGACCTTA
CGGTGGCTATTTCAATGACCCGTTACCTCGAAGTTGTAGCTACCAAGATG
AATTGACAAGACAGTCTTACCAATCACTGCTATGTACTGTCAACGAATCT
CCAAATATTCTTGGTGATTACTATCCGATGCAAAACATTATTAATGATGT
CAATACATTTTCAAATGTTCTTTCGTCGTCGACCAGAAGCACTGGCTTTC
AAATCAAGGTCAAAGATTTGTCCGGCTCATCTCAGACTTCATCAATGTAC
ATTCCAATTAATTCTAACTTTATATTTTCGTTTATCCCATCAAAATATCT
GTACTTACCAAGACAAGTTCTCGATTCATCGAAATGTAACCTACAAAATC
CCATCGTTATGTTGCAGCCATTTGATTCGACTTGCTCGTATATGGTGACG
AATTCCAATTGCGACAGTACTAAAGATCCACGGTTATCCAGCTACTTCTA
TCTCCTTTCTTCAACAATTACAAATTCTTTCTGTACTGGCAGCTGTTCAA
TATCGTTTGTTCAAGGAAATATTCCAGTGTTTGCATTTTATAAATGCTTT
GATGGGAATACTTCTTCAATTTGTACTTGGGACAATGGTTATAATTTTCC
TCCTTCACCTGCTATCGCTAATGGTACATGTAATTACGTGGTTAGTTCAG
TTACATACACCATTTATTACAATACATCATTGTCATACATCAAAGCCGAC
ATAAATCTTACGAATGTTCCCTTAAATAAAATTTTGGATCAACGATTTAT
CGCTTCATTTGTAAGTACGAGTGCGACAAATGTATCATTTCAATCAGTCA
CTTCTCTCGAATCATTAGGATCTGTAGCCGTATCAAATATTTCCGGCCGT
TATGGATATGACAATGGAATGCCGATTTTGACTGTCAGTGATACTCAAAA
TCTTGCATTCGTGAACATGAAAACATTTTCAATAAACCCTTCCGGGACTT
GCACAACTAATGGAAATAATGTGCTCTTTCTTCAGGATTCTTTGGTTCAA
TGCACATTCACTTTTAACTCATCTACTTGTTTCGATCGACGAAACGCCGT
CAAAGCCTATTTAGATGCCATGTTTCCAAATAATGCTGTTGCTGTATATG
GCAATCCAAGCTCTTCTAGTGATTTCTGTGTCATGAATGTGGATACCCTC
AATATAGCAAATACTACTTATTATCCGTACAATGCAAATTATAGTGATTC
TATTTTAAAATCGATTCCGATAAACTCAATGCCTGAATATTGTGTAAACA
TGCCTACAGGCATTACGGTGACCCTATATTATGCAAGGCAGGGTAAAGCA
AGAAATGAGTACATCAATAATATTGTCAGTGTCGTGAAAAATTACCAGTT
GAGCAACATTTCTAATTTCGTCCCAATCGGTGCAAATGCCTCATCTACCA
ACTCCGTGACTTTAACGGCATATTTTGAGTTCGTTCTAGTTGCAGCTAAC
ATCACAGGAGCTCAGAACACTAGTAACAATGCCCAAGGGGTCTGTCTGTA
CGATATATGCTTGAATGAACTGTTTTATCCTTGGATGTATAATTATGAGG
GTAAACAAGGATTTTATGAAGAAGCATTTGGTTTGTTTTTGTTGGGTTTG
GCAGTATTTCTGCTTGTGACAACATATCCCTGGTGGTGATTGTTTGCTTG
TATACTCTCGAG
back to top

protein sequence of SMED30018843-orf-1

>SMED30018843-orf-1 ID=SMED30018843-orf-1|Name=SMED30018843-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=167bp
MALGLNSIVCGAIIRIPLKLEGCDSLVKEQLTVYGFATLDTLTTPRFTCN
EELPVTAVVEIALFKFAIEQSTAEFTSNGAEKLTTNVTGKPLTAEIVPQI
YAWIAGLTERYFVTLIRGLRLQMNCRLRPTLKPFKTTVGSAEFILTVVKV
ASESPVLGSENIQETL*
back to top

protein sequence of SMED30018843-orf-2

>SMED30018843-orf-2 ID=SMED30018843-orf-2|Name=SMED30018843-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=926bp
MNKFVLSLIIILKLLPFICPQGLISLNPDPVVVYLDSPNATLSFSITNFD
SSKNYNVSCIFSEPSTGLSDATFTTVNINSALPTVVLNGFKVGRNRQFIC
SLNPLINVTKYLSVKPAIQAYICGTISAVNGLPVTFVVSFSAPLDVNSAV
DCSIANLNNAISTTAVTGSSSLQVNLGVVNVSSVANPYTVNCSFTRLSHP
SNFNGILIIAPQTIEFKPNAIVTYSPIIKLNLVSNYNASTQVGLNCTIVT
ATSPTCPAIFNSTINWSLYPNQVVFKDKTNVIEINMTRTGPIPNSMEQYT
VVCCLDGSSSTAINAVIQINNNATETNVTSNGTETQYGDLRFTQLASCPC
DLTANICDQNCCCDPFCSCTTNITPISGPYGGYFNDPLPRSCSYQDELTR
QSYQSLLCTVNESPNILGDYYPMQNIINDVNTFSNVLSSSTRSTGFQIKV
KDLSGSSQTSSMYIPINSNFIFSFIPSKYLYLPRQVLDSSKCNLQNPIVM
LQPFDSTCSYMVTNSNCDSTKDPRLSSYFYLLSSTITNSFCTGSCSISFV
QGNIPVFAFYKCFDGNTSSICTWDNGYNFPPSPAIANGTCNYVVSSVTYT
IYYNTSLSYIKADINLTNVPLNKILDQRFIASFVSTSATNVSFQSVTSLE
SLGSVAVSNISGRYGYDNGMPILTVSDTQNLAFVNMKTFSINPSGTCTTN
GNNVLFLQDSLVQCTFTFNSSTCFDRRNAVKAYLDAMFPNNAVAVYGNPS
SSSDFCVMNVDTLNIANTTYYPYNANYSDSILKSIPINSMPEYCVNMPTG
ITVTLYYARQGKARNEYINNIVSVVKNYQLSNISNFVPIGANASSTNSVT
LTAYFEFVLVAANITGAQNTSNNAQGVCLYDICLNELFYPWMYNYEGKQG
FYEEAFGLFLLGLAVFLLVTTYPWW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040354Tectonic
IPR009073HscB_oligo_C
IPR011677DUF1619
Vocabulary: biological process
TermDefinition
GO:0051259protein oligomerization
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011677Domain of unknown function DUF1619PFAMPF07773DUF1619coord: 348..641
e-value: 2.2E-22
score: 80.4
IPR040354TectonicPANTHERPTHR14611UNCHARACTERIZED DUF1619-CONTAININGcoord: 172..919
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.791
NoneNo IPR availableTMHMMTMhelixcoord: 905..924