Denticleless E3 ubiquitin protein ligase homolog (Drosophila)

Overview
NameDenticleless E3 ubiquitin protein ligase homolog (Drosophila)
Smed IDSMED30018837
Length (bp)1868
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) (SMED30018837) t-SNE clustered cells

Violin plots show distribution of expression levels for Denticleless E3 ubiquitin protein ligase homolog (Drosophila) (SMED30018837) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) (SMED30018837) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Denticleless E3 ubiquitin protein ligase homolog (Drosophila) (SMED30018837) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018837

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018837h1SMcG0000439 SmedASXL_014632SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30018837h1SMcG0000439 dd_Smed_v6_15465_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30018837h1SMcG0000439 SMED_03902_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018837h1SMcG0000439 SMED_03902_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Human
Match: DTL (denticleless E3 ubiquitin protein ligase homolog [Source:HGNC Symbol;Acc:HGNC:30288])

HSP 1 Score: 201.445 bits (511), Expect = 3.383e-55
Identity = 126/376 (33.51%), Postives = 201/376 (53.46%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFSPEFN-SNIVMIAKEDGGIVMINTE-LSGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHH-PDFVVSSSISKSQNRK-FNP---IPKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL  ++C+  D    Y E     P + C FS   N  +++ +A E+G + + NTE  S  +   + + AH N +FD+ W+ G  +++T++GD++ K+ D+   E I     H+ S+KS+A       +F +  RDG+I++WD    ++ NK+D G      +N +  AH+  D    S   K QN K   P     +SVT ++F +EN L S+G+ DG IK+WD+RK     ++ P   K   Y G      G++ L+++  G+ LFA C D+ IY +N+       PV  + GH + ++Y+K  LSPD+++L  GSS  + YI+ V    Q P +L GH  EVT   WCP++   I + SDD T  + R+  G E
Sbjct:   28 LLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWD----TRCNKKD-GFYR--QVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTS-PVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLE 395          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Human
Match: DTL (denticleless E3 ubiquitin protein ligase homolog [Source:HGNC Symbol;Acc:HGNC:30288])

HSP 1 Score: 189.119 bits (479), Expect = 4.803e-51
Identity = 119/362 (32.87%), Postives = 195/362 (53.87%), Query Frame = 1
Query:  226 ILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTE-LSGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHH-PDFVVSSSISKSQNRK-FNP---IPKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            +L+N    +  +   R +P    +++ +A E+G + + NTE  S  +   + + AH N +FD+ W+ G  +++T++GD++ K+ D+   E I     H+ S+KS+A       +F +  RDG+I++WD    ++ NK+D G      +N +  AH+  D    S   K QN K   P     +SVT ++F +EN L S+G+ DG IK+WD+RK     ++ P   K   Y G      G++ L+++  G+ LFA C D+ IY +N+       PV  + GH + ++Y+K  LSPD+++L  GSS  + YI+ V    Q P +L GH  EVT   WCP++   I + SDD T  + R+  G E
Sbjct:    1 MLFNSVLRQPQLGVLRNAPNME-HVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWD----TRCNKKD-GFYR--QVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTS-PVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLE 353          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Human
Match: DCAF5 (DDB1 and CUL4 associated factor 5 [Source:HGNC Symbol;Acc:HGNC:20224])

HSP 1 Score: 62.7734 bits (151), Expect = 1.410e-9
Identity = 90/397 (22.67%), Postives = 165/397 (41.56%), Query Frame = 1
Query:   85 ISNPINSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSN---IVMIAKEDGGIVMINTELSGSQAI------VQNFRAHKNCIFDVQW-MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            +   + SV     QR +  D    +LT+    DF        R     LY +D      + C  + EF++N    ++   +D  +++ + E    QAI      +Q    H + IF + +  G+ ++ +   D  +   D+   E++     HE +V  L++ P + N+FASSS DG +L+WD+       +E P              H   F +++  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G L      + +  N  GT L A  +      Y++   + ++PV+Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:    7 LGGSMRSVVGFLSQRGLHGD---PLLTQ----DFQRRRLRGCRN----LYKKDLLGH--FGCVNAIEFSNNGGQWLVSGGDDRRVLLWHME----QAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETL-DVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDI-------RESP--------------HGEPFCLANYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPQS------SLLRYGGNLSLQSAMS-VRFNSNGTQLLALRRRLPPVLYDI---HSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGGIGRVVNGAFMVLKGHRSIVNQVRFNP 343          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Human
Match: DCAF5 (DDB1 and CUL4 associated factor 5 [Source:HGNC Symbol;Acc:HGNC:20224])

HSP 1 Score: 62.7734 bits (151), Expect = 1.460e-9
Identity = 67/287 (23.34%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  388 HKNCIFDVQW-MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            H + IF + +  G+ ++ +   D  +   D+   E++     HE +V  L++ P + N+FASSS DG +L+WD+       +E P              H   F +++  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G L      + +  N  GT L A  +      Y++   + ++PV+Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:   18 HHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETL-DVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDI-------RESP--------------HGEPFCLANYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPQS------SLLRYGGNLSLQSAMS-VRFNSNGTQLLALRRRLPPVLYDI---HSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGGIGRVVNGAFMVLKGHRSIVNQVRFNP 261          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Human
Match: DCAF5 (DDB1 and CUL4 associated factor 5 [Source:HGNC Symbol;Acc:HGNC:20224])

HSP 1 Score: 62.7734 bits (151), Expect = 1.460e-9
Identity = 67/287 (23.34%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  388 HKNCIFDVQW-MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            H + IF + +  G+ ++ +   D  +   D+   E++     HE +V  L++ P + N+FASSS DG +L+WD+       +E P              H   F +++  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G L      + +  N  GT L A  +      Y++   + ++PV+Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:   18 HHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETL-DVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDI-------RESP--------------HGEPFCLANYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPQS------SLLRYGGNLSLQSAMS-VRFNSNGTQLLALRRRLPPVLYDI---HSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPADPEAGGIGRVVNGAFMVLKGHRSIVNQVRFNP 261          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Celegans
Match: cdt-2 (CDT (S. pombe CDC10 Dependent Transcript) homolog [Source:UniProtKB/TrEMBL;Acc:Q22059])

HSP 1 Score: 117.472 bits (293), Expect = 2.473e-27
Identity = 87/306 (28.43%), Postives = 156/306 (50.98%), Query Frame = 1
Query:  268 CRFSPEFNSNIVMIAKEDGGIVMI-------NTELSGSQAIVQNFRAHKNCIFDVQWM--GSNRILTSSGDRSIKYIDLNREESISQSTC---HEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNS-KYNKEDPGVISISPINHLFNAH-HPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLAS-SGSADGKIKLWDVRKISKKNP-EPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKI-PVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHV 1134
             RFSP  N   ++   +D G + I       +  +   +  +  F AH   I DV  +    ++I++ SGD +I+  DLN+     +S     HEGSV+S+   P  PN+F +  RD  + +WD+  ++ K  +ED  + +I+       AH  P  V++S   KS+ +        VTS++F++E+ +AS S +AD  I++WD+RK ++    +P +++      +   G T L +++ G  LFA C D  I++Y++  P+  + P+  YTG    ++Y ++  SP    +ACGS      ++ +
Sbjct:   45 ARFSPHLNQEHILYMGDDPGNIGIFDVRKFQDRSVPLEERQLYFFPAHDGAIMDVVGVPQKESQIVSISGDSTIRCWDLNQSTLDRKSQVFFGHEGSVRSICFAPDDPNVFVTGGRDFQVKIWDMRVSTVKKMEEDCRMATIT----YKTAHPKPSKVLTSGTPKSKAKAKTIEGYKVTSVLFLDEHHVASASENADSGIRVWDIRKPTRNGEGQPARILKVPTSNKKSYGVTCLTLDRFGNRLFASCTDSSIFEYSV--PSESVSPINSYTGATIHNFYTQVACSPVSDVIACGSEDSRAVVWDL 344          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Celegans
Match: atg-16.1 (Autophagic-related protein 16.1 [Source:UniProtKB/Swiss-Prot;Acc:Q19124])

HSP 1 Score: 54.299 bits (129), Expect = 1.847e-7
Identity = 63/287 (21.95%), Postives = 118/287 (41.11%), Query Frame = 1
Query:  406 DVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNM--FASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHP-----DFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLAS-----SGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMS 1230
            DV W+      T   DR+IK   ++     ++     GS  +        +   F +SS D ++ +W+L DNS+      G          + +H       D V+   I   QN++ +      + ++ V  N+ AS     SG  D K++ +D R     + +PV+ +   G++      T L V  +G  L    +D+ I   +L R    +  Y    + + S   ++ LS   +Y+A GSS+ S ++++      +  L +  +  +    W P   G++ S
Sbjct:  297 DVHWLDGETFATGGSDRNIKIWKVDGHGGYTRIGTLAGSNAAFTRIDYERDRKHFIASSNDKNVRIWNL-DNSRLLSTLSGHSDQVTCVKFYQSHSAVSGSADRVIK--IWDIQNQRCSRSLFPASKVLDVATNMGASPSLFASGHFDKKLRFYDGR-----STDPVRTVDMGGRI------TSLDVTMSGCELLVSTRDDTISLIDL-RTFQTVHCYSAENYRTSSDLSRVVLSSGNEYVAAGSSNGSIFVWNRNSTKLEKQLCSNSENAIFSLSWNPTGYGLLSS 568          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Celegans
Match: prp-17 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:O44729])

HSP 1 Score: 49.2914 bits (116), Expect = 8.515e-6
Identity = 58/269 (21.56%), Postives = 111/269 (41.26%), Query Frame = 1
Query:  361 QAIVQNFRAHKNCIFDVQWM--GSNRILTSSGDRSIKYIDL-NREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSK----YNKEDPGVISISP---INHLF--NAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQ-YTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIY 1128
            + +V  +R H   +  +QW    ++  L+ S D  IK  ++ +R+  +     H+  V+ +A   +    F S+S D  + LWD          +    P  +   P    NH+F     +   +   S S    ++++   ++V SI F ++N   +S S D  +++W+      + P   K+I   G L   P  T    ++    +   C D  I  + L     +    + + GH +  Y   +D SPD+ +L  G +    +I+
Sbjct:  265 KKLVHTYRGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVVRTYAGHKLPVREVAFN-NEGTEFLSASFDRYVKLWDTETGQVKQRFHTGHVPYCLKYHPDDDKNHMFLVGMQNKKIIQWDSRSGEIVQEYDRHLQAVNSITFFDKNRRFASTSDDKSVRIWEW-----EIPVDTKLIQNVG-LHAIPTMTKSPNDK---WVVGQCMDNRIVLFQLVDDKLRFSKKKAFRGHNAAGYACNIDFSPDQSFLISGDADGKLFIW 523          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Celegans
Match: prp-17 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:O44729])

HSP 1 Score: 49.2914 bits (116), Expect = 8.515e-6
Identity = 58/269 (21.56%), Postives = 111/269 (41.26%), Query Frame = 1
Query:  361 QAIVQNFRAHKNCIFDVQWM--GSNRILTSSGDRSIKYIDL-NREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSK----YNKEDPGVISISP---INHLF--NAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQ-YTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIY 1128
            + +V  +R H   +  +QW    ++  L+ S D  IK  ++ +R+  +     H+  V+ +A   +    F S+S D  + LWD          +    P  +   P    NH+F     +   +   S S    ++++   ++V SI F ++N   +S S D  +++W+      + P   K+I   G L   P  T    ++    +   C D  I  + L     +    + + GH +  Y   +D SPD+ +L  G +    +I+
Sbjct:  265 KKLVHTYRGHNKGVNFLQWFPKSAHLFLSCSMDTKIKLWEVYDRQRVVRTYAGHKLPVREVAFN-NEGTEFLSASFDRYVKLWDTETGQVKQRFHTGHVPYCLKYHPDDDKNHMFLVGMQNKKIIQWDSRSGEIVQEYDRHLQAVNSITFFDKNRRFASTSDDKSVRIWEW-----EIPVDTKLIQNVG-LHAIPTMTKSPNDK---WVVGQCMDNRIVLFQLVDDKLRFSKKKAFRGHNAAGYACNIDFSPDQSFLISGDADGKLFIW 523          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Fly
Match: l(2)dtl (gene:FBgn0013548 transcript:FBtr0072085)

HSP 1 Score: 179.489 bits (454), Expect = 1.118e-47
Identity = 123/384 (32.03%), Postives = 197/384 (51.30%), Query Frame = 1
Query:  181 DFLLETFECARED--RFIL---YNEDFE-ESPVYQCRFS-PEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNF---RAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNRE--ESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAH--HPDFVVSSSISKSQNRKF--NPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKP 1272
            DF L     A+ED  R I    Y  DF  E P++  +F+  +   +I+ IA EDG I + +T     Q   Q+    + H N +FD++W  G  R +++SGD + +  ++       ++    H  SVKS A + + P +FA+  RDG+IL+WD+  N   +      ++    N +++ H   P   VS    +++  K        S+T + F + + L S G+ DG IK+WD+R+     KK P P   +PY+G      GFT+L+V+ +GT L+A C D  IY YNL   + + P+  Y G ++ ++Y+K  LSPD KYL  GSS    YI+++    +  + L GH  EVT   W  ++   I++ SDD    + R+ P
Sbjct:   21 DFALRRLSVAKEDSWRGIAPANYCPDFNPEPPIFSAKFANCDGYRHILAIANEDGKITLQDTTQRNHQPEEQSLVGPQCHFNAVFDLEWAPGQMRFVSASGDHTARLWEVAGSGIRGLNSYVGHTRSVKSAAFKRTDPAVFATGGRDGAILIWDIRANLNMD------LTSRVDNCIYSGHTGGPGTPVSQRKQRTRTPKMAGGTTSSSITGLAFQDNDTLISCGAGDGVIKVWDLRRNYTAYKKEPLPRHKLPYAGS-STFRGFTNLIVDASGTRLYANCMDNTIYCYNLASYSQR-PLACYKGLLNSTFYIKSCLSPDGKYLLSGSSDERAYIWNLDHAEEPLVALAGHTVEVTCVAWGSSHDCPIVTCSDDARHKIWRIGP 396          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Fly
Match: Wdr24 (gene:FBgn0027518 transcript:FBtr0330297)

HSP 1 Score: 50.0618 bits (118), Expect = 6.752e-6
Identity = 28/109 (25.69%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  286 FNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGS--NRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDL 606
             +SN++  A  +G + + +    G Q  +  +  H+     V +  S  N +++ S D +IK  D+  ++SI+   C+  SV+ +   P   N+F++ S +G++ LWD+
Sbjct:   76 LDSNLLATAATNGVVSVWDLSKFGRQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIKCFDIRSDKSINTYFCNSESVRDVKFSPHTQNIFSAVSENGTVQLWDM 184          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Fly
Match: Wdr24 (gene:FBgn0027518 transcript:FBtr0085543)

HSP 1 Score: 50.0618 bits (118), Expect = 6.807e-6
Identity = 28/109 (25.69%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  286 FNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGS--NRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDL 606
             +SN++  A  +G + + +    G Q  +  +  H+     V +  S  N +++ S D +IK  D+  ++SI+   C+  SV+ +   P   N+F++ S +G++ LWD+
Sbjct:   76 LDSNLLATAATNGVVSVWDLSKFGRQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIKCFDIRSDKSINTYFCNSESVRDVKFSPHTQNIFSAVSENGTVQLWDM 184          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Fly
Match: Wdr33 (gene:FBgn0046222 transcript:FBtr0078713)

HSP 1 Score: 49.2914 bits (116), Expect = 9.543e-6
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  370 VQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDL-NREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSK 621
            +    AHK+ + D++W    N ++T+S D  +K  D+ N  E +     H+    S++  P H  +F S   DGSIL W++  + +
Sbjct:  308 LATLHAHKSTVMDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRGHKKEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKE 393          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Fly
Match: Wdr33 (gene:FBgn0046222 transcript:FBtr0078714)

HSP 1 Score: 49.2914 bits (116), Expect = 9.543e-6
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  370 VQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDL-NREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSK 621
            +    AHK+ + D++W    N ++T+S D  +K  D+ N  E +     H+    S++  P H  +F S   DGSIL W++  + +
Sbjct:  308 LATLHAHKSTVMDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRGHKKEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKE 393          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Zebrafish
Match: dtl (denticleless E3 ubiquitin protein ligase homolog (Drosophila) [Source:NCBI gene;Acc:192314])

HSP 1 Score: 210.305 bits (534), Expect = 3.619e-59
Identity = 123/377 (32.63%), Postives = 207/377 (54.91%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFSPEFNS-NIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAH-HPDFVVSSSISKSQNRKFNPIP----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRM--KPGSE 1281
            LL+ +ECAR D  I Y       P + C FS      N + +A E+G + + NT    S ++++ ++AH N +FD+ W+ G+N ++T+SGD++ +  D+   + +     H+ S+KS+A       +F++  RDG+I++WD    ++ +K+D     +  I+    AH  P+        +++ R+    P    + VT ++F +E  L SSG+ DG IK+WD+R+      +NP P++  PY G      G++ L ++  G+ LF+ C D+ IY +N+       PV  ++GH + S+Y+K  +SPD+++LA GSS ++ YI+ +    Q PM+L GH  EVT   WCP +   I S SDD T  + R+  KP  E
Sbjct:   29 LLDGYECARRDEHISYGASAAAVPPFGCTFSSAHGQQNCLAVANEEGFVTIFNTGEKQS-SVLKEWQAHDNAVFDIAWVPGTNCLVTASGDQTARLWDVITGDLLGTFKGHQCSLKSVAFYKQEKAVFSTGGRDGNIMIWD----TRCSKKDGFYRQVKQIS---GAHMKPERFTP----QTKKRRGMAPPVDSQQGVTVVLFCDETKLISSGAVDGIIKMWDLRRNYTAYHQNPLPLQAYPYPGSCTRKLGYSGLSLDYTGSRLFSNCTDDNIYMFNISGLK-TTPVAVFSGHSNSSFYVKSTVSPDDQFLASGSSDHNVYIWKISDPKQAPMMLQGHSQEVTSVAWCPTDFTKIASCSDDNTVRIWRLNRKPEGE 392          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Zebrafish
Match: dcaf5 (ddb1 and cul4 associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-060929-808])

HSP 1 Score: 60.077 bits (144), Expect = 6.475e-9
Identity = 68/287 (23.69%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  388 HKNCIFDVQWMGSN-RILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            H + IF + +  +N R+ +   D  +   D+ R E+++    H+ +V  L++ P + N+FASSS DG +L+WD        +E P              H   F +++  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G L      + +  N  GT L A  +      Y L   + ++P +Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:   98 HLSNIFCLAFDSTNKRVFSGGNDEQVILHDVERGETLN-VFLHDDAVYGLSVSPVNDNVFASSSDDGRVLIWD-------TREPP--------------HGEPFCLANYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPRS------SLLRYGGSLSLQSAMS-VRFNSTGTQLLALRRRLPPVLYEL---HSRLPSFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWRIPTDPEAGGAGRVVNGAFMVLKGHRSIVNQVRFNP 341          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Zebrafish
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 55.8398 bits (133), Expect = 5.594e-8
Identity = 49/211 (23.22%), Postives = 86/211 (40.76%), Query Frame = 1
Query:  283 EFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQW---MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNS---------------KYNKEDPGVISISPIN------HLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRK 843
            E N ++++    DG + + +T  +  Q ++Q  + H   ++ V W      N +++ S D + K  D  + + ++    HEG + S    P  P  FAS+S DG++ +WD+   S                + K D  V+    ++       L N  HP   +S      +  KF P  K+V            +S S D  ++ WD  K
Sbjct:   69 ENNEHVLVTGGGDGSLQIWDT--ANPQGLLQVLKGHTQEVYSVDWSQTRAENLLVSGSWDHTAKVWDPVQCQLVNSLQGHEGVIYSTIWSPHIPACFASASGDGTLRVWDVKAGSCRLVIPAHKSEILSCDWCKYDQNVLVTGAVDCSLRVWDLRNIRHPVAQMSGHSYAIRRVKFCPFYKTVL-----------ASCSYDFTVRFWDYSK 266          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Zebrafish
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:30722])

HSP 1 Score: 55.8398 bits (133), Expect = 6.227e-8
Identity = 54/227 (23.79%), Postives = 90/227 (39.65%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISP-INHLFNAHHPDFVVSSS----------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSSYSPYIYHV 1134
            H G V  +A  P  P+M  S+SRD +I++W L  D + Y      +   S  ++ +  +    F +S S           + +  R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + YL  + +SPD    A G       ++ +
Sbjct:   14 HSGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDDSHTEWVSCVRFSPNSSNP-------------IIVSCGWDKMVKVWNLANCKLK------TNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDL 221          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Zebrafish
Match: wdr33 (WD repeat domain 33 [Source:ZFIN;Acc:ZDB-GENE-040924-3])

HSP 1 Score: 55.4546 bits (132), Expect = 1.882e-7
Identity = 28/82 (34.15%), Postives = 43/82 (52.44%), Query Frame = 1
Query:  370 VQNFRAHKNCIFDVQW-MGSNRILTSSGDRSIKYIDL-NREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLN 609
            +    AHKN + +V+W +  N +LT+S D   K  D+ N +E +     H+    ++A  P H  MFAS   DGS+L W + 
Sbjct:  281 LATLHAHKNTVMEVKWNLNGNWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVAWHPVHEGMFASGGSDGSLLFWHVG 362          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Xenopus
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:395039])

HSP 1 Score: 213.386 bits (542), Expect = 1.303e-59
Identity = 126/377 (33.42%), Postives = 209/377 (55.44%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP-----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++CA+ D    Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   + I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA   D    S + K +       P     +SVT +IF +E+ + S+G+ DG +K+WD+RK     +++P P K+ PY G      G+++LV++  GT LFA C D+ +Y +N      + PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K  SE
Sbjct:   27 LLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNAL--DKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTE-PVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSE 395          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Xenopus
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:395039])

HSP 1 Score: 213.386 bits (542), Expect = 1.335e-59
Identity = 126/377 (33.42%), Postives = 209/377 (55.44%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP-----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++CA+ D    Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   + I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA   D    S + K +       P     +SVT +IF +E+ + S+G+ DG +K+WD+RK     +++P P K+ PY G      G+++LV++  GT LFA C D+ +Y +N      + PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K  SE
Sbjct:   28 LLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNAL--DKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTE-PVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSE 396          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Xenopus
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:395039])

HSP 1 Score: 213.001 bits (541), Expect = 1.585e-59
Identity = 125/375 (33.33%), Postives = 206/375 (54.93%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPI---PKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++CA+ D    Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   + I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA            K   R   P     +SVT +IF +E+ + S+G+ DG +K+WD+RK     +++P P K+ PY G      G+++LV++  GT LFA C D+ +Y +N      + PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K  SE
Sbjct:   24 LLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNALDKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTE-PVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSE 392          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Xenopus
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:395039])

HSP 1 Score: 213.001 bits (541), Expect = 2.455e-59
Identity = 126/377 (33.42%), Postives = 209/377 (55.44%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP-----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++CA+ D    Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   + I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA   D    S + K +       P     +SVT +IF +E+ + S+G+ DG +K+WD+RK     +++P P K+ PY G      G+++LV++  GT LFA C D+ +Y +N      + PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K  SE
Sbjct:   63 LLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNAL--DKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTE-PVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSE 431          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Xenopus
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:395039])

HSP 1 Score: 212.616 bits (540), Expect = 3.879e-59
Identity = 126/377 (33.42%), Postives = 209/377 (55.44%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP-----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++CA+ D    Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   + I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA   D    S + K +       P     +SVT +IF +E+ + S+G+ DG +K+WD+RK     +++P P K+ PY G      G+++LV++  GT LFA C D+ +Y +N      + PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K  SE
Sbjct:   65 LLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNAL--DKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTE-PVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSE 433          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Mouse
Match: Dtl (denticleless E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:1924093])

HSP 1 Score: 196.438 bits (498), Expect = 1.186e-53
Identity = 129/406 (31.77%), Postives = 211/406 (51.97%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRF--SPEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHH-PDFVVSSSISKSQNRK-FNPI---PKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRM------KPGSEFNVFYRNQVIKRSHNLAPFSLSS 1350
            LL  ++C   D    Y E     P + C F  +P    +I+ +A E+G + + NTE   S+    + + AH N +FD+ W+ G  +++T++GD++ K+ D+   E +     H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D G      +N +  AH+  D    S   K QN K   P     +SVT ++F +EN L S+G+ DG IK+WD+RK     ++ P   K   Y G      G++ LV++  G+ LFA C D+ IY +N+       PV  + GH + ++Y+K  LSPD+++L  GSS  + YI+ V +    P +L GH  EVT   WCP++   I + SDD T  + R+      KPG + ++       K+     P ++ S
Sbjct:   28 LLSGYQCNCNDEHTSYGETGVPVPPFGCTFCTAPSME-HILAVANEEGFVRLYNTESQTSKKTCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVRAGELMGTCKGHQCSLKSVAFPKFQKAVFSTGGRDGNIMIWD----TRCNKKD-GFYRQ--VNQISGAHNTADKQTPSKPKKKQNSKGLAPAVDSQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGTSTRKLGYSSLVLDSTGSTLFANCTDDNIYMFNMTGLKTS-PVAVFNGHQNSTFYVKSSLSPDDQFLISGSSDEAAYIWKVSMPWHPPTVLLGHSQEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGDKHSIVGWTSQKKKEVKACPVTVPS 424          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Mouse
Match: Dtl (denticleless E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:1924093])

HSP 1 Score: 62.003 bits (149), Expect = 6.201e-11
Identity = 36/122 (29.51%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRF--SPEFNSNIVMIAKEDGGIVMINTELSGS-QAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLAL 540
            LL  ++C   D    Y E     P + C F  +P    +I+ +A E+G + + NTE   S +   + + AH N +FD+ W+ G  +++T++GD++ K+ D+   E +     H+ S+KS+A 
Sbjct:   28 LLSGYQCNCNDEHTSYGETGVPVPPFGCTFCTAPSME-HILAVANEEGFVRLYNTESQTSKKTCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVRAGELMGTCKGHQCSLKSVAF 148          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Mouse
Match: Dcaf5 (DDB1 and CUL4 associated factor 5 [Source:MGI Symbol;Acc:MGI:2444785])

HSP 1 Score: 62.003 bits (149), Expect = 1.679e-9
Identity = 90/397 (22.67%), Postives = 165/397 (41.56%), Query Frame = 1
Query:   85 ISNPINSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSN---IVMIAKEDGGIVMINTELSGSQAI------VQNFRAHKNCIFDVQW-MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            +   + SV     QR +  D    +LT+    DF        R     LY +D      + C  + EF++N    ++   +D  +++ + E    QAI      +Q    H + IF + +  G+ ++ +   D  +   D+   E++     HE +V  L++ P + N+FASSS DG +L+WD+       +E P              H   F +++  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G L      + +  N  GT L A  +      Y++   + ++PV+Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:    7 LGGSMRSVVGFLSQRGLHGD---PLLTQ----DFQRRRLRGCRN----LYKKDLLGH--FGCVNAIEFSNNGGQWLVSGGDDRRVLLWHME----QAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGGNDEQVILHDVESSETL-DVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDI-------RESP--------------HGEPFCLANYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPQS------SLLRYGGNLSLQSAMS-VRFNSNGTQLLALRRRLPPVLYDI---HSRLPVFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWKIPADPEAGGIGRVVNGAFMVLKGHRSIVNQVRFNP 343          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Mouse
Match: Rack1 (receptor for activated C kinase 1 [Source:MGI Symbol;Acc:MGI:101849])

HSP 1 Score: 56.225 bits (134), Expect = 5.182e-8
Identity = 54/227 (23.79%), Postives = 91/227 (40.09%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISP-INHLFNAHHPDFVVSSS----------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSSYSPYIYHV 1134
            H G V  +A  P  P+M  S+SRD +I++W L  D + Y      +   S  ++ +  +    F +S S           + +  R+F    K V S+ F ++N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + YL  + +SPD    A G       ++ +
Sbjct:   14 HNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNP-------------IIVSCGWDKLVKVWNLANCKLK------TNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDL 221          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Mouse
Match: Atg16l1 (autophagy related 16-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924290])

HSP 1 Score: 52.7582 bits (125), Expect = 1.090e-6
Identity = 37/142 (26.06%), Postives = 62/142 (43.66%), Query Frame = 1
Query:  799 SGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGII 1224
            SG  D KI+ WD+R  S      V+ +   GK+      T L +N   T L +  +D+ +   +L R N     +   G    S + ++  SPD  Y+A GS+  S Y++ V     + +L   H   +    W P+   ++
Sbjct:  480 SGHFDKKIRFWDIRSES-----VVREMELLGKI------TALDLNPERTELLSCSRDDLLKVIDL-RTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVV 609          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. UniProt/SwissProt
Match: sp|Q6P1W0|DTL_XENTR (Denticleless protein homolog OS=Xenopus tropicalis OX=8364 GN=dtl PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 7.074e-59
Identity = 126/377 (33.42%), Postives = 209/377 (55.44%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP-----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++CA+ D    Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   + I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA   D    S + K +       P     +SVT +IF +E+ + S+G+ DG +K+WD+RK     +++P P K+ PY G      G+++LV++  GT LFA C D+ +Y +N      + PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K  SE
Sbjct:   28 LLQCYQCAKHDEHTSYGELGAAVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDVQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGDLIGECKGHQCSLKSVAFSKFEKAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNAL--DKQTPSKVKKRKPYVRGLAPSVDSQQSVTVVIFQDEHTIISAGAVDGIVKVWDLRKNYSAYRQDPVPAKLFPYPGNSTRKLGYSNLVLDPTGTNLFASCTDDNVYMFNATGLKTE-PVSVFGGHQNSTFYIKTSVSPDGQFLLSGSSDHSAYIWQVSDPKVPPVTLTGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSSE 396          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. UniProt/SwissProt
Match: sp|Q5RHI5|DTL_DANRE (Denticleless protein homolog OS=Danio rerio OX=7955 GN=dtl PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.732e-58
Identity = 123/377 (32.63%), Postives = 207/377 (54.91%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFSPEFNS-NIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAH-HPDFVVSSSISKSQNRKFNPIP----KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRM--KPGSE 1281
            LL+ +ECAR D  I Y       P + C FS      N + +A E+G + + NT    S ++++ ++AH N +FD+ W+ G+N ++T+SGD++ +  D+   + +     H+ S+KS+A       +F++  RDG+I++WD    ++ +K+D     +  I+    AH  P+        +++ R+    P    + VT ++F +E  L SSG+ DG IK+WD+R+      +NP P++  PY G      G++ L ++  G+ LF+ C D+ IY +N+       PV  ++GH + S+Y+K  +SPD+++LA GSS ++ YI+ +    Q PM+L GH  EVT   WCP +   I S SDD T  + R+  KP  E
Sbjct:   29 LLDGYECARRDEHISYGASAAAVPPFGCTFSSAHGQQNCLAVANEEGFVTIFNTGEKQS-SVLKEWQAHDNAVFDIAWVPGTNCLVTASGDQTARLWDVITGDLLGTFKGHQCSLKSVAFYKQEKAVFSTGGRDGNIMIWD----TRCSKKDGFYRQVKQIS---GAHMKPERFTP----QTKKRRGMAPPVDSQQGVTVVLFCDETKLISSGAVDGIIKMWDLRRNYTAYHQNPLPLQAYPYPGSCTRKLGYSGLSLDYTGSRLFSNCTDDNIYMFNISGLK-TTPVAVFSGHSNSSFYVKSTVSPDDQFLASGSSDHNVYIWKISDPKQAPMMLQGHSQEVTSVAWCPTDFTKIASCSDDNTVRIWRLNRKPEGE 392          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. UniProt/SwissProt
Match: sp|Q6GPU3|DTLB_XENLA (Denticleless protein homolog B OS=Xenopus laevis OX=8355 GN=dtl-b PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.468e-57
Identity = 124/375 (33.07%), Postives = 203/375 (54.13%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQ-AIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPI---PKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++C ++D  I Y +     P + C FS  P   S+++ +A E+G + + +TE    Q  +V+ F AH N +FD+ W+ G ++++T+SGD++ K  D+   E I +   H+ S+KS+A       +F++  RDG+I++WD    ++ NK+D     ++ I    NA            K   R   P     +SVT +IF +E  + S+G+ DG +K+WD+RK     +++P PVK+ PY G      G++ LV++  GT LFA C D+ +Y +N        PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  + R+   SE
Sbjct:   28 LLQCYQCVKQDEHISYGDLGRAVPPFGCAFSTVPGM-SHVLAVANEEGIVRLYDTECGDMQRLVVKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVKAGELIGECKGHQCSLKSVAFSKFERAVFSTGGRDGNIMVWD----TRCNKKDGFYRQVNQITGAHNAIDKQTPSKVKKRKPSIRGLAPSVDSQQSVTVVIFQDEYTVISAGAVDGVVKIWDLRKNYSTYRQDPVPVKLFPYPGNSTRKLGYSSLVLDPTGTNLFASCTDDNVYMFNATGLKTD-PVSVFRGHQNSTFYIKASVSPDGQFLLSGSSDHSAYIWQVSDPLAAPINLIGHCQEVTSVAWCQSDFTKIATCSDDNTVRIWRLNRSSE 396          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. UniProt/SwissProt
Match: sp|Q4V837|DTLA_XENLA (Denticleless protein homolog A OS=Xenopus laevis OX=8355 GN=dtl-a PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 6.602e-56
Identity = 123/375 (32.80%), Postives = 203/375 (54.13%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQAIV-QNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPI---PKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LL+ ++C ++D  I Y E     P + C FS  P+  S+++ +A E+G + + +TE    Q ++ + F AH N +FD+ W+ G ++++T+SGD++ K  D+   E I +   H+ S+KS++       +F++  RDG+I++WD    ++ +K+D     ++ I    NA            K   R   P     +SVT +IF +E  + S+G+ DG +K+WD+RK     +++P PVK  PY G      G++ LV++  GT LFA C D+ +Y +N        PV  + GH + ++Y+K  +SPD ++L  GSS +S YI+ V      P+ L GH  EVT   WC ++   I + SDD T  V R+K   E
Sbjct:   28 LLQCYQCVKQDEHISYGELGMPVPPFGCAFSTVPDM-SHVLAVANEEGIVRLYDTECRDMQRLLMKEFMAHTNAVFDIAWVPGEHKLVTASGDQTAKLWDVMAGELIGECRGHQCSLKSVSFSKFERAVFSTGGRDGNIMMWD----TRCSKKDGFYRQVNQITGAHNAIDKQTPSKMKKRKPSIRGLAPSVDSQQSVTVVIFQDEYTIISAGAVDGVVKIWDLRKNYSAYRQDPVPVKHFPYPGNSTRKLGYSSLVLDPTGTNLFASCTDDNVYMFNATGLKTD-PVSIFRGHQNSTFYIKASVSPDGQFLLSGSSDHSAYIWQVSDPMAAPVTLMGHCQEVTSVAWCQSDFTKIATCSDDNTVRVWRLKRSCE 396          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. UniProt/SwissProt
Match: sp|Q5ZJW8|DTL_CHICK (Denticleless protein homolog OS=Gallus gallus OX=9031 GN=DTL PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 9.108e-56
Identity = 130/406 (32.02%), Postives = 222/406 (54.68%), Query Frame = 1
Query:  139 SDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFS--PEFNSNIVMIAKEDGGIVMINTELSGSQAIV-QNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHP-DFVVSSSISKSQN--RKFNPI---PKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMK--PGSEFNVFYRNQVI 1311
            + +RQS    S+    LL+ + C+RED  + Y E     P + C FS  P F  +++ +A E+G + + +TE   +  ++ + ++AH N +FD+ W+ G +RI+T+SGD++ K  D+   E +     H+ S+KS+A       +F +  RDG+I++WD    ++ NK+D G      +N +  AH+  D    S + K +   R   P+    +SVT ++  +E+ L S+G+ DG IK+WD+RK     +++P P K   Y G      G++ LV++  G  LFA C D+ IY +N+       PV  ++GH + ++Y+K  +SPD+++L  GSS  + YI+ V      P +L GH  EVT   WCP++   I + SDD T  + R++  P  E +V  + +++
Sbjct:   11 AGHRQS---SSLPLQHLLDGYRCSREDDHLSYGEIGMPVPPFGCSFSAAPNFE-HVLAVANEEGFVRLYDTEAQNTTKLISKEWQAHSNAVFDLAWVPGEHRIVTASGDQTAKVWDVRAGELLGICKGHQCSLKSVAFSRFEKAVFCTGGRDGNIMVWD----TRCNKKD-GFYR--QVNQISGAHNVVDRQTPSKLRKKRQNLRGLAPLVDFQQSVTVVLLQDEHTLISAGAVDGVIKVWDLRKNYAAYRQDPVPSKSFFYPGTSTRKLGYSSLVLDSTGANLFANCTDDSIYMFNMTSLK-TFPVAVFSGHQNSTFYIKSSISPDDQFLVSGSSDCNAYIWKVSEPSLPPRILVGHSQEVTSIAWCPSDFTKIATCSDDNTVRIWRLQHYPEEEKSVSNKAKLV 404          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. TrEMBL
Match: A0A4Z2DMJ7 (Denticleless protein OS=Schistosoma japonicum OX=6182 GN=EWB00_010903 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 5.355e-86
Identity = 155/382 (40.58%), Postives = 238/382 (62.30%), Query Frame = 1
Query:  175 VPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGS-NRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWD--LNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNR---KFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKI----SKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNV 1290
            +P   +E FEC R   + L++     SP + C FSP   +++++IA+EDG + + +T ++GSQA ++++ AH N +FDV+W+ S +  LT+SGD+SI+ ID      I Q   H  SV+SL+  PS  ++FAS+SRDGSI +WD  +  ++   +  PG   IS +  L   H P +  SS+    + R   +     +SVTS++FV++N   S+GS+DG IK+WD+R++    SKK  +P  V+PYSG  Q   G++DLVVN     LFA C D  +Y+Y+L +   + PV+ YTGHV+DS+Y+K+D+SPD+ Y+ CGSS    +IY VG   QQP++L+GH GEV+V RWC  +   I+++SD+  A V  M P   + +
Sbjct:   21 LPIICVENFECRRNQAYHLHSVLAPSSPPFACDFSPTL-TDLILIAQEDGLVHLYDTSVTGSQAFLKHYEAHNNAVFDVKWLSSGSSFLTASGDQSIRLIDAETGVIIQQFFGHTMSVRSLSFMPSDCHIFASTSRDGSIRMWDTRVKPDAVNFRGSPG---ISSVGVLPQCHVPSWPNSSNTDGRKTRTPKRVATDAQSVTSVLFVDDNTFLSAGSSDGSIKMWDLRRVFCVGSKKQAKPKFVLPYSGTSQKQSGYSDLVVNSYRKRLFANCLDNVVYEYDLTQSTTQ-PVFIYTGHVTDSFYVKLDISPDDSYIICGSSDRRAHIYAVGKRQQQPIVLSGHTGEVSVARWCKGDPTRIVTLSDESQAFVWNMFPARRYTL 397          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. TrEMBL
Match: A0A3Q0KKZ3 (Putative prokaryotic DNA topoisomerase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 5.882e-85
Identity = 159/406 (39.16%), Postives = 247/406 (60.84%), Query Frame = 1
Query:  103 SVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGS-NRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWD--LNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNR---KFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKI----SKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNV 1290
            SV+ +  QR+ F   R +   +  +P   +E FEC R   + L++     SP + C FSP   +++++IA+EDG + + +T ++G+QA ++++ AH N +FDV+W+ S +  LT+SGD+SI+ ID      I Q   H  SV+SL+  PS  ++FAS+SRDGSI +WD  +  ++   +  PG   IS +  L   H P    SS+    + R   +     +SVTS++FV++N   S+GS+DG IK+WD+R++    SKK  +P  + PYSG  Q   G++DL VN   T LFA C D  +Y+Y+L +   + PV+ YTGHV+DS+Y+K+D+SPD+ Y+ CGSS    +IY VG   QQP++L+GH GEV+V RWC  +   I+++SD+  A V  M P   + +
Sbjct:    4 SVFSSVNQREFF---RFTEENQKRLPTIGVENFECRRNQAYHLHSVLAPNSPPFACDFSPTL-TDLILIAQEDGLVHLYDTSVTGTQAFLKHYEAHNNAVFDVKWLSSGSSFLTASGDQSIRLIDAETGVIIQQFFGHTMSVRSLSFMPSDCHIFASTSRDGSIRMWDTRVKPDAVNFRGSPG---ISSVGVLPQCHVPFLPNSSNTDGRRTRTPKRSATDAQSVTSVLFVDDNTFLSAGSSDGSIKMWDLRRVFCVGSKKQAKPKFIFPYSGTSQKQSGYSDLAVNSHRTRLFANCLDNVVYEYDLTQSTTQ-PVFVYTGHVTDSFYVKLDISPDDSYIICGSSDRRAHIYAVGKRRQQPIVLSGHTGEVSVPRWCKGDPTRIVTLSDESQAFVWNMFPARRYTL 401          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. TrEMBL
Match: A0A4S2LVC4 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004607 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.275e-82
Identity = 159/404 (39.36%), Postives = 244/404 (60.40%), Query Frame = 1
Query:  100 NSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGS-NRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKY--NKEDPGVISIS--PINHL--FNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKI-----SKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPG 1275
             SV+ +   R++F + +++      +P   +E FEC     + L++     SP + C FSP F S++++IA+EDG + + NT L G+ A +Q++ AH N +FDV+W+ S +  LT+SGD+SI+ ID  +     Q   H  SV+SLAL PS  N+FAS+SRDGSI LWDL   S     +  PG  S+   P  HL  ++     +  +S   ++ +R+ +   +SVTS++F+++N L S+GS DG IK+WD+R++      KK  +P  V PY G  Q   G++DL ++   + L+A C D  +Y+Y+L R +   P + YTGH +DS+Y+K+DLSPD+ YL CGSS    +IY VG   Q P++L+GH GEV++ RWCP +   I+++SDD  A V  M P 
Sbjct:    3 GSVFHDVSFREVFGNRKKNATCSKRIPGIGVEYFECRASQAYRLHSMLDINSPPFACDFSPTF-SDLILIAQEDGLVHLYNTSLEGAVAFIQDYEAHANAVFDVKWLPSGSAFLTASGDQSIRLIDAEQGIVQQQFFGHTMSVRSLALMPSDSNIFASASRDGSIRLWDLRLKSDAVNCRGLPGTPSVGLIPQCHLPNWSGTMESYSPTSRRPRTPSRRASCDAQSVTSVVFMSDNTLLSAGSTDGSIKMWDLRRVFSTNSGKKKVKPKCVFPYRGISQKRSGYSDLRLDSLRSRLYANCLDNVVYEYDLTRQSTS-PAFVYTGHQTDSFYIKLDLSPDDGYLICGSSDRRAHIYAVGQRRQCPIMLSGHNGEVSIPRWCPGDPTRIVTLSDDSRAFVWNMFPA 404          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. TrEMBL
Match: A0A0X3Q3I0 (Denticleless protein homolog OS=Schistocephalus solidus OX=70667 GN=DTL PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 9.107e-82
Identity = 171/490 (34.90%), Postives = 272/490 (55.51%), Query Frame = 1
Query:  103 SVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRI-LTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLF-NAHHPDFV-VSSSISK--SQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKIS---KKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNVFYRNQVIKRSHNLAPFSLSSRSHQETVNENNQFQKAQIPQEIKQEVQFNKTDLEKPMIK--LTTPKTKDQ---SITSFLSPMPTSA 1533
            SV+     R  F+  RQS   +  +P+  +E FEC R   F LY+     SP + C FS   +  ++++AKEDG + + NT    + A+++N+  H N IFDV+W+   R+ LT+SGD+SIK +D      +     H  SV+SLAL P+  ++FAS+SRDG I LWD+   SK + E  G +S+   + L    H P  V + S + +  S++RK      SVT +IF     L S+GS DG +K+WD+RK+S   ++   P  V+PY G  +   GF+DLV++   T L+A C D  IY+Y+L   + + P++ Y GH+++S+Y+KM LSPD++YLACGS  +  YIY VG   Q P++L+GH GEV+V RW   +  +++++SD     V RM P   + +    +++          L+ R  + T++ + Q  +   P   K+  QF ++    P     + +P T+     +I SFL+ +  +A
Sbjct:    6 SVFSEVTARDSFAHNRQSFSIRKCIPEIGVENFECIRSQSFQLYSNVDGTSPPFACDFSAH-DPYLLLVAKEDGLVHLYNTLEKHAYALIRNYEVHDNAIFDVKWLSHARMFLTASGDQSIKLVDSASTAVVRSFLGHTMSVRSLALMPNDNHIFASASRDGCIRLWDMR--SKSHSEQVGGVSVCCSSLLLPQCHVPSTVPLESPLRRLRSKSRKSLSDSHSVTCVIFGRNFDLISAGSTDGAVKIWDLRKLSSSARRPATPKMVLPYRGISRKQSGFSDLVLDSRRTRLYASCLDHTIYEYDLNSQSTR-PMFVYAGHLTNSFYIKMTLSPDDRYLACGSGDHRAYIYLVGERFQNPLILSGHTGEVSVPRWSVFDPTLMVTLSDAAQLFVWRMFPSRRYTLPQSGELV---------GLTERLSRPTMSPSTQIDRLMPPSPQKELNQFCQSPDVAPTASPDVASPSTRKHRQVNIRSFLADISMTA 482          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. TrEMBL
Match: A0A0X3NXG9 (Denticleless protein homolog OS=Schistocephalus solidus OX=70667 GN=DTL PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.411e-81
Identity = 171/490 (34.90%), Postives = 272/490 (55.51%), Query Frame = 1
Query:  103 SVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRI-LTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLF-NAHHPDFV-VSSSISK--SQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKIS---KKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNVFYRNQVIKRSHNLAPFSLSSRSHQETVNENNQFQKAQIPQEIKQEVQFNKTDLEKPMIK--LTTPKTKDQ---SITSFLSPMPTSA 1533
            SV+     R  F+  RQS   +  +P+  +E FEC R   F LY+     SP + C FS   +  ++++AKEDG + + NT    + A+++N+  H N IFDV+W+   R+ LT+SGD+SIK +D      +     H  SV+SLAL P+  ++FAS+SRDG I LWD+   SK + E  G +S+   + L    H P  V + S + +  S++RK      SVT +IF     L S+GS DG +K+WD+RK+S   ++   P  V+PY G  +   GF+DLV++   T L+A C D  IY+Y+L   + + P++ Y GH+++S+Y+KM LSPD++YLACGS  +  YIY VG   Q P++L+GH GEV+V RW   +  +++++SD     V RM P   + +    +++          L+ R  + T++ + Q  +   P   K+  QF ++    P     + +P T+     +I SFL+ +  +A
Sbjct:    6 SVFSEVTARDSFAHNRQSFSIRKCIPEIGVENFECIRSQSFQLYSNVDGTSPPFACDFS-AHDPYLLLVAKEDGLVHLYNTLEKHAYALIRNYEVHDNAIFDVKWLSHARMFLTASGDQSIKLVDSASTAVVRSFLGHTMSVRSLALMPNDNHIFASASRDGCIRLWDMR--SKSHSEQVGGVSVCCSSLLLPQCHVPSTVPLESPLRRLRSKSRKSLSDSHSVTCVIFGRNFDLISAGSTDGAVKIWDLRKLSSSARRPATPKMVLPYRGISRKQSGFSDLVLDSRRTRLYASCLDHTIYEYDLNSQSTR-PMFVYAGHLTNSFYIKMTLSPDDRYLACGSGDHRAYIYLVGERFQNPLILSGHTGEVSVPRWSVFDPTLMVTLSDAAQLFVWRMFPSRRYTLPQSGELV---------GLTERLSRPTMSPSTQIDRLMPPSPQKELNQFCQSPDVAPTASPDVASPSTRKHRQVNIRSFLADISMTA 482          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Cavefish
Match: dtl (denticleless E3 ubiquitin protein ligase homolog (Drosophila) [Source:NCBI gene;Acc:192314])

HSP 1 Score: 205.682 bits (522), Expect = 1.442e-57
Identity = 114/374 (30.48%), Postives = 198/374 (52.94%), Query Frame = 1
Query:  187 LLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPIN--HLFNAHHPDFVVSSSISKSQNRKFNPI---PKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSE 1281
            LLE ++C R D  I Y       P + C FS     +  +    + G+V I        ++++ + AH N +FD+ W+ G+N ++T+SGD++ +  D+  EE +     H+ S+KS++       +F +  RDG+I++WD    ++ +K+D     +  I+  H+  A +      +   +S  R   P     + VT ++F +EN L SSG+ DG IK+WD+RK      +NP P++   Y G      G++ L ++  G+ LF  C D+ +Y +++       PV  ++GH + S+Y+K  LSPD+++LA GS+  S YI+ +    + P++L GH  EVT   WCP +   +++ SDD T  + R+  G+E
Sbjct:   27 LLECYQCTRHDEHISYGNTAVAVPPFGCSFSTAPGQHNTLAVANEEGVVAIYKTAEKQSSVLKEWPAHDNAVFDIAWVPGANSLVTASGDQTARLWDVLAEELLGSFKGHQCSLKSVSFPKQEKAVFCTGGRDGNIMVWD----TRCSKKDGFYRQVKQISGAHMKTAGN---TPQNKKKRSSCRGMAPSVDSQRGVTVVLFRDENTLISSGAVDGMIKMWDLRKNYTAYHQNPIPLQTYKYPGSSTRKLGYSGLTLDSTGSRLFCNCTDDNVYMFDISGLK-TTPVAVFSGHRNSSFYVKSSLSPDDQFLASGSTDCSAYIWKISEPAKAPVMLQGHSQEVTSVTWCPTDFTKLVTCSDDNTVRIWRLNRGAE 392          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Cavefish
Match: dcaf5 (DDB1 and CUL4 associated factor 5 [Source:NCBI gene;Acc:103033617])

HSP 1 Score: 59.6918 bits (143), Expect = 6.430e-9
Identity = 69/287 (24.04%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  388 HKNCIFDVQWMGSN-RILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            H + IF + +  +N R+ +   D  +   D+ R E+++    H+ +V  L++ P + N+FASSS DG +L+WD        +E P              H   F +++  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G L      + +  N AGT L A  +      Y L   + ++P +Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:   99 HLSNIFCLAFDSTNTRVFSGGNDEQVILHDVERGETLN-VFLHDDAVYGLSVSPVNDNVFASSSDDGRVLIWD-------TREPP--------------HGEPFCLANYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPRS------SLLRYGGSLSLQSAMS-VRFNSAGTQLLALRRRLPPVLYEL---HSRLPSFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWKIPKDPEAGGPGRVVNGAFMVLKGHRSIVNQVRFNP 342          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Cavefish
Match: rack1 (guanine nucleotide-binding protein subunit beta-2-like 1 [Source:NCBI gene;Acc:103029614])

HSP 1 Score: 56.225 bits (134), Expect = 3.787e-8
Identity = 54/225 (24.00%), Postives = 89/225 (39.56%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISP-INHLFNAHHPDFVVSSS----------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSSYSPYIY 1128
            H G V  +A  P  P+M  S+SRD ++L+W L  D + Y      +   S  ++ +  +    F +S S           + +  R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + YL  + +SPD    A G       ++
Sbjct:   14 HSGWVTQIATTPQFPDMILSASRDKTVLMWKLTRDETNYGVPQRALKGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDESHSEWVSCVRFSPNSSNP-------------IIVSCGWDKMVKVWNLANCKLK------TNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLW 219          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Cavefish
Match: ENSAMXT00000032472.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 54.299 bits (129), Expect = 9.194e-8
Identity = 53/219 (24.20%), Postives = 88/219 (40.18%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISP-INHLFNAHHPDFVVSSS----------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSS 1110
            H G V  +A  P  P+M  S+SRD +I++W L  D + Y      +   S  ++ +  +    F +S S           + +  R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + +L  + +SPD    A G  +
Sbjct:   14 HSGWVTQIATTPQFPDMILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHSEWVSCVRFSPNSSNP-------------IIVSCGWDKMVKVWNLANCKLK------TNHIGHTGFLNTVTVSPDGSLCASGGKT 213          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Cavefish
Match: ENSAMXT00000047239.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 54.299 bits (129), Expect = 1.865e-7
Identity = 53/227 (23.35%), Postives = 90/227 (39.65%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISP-INHLFNAHHPDFVVSSS----------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSSYSPYIYHV 1134
            H G V  +A  P  P+M  S+SRD +I++W L  D + Y      +   S  ++ +  +    F +S S           + +  R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + +L  + +SPD    A G       ++ +
Sbjct:   14 HSGWVTQIATTPQFPDMILSASRDKTIVMWKLTRDETNYGVPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHSEWVSCVRFSPNSSNP-------------IIVSCGWDKMVKVWNLANCKLK------TNHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDL 221          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Sea Lamprey
Match: dtl (denticleless E3 ubiquitin protein ligase homolog (Drosophila) [Source:NCBI gene;Acc:192314])

HSP 1 Score: 151.754 bits (382), Expect = 1.133e-41
Identity = 95/308 (30.84%), Postives = 165/308 (53.57%), Query Frame = 1
Query:  103 SVYKNFFQRKIFSDYRQSILTKSIVP-DFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSN-IVMIAKEDGGIVMINTEL--SGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNP---IPKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNL 993
            S++++ + R I    R  +   S  P D LL  FEC   D   ++    +  P + C FS E  S+ ++ +  EDG + + +TE    GS+ +++ + AH N +FD  WM G ++++T+SGD+  K  D+   E++     H+ S+KS+A   S   +F +  RDG+I++WD+    + +K D    ++  I    NA  P  +  +   ++  R   P     +SVT++IF +E  L SSG+ DG IK+WD+RK     +  P P +  PY G      GF+ LV+N + ++LFA C ++++Y +++
Sbjct:    2 SLFESVYNRHILK--RNKVGPSSRCPLDSLLLGFECRAPDEHKVFGTAGDPVPAFACPFSREAGSHHLLAVPSEDGVVQIYDTEKPHKGSR-VLKAWLAHSNAVFDCAWMPGESKLVTASGDQMAKLWDVCAGEALGSFKGHQCSLKSVAFSQSEKAVFCTGGRDGNIMVWDI----RCSKRDGFYSAVKRIGSAHNA--PAKISVTPKRRNTPRGMAPSVDSQQSVTAVIFQDEKTLVSSGAVDGVIKVWDMRKNYTSYRMGPVPAQSFPYPGSSSRKRGFSSLVLNASSSLLFANCTEDWVYMFDV 300          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 55.8398 bits (133), Expect = 1.196e-8
Identity = 67/281 (23.84%), Postives = 110/281 (39.15%), Query Frame = 1
Query:  247 EESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQW-MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISK-------SQNRKFNPIPK---SVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQN-PPGFTDLVVNQAGTMLFAYCKDEFIYQYNL--ERPNYKIPVYQYTGHVSD 1047
             E  VY C+F P  N N +  A  D  I+M N  + G      + + H   I D+ +    + I TSS D+++   D    E I +   H   V +       P M  ++S DG++ LWD       +        +S     FN    D ++S  I          QN+    +     SVT +    +     S + D  +++WD+R  +   P    V  + G + N          +  G+ + A   D F+Y ++    R  YK+P   + G V+D
Sbjct:   56 HEGEVYCCKFHP--NGNTLASAGFDRTILMWN--VYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQCLSVT---FN-DTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFA---PMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLP--GHAGSVND 323          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 5.969e-8
Identity = 57/234 (24.36%), Postives = 89/234 (38.03%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISPINHLFNAHH--PDFVVSSS------------------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSSYSPYIY 1128
            H G V  +A  P  P+M  S+SRD ++++W L  D + Y     G+    P   L    H   D V+SS                    + +  R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + YL  + +SPD    A G       ++
Sbjct:   14 HNGWVTQIATTPQFPDMILSASRDKTLIMWKLTRDETNY-----GI----PQRSLHGHGHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQEDGHTEWVSCVRFSPNNNNP-------------IIVSCGWDKLVKVWNLTNCKLK------TNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLW 219          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Sea Lamprey
Match: WDR77 (WD repeat domain 77 [Source:HGNC Symbol;Acc:HGNC:29652])

HSP 1 Score: 51.6026 bits (122), Expect = 6.851e-8
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  301 VMIAKEDGGIVMINTELSGSQAIV--QNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVI 648
            +++A + G + +   EL+ ++A +  ++ R   N I        +R+++ S DRS+K  DL+  + +S    H  SV  ++  P   N+F S S+DG I+LWDL       K  P V+
Sbjct:   69 ILVASDSGALELW--ELAENEAYLCSRHCRYEHNDIVTRISTSGSRVVSGSLDRSVKVWDLSELKVVSSYRGHSASVDCVSFSPHDDNLFLSCSQDGKIMLWDL------RKAKPAVV 178          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 50.8322 bits (120), Expect = 3.031e-7
Identity = 55/223 (24.66%), Postives = 81/223 (36.32%), Query Frame = 1
Query:  244 FEESPVYQCRFSPEFN-------SNIVMI--AKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNS-----KYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNR----KFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKN 858
               S V  C ++P  N        NI  I   K   G V ++ EL G          H   +   +++  NRI+TSSGD +    D+   +  +    H G V SLAL P     F S + D S  LWD+ D         ++ D   I   P  + F     D        ++         + I   +TS+ F     L  +G  D    +WD  K  +  
Sbjct:    7 LRSSWVMTCSYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPG----------HTGYLSCCRFLDDNRIVTSSGDTTCALWDIETGQQTTAFVGHSGDVMSLALAPD-GRAFVSGACDASAKLWDVRDGMCRQTFSGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELVLYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNVWDAMKAERAG 218          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Yeast
Match: PEX7 (Peroxisomal signal receptor for peroxisomal matrix proteins; recognizes the N-terminal nonapeptide signal (PTS2); WD repeat protein; defects in human homolog cause lethal rhizomelic chondrodysplasia punctata (RCDP) [Source:SGD;Acc:S000002549])

HSP 1 Score: 49.6766 bits (117), Expect = 7.087e-7
Identity = 63/266 (23.68%), Postives = 111/266 (41.73%), Query Frame = 1
Query:  262 YQCRFSPEFNSNIVMIAKEDGGIV------MINTELSGSQAIVQNFRAHKNCIFDVQWMGS--NRILTSSGDRSIKYIDLN-REESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISIS----PINHL---------------------FNAHHPDFVVSSS-------------ISKSQNRKFNPIPKSVTSIIFVNEN----VLASSGSADGKIKLWDVRKISKKNPEPVK-VIPYSGKLQN 903
            Y  ++SP F++ + + A  + G+V      ++  + SG    V +F   ++C+FD+ W  S  N++L + GD +++  D   +E  I+    HE  V S      +   F SSS DGSI +W            P  + I+    P+N +                     F+ H  + V+S S               K+QN   N +  S    +  + N     + ++G  D  I++WD+R ++K     +K  +P  G+L N
Sbjct:   12 YGVQYSPFFDNRLAVAAGSNFGLVGNGKLFILEIDRSGRIVEVNSFLT-QDCLFDLAWNESHENQVLVAQGDGTLRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQN---NFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVP--GQLHN 271          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Yeast
Match: STE4 (G protein beta subunit; forms a dimer with Ste18p to activate mating signaling pathway, forms heterotrimer with Gpa1p and Ste18p to dampen signaling; pheromone-induced phosphorylation plays critical role in chemotropism; may recruit Rho1p to polarized growth site during mating; contains WD40 repeats [Source:SGD;Acc:S000005738])

HSP 1 Score: 47.3654 bits (111), Expect = 4.159e-6
Identity = 51/201 (25.37%), Postives = 85/201 (42.29%), Query Frame = 1
Query:   85 ISNPINSVYKNFFQRK----------IFSDYRQSILTKSIVPDFLLETFECAREDRFILYNED----------FEESPVYQCRFSPEFNSNIVMIA--KEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHP------NMFASSSRDGSILLWD 603
            ++N + S+ KN    K            SD+R S  +K I+          A +D F+L  +            +   V  C  SP  +S +V  A    +  I  ++ E   +Q +   F+ H   I D+++  +  ILT+SGD +    D+ + + + + + H G V +LA+ P  P      N FAS   DG   +WD
Sbjct:   68 MANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILS---------ASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISP--SSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAI-PEEPNSENSSNTFASCGSDGYTYIWD 256          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Nematostella
Match: EDO44039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWU9])

HSP 1 Score: 210.305 bits (534), Expect = 8.044e-63
Identity = 113/326 (34.66%), Postives = 186/326 (57.06%), Query Frame = 1
Query:  301 VMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSN-RILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP---KSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMV 1257
            + +A EDG + +++T   G QAIV  + AH N IFDV WM +  +++T+SGD++ +  D+ +E S++    H  S+KS+  R +    FA+ +RDG+I++WD   N + +          P+N +++AH           K   R   P P   +SVT+++F  +++L S+G+ DG +K+WD+RK   ++K++P P  + PY GK     GF+ LV++   + L+A C ++ IY Y       + PV  +TGH + ++Y+K  LSPD+ YL  GSS  + YI+ V    + P+ L GH GEVT   WCP +   +++ SDD T  +
Sbjct:    6 LAVADEDGSVRVLDTNKYGRQAIVVEWTAHSNAIFDVAWMHNEAKLVTASGDQTARLWDVTKETSLAVFKGHSCSLKSVDFRKNDQFTFATGARDGNIMVWDTRCNQRRDH-------YQPVNTIYSAHTQQLTTPMRARKRSRRASTPQPDSQQSVTAVVFHGDDLLISAGAMDGNLKMWDLRKYYTMAKQDPVPYHMFPYPGKGPRKHGFSSLVLDSNQSKLYASCTNDHIYMYECSVLG-EDPVCSFTGHSNSTFYVKAALSPDDNYLLSGSSDNNAYIWKVSDADRPPVCLRGHAGEVTSVVWCPQDITKVVTCSDDTTVRI 323          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Nematostella
Match: EDO28485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6C0])

HSP 1 Score: 107.457 bits (267), Expect = 5.304e-27
Identity = 59/179 (32.96%), Postives = 101/179 (56.42%), Query Frame = 1
Query:  301 VMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSN-RILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIP---KSVTSIIFVNENVLASSGSADGKIK 825
            + +A EDG + +++T   G QAIV  + AH N IFDV WM +  +++T+SGD++ +  D+ +E S++    H  S+KS+  R +    FA+ +RDG+I++WD   N + +          P+N +++AH           K   R   P P   +SVT+++F  +N+L S+G+ DG +K
Sbjct:    4 LAVADEDGSVRVLDTNKYGRQAIVVEWTAHSNAIFDVAWMHNEAKLVTASGDQTARLWDVTKETSLAVFKGHSCSLKSVDFRKNDQFTFATGARDGNIMVWDTRCNQRRDH-------YQPVNTIYSAHTQQLTTPMRARKRSRRASTPQPDSQQSVTAVVFHGDNLLISAGAMDGNLK 175          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Nematostella
Match: EDO38818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBS0])

HSP 1 Score: 60.4622 bits (145), Expect = 5.646e-10
Identity = 58/225 (25.78%), Postives = 94/225 (41.78%), Query Frame = 1
Query:  259 VYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMG-SNRILTSSGDRSIKYIDLNREE--SISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKIS------KKNPEPVKVI---PYSGKL 897
            +Y C +S E+N ++V+ A  DG + + N  L   Q  V+ F+ H   ++ V W    + +L++S D +I+  D  R E  +++  T H+  V S    P  P  FAS+S D  I +WD+    +  +             L  AH  + +        Q+                    L  SGS D  IK WDVR  +      K +P  V+ +   P+ G +
Sbjct:   63 LYDCTWS-EYNKDVVISASGDGSLQLWNLALPEPQP-VRVFKGHTAEVYGVDWCREQDFVLSASWDHTIRLWDPLRTEIPTVAMFTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDMACPGRPQQ-------------LIRAHEGEVLTCDWAKYDQH--------------------LVVSGSVDTLIKGWDVRNTNAPVFSFKAHPYAVRRLKCSPHQGNI 252          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Nematostella
Match: EDO39721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9A5])

HSP 1 Score: 57.7658 bits (138), Expect = 4.906e-9
Identity = 57/228 (25.00%), Postives = 92/228 (40.35%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISPINHLFN----AHHPDFVVSSSISKS----------QNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLK-MDLSPDEKYLACGSSSYSPYIY 1128
            H G V  +A  PS+P+   SSSRD  +++W+L  D++ Y        S++  NH  +    +    F +S S  K+            R+F    K V S+ F  +N    SG+ D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ I  +NL     K      T H+  + YL  + +SPD    A G       ++
Sbjct:   14 HNGWVTQIATNPSNPDTILSSSRDKKLIVWELTRDDANYGFAKK---SLTGHNHFVSDVVMSSDGQFALSGSWDKTLRLWDLNAGVTTRRFVGHTKDVLSVAFSADNRQIVSGARDHHIKLWNTLGVCKYTIQEETHSEWVSCVRFSPNTSNP-------------IIVSSGWDKLIKVWNLTNCRLK------TNHIGHTGYLNCVTVSPDGSLCASGGKDGQAMLW 219          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Nematostella
Match: EDO32035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW82])

HSP 1 Score: 50.0618 bits (118), Expect = 1.447e-6
Identity = 35/104 (33.65%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  304 MIAKEDGGIVMINTELSGSQAIVQNF---RAHKNCIFDVQW-MGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWD 603
            ++   D G V I ++ SGS   ++N    + H N +  V      +RI+++S DRSIK  DL  E+ I     H   V  +    +  ++F S+SRDGS++LWD
Sbjct:   75 IVVGSDNGAVDIWSQ-SGSLLGLENLASLKEHDNVVSSVSVDCEKSRIISASWDRSIKVWDLTSEQCIRTLKGHSDFVLGVDCSGTEKDLFLSASRDGSVVLWD 177          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Medaka
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:101156296])

HSP 1 Score: 202.601 bits (514), Expect = 2.272e-56
Identity = 129/420 (30.71%), Postives = 223/420 (53.10%), Query Frame = 1
Query:  106 VYKNFFQRKIFSDYRQSILTKSIVPDF----LLETFECAREDRFILYNEDFEESPVYQCRFSPEFN-SNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWM-GSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQN---RKFNP---IPKSVTSIIFVNENVLASSGSADGKIKLWDVRK---ISKKNPEPVKVIPYSGKLQNPP-GFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMV---HRMKPGSEFNVFYRNQV 1308
            ++++   R +    RQ+ L+  +VP      LL ++ C R D  I Y    +  P +   FS   +  NI+  A E+G + + NTE  G+  +++ + AH+N +FD+ W+ G  +++T++GD++ +  D+   E +     H  S+KS+A       +F +  RDG+I++WD    ++ +K+D G     P+N +  AHH      SS +K +    R   P     +SVT ++F +++ L S+G+ DG IK+WD+RK     +  P P++  PY+G       G++ LV++ + + +   C D+ IY +N+     + PV  ++GH + S+Y+K  +SPD+++LA GSS    Y++ +      PM+L GH  EVT   WCP +   I S SDD T  +   HR   G++ +V   N V
Sbjct:    2 LFRSVVARGV-GRRRQTALSADLVPRIPLISLLGSYRCVRHDEHISYGNTGDTVPPFGLAFSSARDMQNILAAANEEGIVRIYNTESRGN-PLLKEWLAHENAVFDIAWVPGEPQLVTAAGDQTARLWDVKSGELLGSFRGHLCSLKSVAFTAEEKAVFCTGGRDGNIMVWD----TRCSKKD-GFYR--PVNQISGAHHKAEANPSSKTKKRRSSLRGMAPSVDTQQSVTVVLFRDQHTLISAGAVDGVIKMWDLRKNYVAHRHEPLPLQTYPYAGSCTRMRLGYSGLVLDSSRSNVMCNCTDDSIYMFNVCGVK-RTPVAVFSGHQNSSFYVKSSISPDDQFLASGSSDNHAYMWKISDPQHPPMMLQGHSEEVTSVVWCPTDFTKIASCSDDHTVRIWRLHREAHGAQTSVADPNLV 411          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Medaka
Match: ENSORLT00000025739.2 (autophagy related 16 like 2 [Source:NCBI gene;Acc:101163065])

HSP 1 Score: 64.3142 bits (155), Expect = 2.457e-10
Identity = 63/294 (21.43%), Postives = 127/294 (43.20%), Query Frame = 1
Query:  370 VQNFRAHKNCIFDVQWMGSNRILTSSG-DRSIKYIDLNREESISQSTCHEGSVKSL-ALRPSHPNM-FASSSRDGSILLWDLNDN------SKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGII 1224
            +Q   AH+  I  V++  S+ +L + G DR +K  +L R  +++     +GS + +  +   H      ++S D S LLW L D+      + ++++       S  + +        +    + ++   +    P S + ++     ++  SG  D KI++WD R         V+ +P  G++      T L ++     + + C+D+ +   +L R +    V++  G    S   K  +SPD  Y+A GS+  S Y++ V     +  LL  H+  V    W  + + ++
Sbjct:  323 LQVLEAHEQGINAVRFSCSSDLLATGGTDRVVKLWEL-RAGTLTHRATLDGSTEGVTCVEFDHTGRRVLAASFDRSALLWRLGDSNPKVTLTGHSRKVTAARFTSAPHQVVTGSADRTIRLWDLQRAACVQQVETPSSCSDLVCSGNCII--SGHFDSKIRVWDGRLGG-----CVQELPSQGRV------TSLDLSYDHRQVLSCCRDDSLQLVDLRRWSRDRVVFRAEGFKCGSDSTKAVISPDSSYVAAGSADGSVYVWRVSTANLETRLLEEHRSPVNAVSWSLSGEYVV 602          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 55.8398 bits (133), Expect = 2.543e-8
Identity = 57/219 (26.03%), Postives = 86/219 (39.27%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYN---KEDPG--------VISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSS 1110
            H G V  +A  P +P+M  S+SRD SI++W L  D + Y    +   G        VIS      L  A      +    +    R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + YL  + +SPD    A G  +
Sbjct:   14 HSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHTEWVSCVRFSPNSSNP-------------IIVSCGWDKMVKVWNLANCKLK------TNHIGHTGYLNTVTVSPDGSLCASGGKT 213          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Medaka
Match: dcaf5 (DDB1 and CUL4 associated factor 5 [Source:NCBI gene;Acc:101168827])

HSP 1 Score: 57.7658 bits (138), Expect = 2.919e-8
Identity = 69/287 (24.04%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  388 HKNCIFDVQWMGSN-RILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQY--TGHVSDSYYLKMDLSPD-EKYLACGSSSYSPYIYHVGVVPQQP----------MLLNGHKGEVTVCRWCP 1206
            H + IF + +  SN ++ +   D  +   D+ R E+++    H  +V SL++ P + N+FASSS DG +L+WD        +E P              H   F ++S  S   +  FNP          V   +LA++ S +G + LWD+RK          ++ Y G +      + +  N  GT L A  +      Y L   + ++P +Q+   G+ +         + D ++Y+  GS  ++ Y++ +   P+            M+L GH+  V   R+ P
Sbjct:   95 HLSNIFCLAFDSSNTKVFSGGNDEQVILHDVERRETLN-VFLHIDAVYSLSVSPVNDNVFASSSDDGRVLIWD-------TREPP--------------HGEPFCLASYPSAFHSVMFNP----------VEPRLLATANSKEG-VGLWDIRKPRS------SLLRYGGSMSLQSAMS-VRFNSTGTQLLALRRRLPPVLYEL---HSRLPSFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDFNLYMWKIPKDPEAGGPGRVVNGAFMVLKGHRSIVNQVRFNP 338          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 55.8398 bits (133), Expect = 5.292e-8
Identity = 57/225 (25.33%), Postives = 87/225 (38.67%), Query Frame = 1
Query:  511 HEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYN---KEDPG--------VISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYL-KMDLSPDEKYLACGSSSYSPYIY 1128
            H G V  +A  P +P+M  S+SRD SI++W L  D + Y    +   G        VIS      L  A      +    +    R+F    K V S+ F  +N    SGS D  IKLW+   + K       + E V  + +S    NP             ++ +   D+ +  +NL     K      T H+  + YL  + +SPD    A G       ++
Sbjct:   14 HSGWVTQIATTPQYPDMILSASRDKSIIMWKLTRDETNYGIPQRSLKGHSHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQDEGHTEWVSCVRFSPNSSNP-------------IIVSCGWDKMVKVWNLANCKLK------TNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLW 219          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Planmine SMEST
Match: SMESG000070594.1 (SMESG000070594.1)

HSP 1 Score: 1162.13 bits (3005), Expect = 0.000e+0
Identity = 573/576 (99.48%), Postives = 573/576 (99.48%), Query Frame = 1
Query:   58 MTFDLLNYCISNPINSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNVFYRNQVIKRSHNLAPFSLSSRSHQETVNENNQFQKAQIPQEIKQEVQFNKTDLEKPMIKLTTPKTKDQSITSFLSPMPTSASFDTNRKQSAKPLTEKNIILPKQTKIDRGXXXXXXXXXXXXTPKKRSATKENDENTTNQENLKRRKTISQPIMKFLKSDNARQM 1785
            MTFDLLNYCISNPINSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDN KYNKEDPGVISISPINHLFNAHHPDFVVSSSI KSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNVFYRNQVIKRSHNLAPFSLSSRSHQETVNENNQFQKAQI QEIKQEVQFNKTDLEKPMIKLTTPKTKDQSITSFLSPMPTSASFDTNRKQSAKPLTEKNIILPKQTKIDRGKSVLLKSNNSKKTPKKRSATKENDENTTNQENLKRRKTISQPIMKFLKSDNARQM
Sbjct:    1 MTFDLLNYCISNPINSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFECAREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNYKYNKEDPGVISISPINHLFNAHHPDFVVSSSICKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKPGSEFNVFYRNQVIKRSHNLAPFSLSSRSHQETVNENNQFQKAQIHQEIKQEVQFNKTDLEKPMIKLTTPKTKDQSITSFLSPMPTSASFDTNRKQSAKPLTEKNIILPKQTKIDRGKSVLLKSNNSKKTPKKRSATKENDENTTNQENLKRRKTISQPIMKFLKSDNARQM 576          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Planmine SMEST
Match: SMESG000076568.1 (SMESG000076568.1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.579e-8
Identity = 54/228 (23.68%), Postives = 95/228 (41.67%), Query Frame = 1
Query:  505 TCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLN-DNSKYNKEDPGVISISP-INHLFNAHHPDFVVSSS----------ISKSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISK------KNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHV 1134
            T H+G +  +A  P +PN   S+SRD S+++W+LN D + +      +   +  ++ +  +    F +S S           S    R+F    K V S+ F  +N    SGS DG IKLW+   + K       + + V  + +S   +NP              + +   D+ +  +NL   N K+    + GH  + Y   + +SPD    A G       ++ +
Sbjct:   12 TGHDGPITQIATNPIYPNTLISASRDKSLIIWELNRDENSFGYAKRALKGHNGFVSDVVMSSDGQFALSGSWDGTLRLWDLTSGQTTRRFVGHTKDVLSVAFSADNRQIVSGSRDGTIKLWNTLGVCKYTIQEDGHTDWVSCVRFSPTSENPS-------------IVSCGWDKVVKVWNLS--NCKLRTNHF-GH--NGYLNTVAVSPDGSLCASGGKDGQAMLWDL 221          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Planmine SMEST
Match: SMESG000004409.1 (SMESG000004409.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.179e-6
Identity = 60/262 (22.90%), Postives = 109/262 (41.60%), Query Frame = 1
Query:  379 FRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTC---HEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHPDFV-VSSSIS--KSQNRKFNPIPKSVTSIIFVNENVLASSGSADGKIKLW--DVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGV 1140
            +R H+  I D+ W  +  +L +S DR ++   ++R E +    C   H  +V ++   P     F S S DG + LW++ D                I +   A  P+ + V+S  S  KS +    P    +T  +FV E    + G+ DG+I  +  ++  I+         I  S +       T + V+   +       ++   +  ++  +Y I + +Y G ++ S  +K   SP  KY+  GS +   YI+   V
Sbjct:  575 YRGHEGVITDLVWSKNLFLLVTSMDRQVRLWHISRRECL----CIFNHNDTVPTVVFHPKDDRYFLSGSLDGKLRLWNIPDKK--------------IRYWVEALLPNSLPVASMFSPLKSSSNSLLPPKTVITCAVFVCEATKVAVGTYDGRILFYTAELEYITS------MAIKSSHRKNKYCRVTAIEVDPTDSCKILVTTNDSRVRL-IDARDYHI-ICKYRGFINSSSRIKASFSPTGKYIISGSENSFFYIWKKDV 810          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Planmine SMEST
Match: SMESG000018712.1 (SMESG000018712.1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.879e-6
Identity = 57/218 (26.15%), Postives = 81/218 (37.16%), Query Frame = 1
Query:  244 FEESPVYQCRFSPEFN-------SNIVMI--AKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKY-----NKEDPGVISISPINHLFNAHHPDFVVSS-SISKSQNRKF---NPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRK 843
               S V  C ++P  N        NI  I   K   G V ++ EL G          H   +   +++  N+I+TSSGD +    D+   + ++  T H G V SL+L P     F S + D S  LWDL D         ++ D   I+  P    F     D       I   Q       + I   +TS+ F     L   G  D    +WD  K
Sbjct:   95 LRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPG----------HTGYLSCCRFIDDNQIVTSSGDVTCGLWDIETGQQVATFTGHTGDVMSLSLAPDM-RTFVSGACDASAKLWDLRDGQCKQTFPGHESDINAITFFPNGQAFATGSDDATCRLFDIRADQEIGMFSHDNIICGITSVAFSKSGRLLLGGYDDFNCNVWDTLK 301          
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 49.2914 bits (116), Expect = 5.368e-6
Identity = 75/362 (20.72%), Postives = 128/362 (35.36%), Query Frame = 1
Query:  250 ESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSGSQAIVQNFRAHKNCIFDVQWMG-SNRILTSSGDRSIKYIDLNREESISQSTCHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISISPINHLFNAHHP----------DFVVSSSISKSQNR----------KFNPIPKSVTSIIFVNENVLASSGSADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFAYCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSSSYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMVHRMKP 1272
            +  V+  +F+PE   + +  A  D  I++ NT   G    +     H   I D+Q+   S+ I T+S D+++   D    E + +   H   V S++       +F S S D  I LWD                +    H  +A H           D++ S  I    N+           F     S+TS+   N+     S S D  +++WD R   +       ++   G L N                         ++ NL R  + +                     D K + CGS+  + Y++ +    Q    L GH G V    + P ++ I++SVS D    +  ++P
Sbjct:   60 KGEVFCGKFAPE--GSFLASAGHDREIILWNTY--GDIKDLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKR--------------VKNTTHTIDAKHSVLDVAYSPFGDYIFSGGIENVINQWDVREMKIIQTFAGHTDSITSVAVSNDGNFLLSNSVDNTLRVWDTRPFVRGERCTKLMV---GHLHN-------------------------FEKNLLRCAWSV---------------------DGKRVTCGSADKNVYVWDM-YTGQIMYKLPGHVGSVNETAFHP-HEPILLSVSSDTKIFMGEIQP 352          
The following BLAST results are available for this feature:
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DTL3.383e-5533.51denticleless E3 ubiquitin protein ligase homolog [... [more]
DTL4.803e-5132.87denticleless E3 ubiquitin protein ligase homolog [... [more]
DCAF51.410e-922.67DDB1 and CUL4 associated factor 5 [Source:HGNC Sym... [more]
DCAF51.460e-923.34DDB1 and CUL4 associated factor 5 [Source:HGNC Sym... [more]
DCAF51.460e-923.34DDB1 and CUL4 associated factor 5 [Source:HGNC Sym... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdt-22.473e-2728.43CDT (S. pombe CDC10 Dependent Transcript) homolog ... [more]
atg-16.11.847e-721.95Autophagic-related protein 16.1 [Source:UniProtKB... [more]
prp-178.515e-621.56Yeast PRP (Splicing factor) related [Source:UniPr... [more]
prp-178.515e-621.56Yeast PRP (Splicing factor) related [Source:UniPr... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)dtl1.118e-4732.03gene:FBgn0013548 transcript:FBtr0072085[more]
Wdr246.752e-625.69gene:FBgn0027518 transcript:FBtr0330297[more]
Wdr246.807e-625.69gene:FBgn0027518 transcript:FBtr0085543[more]
Wdr339.543e-629.07gene:FBgn0046222 transcript:FBtr0078713[more]
Wdr339.543e-629.07gene:FBgn0046222 transcript:FBtr0078714[more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtl3.619e-5932.63denticleless E3 ubiquitin protein ligase homolog (... [more]
dcaf56.475e-923.69ddb1 and cul4 associated factor 5 [Source:ZFIN;Acc... [more]
pex75.594e-823.22peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
rack16.227e-823.79receptor for activated C kinase 1 [Source:NCBI gen... [more]
wdr331.882e-734.15WD repeat domain 33 [Source:ZFIN;Acc:ZDB-GENE-0409... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtl1.303e-5933.42denticleless E3 ubiquitin protein ligase homolog [... [more]
dtl1.335e-5933.42denticleless E3 ubiquitin protein ligase homolog [... [more]
dtl1.585e-5933.33denticleless E3 ubiquitin protein ligase homolog [... [more]
dtl2.455e-5933.42denticleless E3 ubiquitin protein ligase homolog [... [more]
dtl3.879e-5933.42denticleless E3 ubiquitin protein ligase homolog [... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dtl1.186e-5331.77denticleless E3 ubiquitin protein ligase [Source:M... [more]
Dtl6.201e-1129.51denticleless E3 ubiquitin protein ligase [Source:M... [more]
Dcaf51.679e-922.67DDB1 and CUL4 associated factor 5 [Source:MGI Symb... [more]
Rack15.182e-823.79receptor for activated C kinase 1 [Source:MGI Symb... [more]
Atg16l11.090e-626.06autophagy related 16-like 1 (S. cerevisiae) [Sourc... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P1W0|DTL_XENTR7.074e-5933.42Denticleless protein homolog OS=Xenopus tropicalis... [more]
sp|Q5RHI5|DTL_DANRE2.732e-5832.63Denticleless protein homolog OS=Danio rerio OX=795... [more]
sp|Q6GPU3|DTLB_XENLA3.468e-5733.07Denticleless protein homolog B OS=Xenopus laevis O... [more]
sp|Q4V837|DTLA_XENLA6.602e-5632.80Denticleless protein homolog A OS=Xenopus laevis O... [more]
sp|Q5ZJW8|DTL_CHICK9.108e-5632.02Denticleless protein homolog OS=Gallus gallus OX=9... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DMJ75.355e-8640.58Denticleless protein OS=Schistosoma japonicum OX=6... [more]
A0A3Q0KKZ35.882e-8539.16Putative prokaryotic DNA topoisomerase OS=Schistos... [more]
A0A4S2LVC41.275e-8239.36WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A0X3Q3I09.107e-8234.90Denticleless protein homolog OS=Schistocephalus so... [more]
A0A0X3NXG91.411e-8134.90Denticleless protein homolog OS=Schistocephalus so... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtl1.442e-5730.48denticleless E3 ubiquitin protein ligase homolog (... [more]
dcaf56.430e-924.04DDB1 and CUL4 associated factor 5 [Source:NCBI gen... [more]
rack13.787e-824.00guanine nucleotide-binding protein subunit beta-2-... [more]
ENSAMXT00000032472.19.194e-824.20receptor of activated protein C kinase 1 [Source:N... [more]
ENSAMXT00000047239.11.865e-723.35receptor of activated protein C kinase 1 [Source:N... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtl1.133e-4130.84denticleless E3 ubiquitin protein ligase homolog (... [more]
snrnp401.196e-823.84small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
ENSPMAT00000002506.15.969e-824.36pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
WDR776.851e-829.66WD repeat domain 77 [Source:HGNC Symbol;Acc:HGNC:2... [more]
GNB33.031e-724.66G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PEX77.087e-723.68Peroxisomal signal receptor for peroxisomal matrix... [more]
STE44.159e-625.37G protein beta subunit; forms a dimer with Ste18p ... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440398.044e-6334.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284855.304e-2732.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388185.646e-1025.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397214.906e-925.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320351.447e-633.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtl2.272e-5630.71denticleless E3 ubiquitin protein ligase homolog [... [more]
ENSORLT00000025739.22.457e-1021.43autophagy related 16 like 2 [Source:NCBI gene;Acc:... [more]
rack12.543e-826.03receptor for activated C kinase 1 [Source:NCBI gen... [more]
dcaf52.919e-824.04DDB1 and CUL4 associated factor 5 [Source:NCBI gen... [more]
rack15.292e-825.33receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of Denticleless E3 ubiquitin protein ligase homolog (Drosophila) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070594.10.000e+099.48SMESG000070594.1[more]
SMESG000076568.11.579e-823.68SMESG000076568.1[more]
SMESG000004409.11.179e-622.90SMESG000004409.1[more]
SMESG000018712.13.879e-626.15SMESG000018712.1[more]
SMESG000045329.15.368e-620.72SMESG000045329.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018837 ID=SMED30018837|Name=Denticleless E3 ubiquitin protein ligase homolog (Drosophila)|organism=Schmidtea mediterranea sexual|type=transcript|length=1868bp
AAATTAAAAGTTACTTTCTTCAAATAATATTTAATCAATTTATTTTTAAA
TTAATTCATGACATTTGACTTACTAAATTACTGTATTTCAAATCCGATTA
ATTCAGTTTATAAAAATTTTTTTCAAAGAAAAATTTTTAGTGATTATCGA
CAAAGTATATTAACAAAAAGTATAGTACCCGATTTTTTACTTGAAACCTT
CGAATGTGCAAGAGAAGATAGATTTATTTTATATAATGAAGATTTCGAAG
AATCTCCAGTATATCAATGCCGATTTAGTCCAGAATTTAATTCAAACATA
GTTATGATAGCAAAGGAAGATGGGGGCATAGTTATGATAAATACTGAACT
TAGCGGCTCTCAGGCAATTGTTCAAAATTTCAGAGCGCATAAAAATTGTA
TATTTGATGTTCAATGGATGGGATCCAATCGGATTCTCACGAGTTCCGGA
GATAGGAGCATCAAATATATTGATTTGAATAGAGAAGAGTCGATTTCACA
ATCTACTTGTCACGAAGGTTCAGTGAAATCACTCGCGTTGCGCCCGAGTC
ATCCAAATATGTTTGCTTCGTCATCAAGAGACGGCTCGATTTTATTATGG
GATCTAAATGATAACTCTAAATACAACAAGGAAGACCCAGGAGTGATTTC
TATTTCACCGATTAATCATCTTTTCAATGCTCACCATCCAGACTTTGTAG
TATCTTCTTCAATAAGCAAATCACAAAATAGGAAATTCAATCCTATCCCG
AAATCTGTCACAAGCATTATATTTGTCAATGAAAATGTATTGGCCAGTAG
CGGCTCCGCCGATGGAAAAATAAAACTATGGGACGTCAGAAAGATTTCCA
AAAAGAATCCAGAACCAGTAAAGGTTATTCCCTATTCGGGAAAGTTACAA
AATCCACCAGGATTTACAGATCTGGTTGTCAATCAGGCCGGTACAATGTT
GTTTGCGTATTGCAAGGATGAATTTATTTACCAATATAACCTTGAAAGGC
CAAATTATAAAATACCGGTTTACCAATACACAGGCCATGTCAGTGATTCG
TATTATTTGAAAATGGATCTCAGTCCAGATGAAAAATATCTTGCATGTGG
GAGCAGCTCTTACTCACCATACATTTATCACGTTGGAGTTGTTCCACAGC
AGCCGATGTTACTAAATGGACACAAAGGTGAAGTGACAGTTTGTCGTTGG
TGCCCAGCGAATCAAGGAATTATAATGAGTGTATCAGACGACTGCACTGC
AATGGTGCATCGTATGAAACCCGGGTCGGAGTTCAATGTGTTCTATCGCA
ACCAAGTCATTAAAAGAAGTCATAATTTAGCCCCATTTTCTCTATCATCG
AGGAGCCACCAAGAAACAGTCAATGAGAACAATCAATTTCAGAAAGCACA
GATCCCCCAAGAAATCAAACAGGAAGTGCAATTCAATAAAACAGATCTCG
AGAAACCAATGATAAAATTGACTACACCAAAAACCAAAGATCAATCAATT
ACGTCATTTTTGTCTCCCATGCCAACGTCTGCATCATTCGATACGAATAG
AAAACAATCAGCGAAACCTTTGACAGAAAAAAATATAATTCTCCCAAAAC
AAACAAAAATCGATAGAGGGAAAAGTGTTTTGCTCAAATCCAACAATTCT
AAAAAGACTCCCAAGAAAAGAAGTGCAACAAAGGAAAACGATGAAAATAC
GACAAATCAAGAGAATCTGAAGCGTAGGAAAACGATTTCACAGCCGATTA
TGAAATTTTTAAAATCTGATAATGCTAGACAAATGTAATTTTCATGGACT
TTGACTTGTACATTTTTTAGATTTACTGTTTAAAATAAAACTCGATTTTC
TTTTTTTCTAAAAAAAAA
back to top

protein sequence of SMED30018837-orf-1

>SMED30018837-orf-1 ID=SMED30018837-orf-1|Name=SMED30018837-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=577bp
MTFDLLNYCISNPINSVYKNFFQRKIFSDYRQSILTKSIVPDFLLETFEC
AREDRFILYNEDFEESPVYQCRFSPEFNSNIVMIAKEDGGIVMINTELSG
SQAIVQNFRAHKNCIFDVQWMGSNRILTSSGDRSIKYIDLNREESISQST
CHEGSVKSLALRPSHPNMFASSSRDGSILLWDLNDNSKYNKEDPGVISIS
PINHLFNAHHPDFVVSSSISKSQNRKFNPIPKSVTSIIFVNENVLASSGS
ADGKIKLWDVRKISKKNPEPVKVIPYSGKLQNPPGFTDLVVNQAGTMLFA
YCKDEFIYQYNLERPNYKIPVYQYTGHVSDSYYLKMDLSPDEKYLACGSS
SYSPYIYHVGVVPQQPMLLNGHKGEVTVCRWCPANQGIIMSVSDDCTAMV
HRMKPGSEFNVFYRNQVIKRSHNLAPFSLSSRSHQETVNENNQFQKAQIP
QEIKQEVQFNKTDLEKPMIKLTTPKTKDQSITSFLSPMPTSASFDTNRKQ
SAKPLTEKNIILPKQTKIDRGKSVLLKSNNSKKTPKKRSATKENDENTTN
QENLKRRKTISQPIMKFLKSDNARQM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007095mitotic G2 DNA damage checkpoint
GO:0072425signal transduction involved in G2 DNA damage checkpoint
GO:0055114oxidation-reduction process
GO:0006468protein phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 142..182
e-value: 1.1E-6
score: 38.3
coord: 220..259
e-value: 0.67
score: 18.1
coord: 362..402
e-value: 0.03
score: 23.5
coord: 101..139
e-value: 0.0012
score: 28.1
coord: 317..358
e-value: 22.0
score: 8.5
coord: 267..311
e-value: 350.0
score: 0.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 105..136
e-value: 0.1
score: 13.5
coord: 150..182
e-value: 0.016
score: 16.1
coord: 232..259
e-value: 0.015
score: 16.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 227..261
score: 9.64
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 149..191
score: 11.879
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 281..499
e-value: 7.5E-13
score: 50.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 46..279
e-value: 7.7E-31
score: 109.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 536..553
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 514..562
NoneNo IPR availablePANTHERPTHR22852LETHAL 2 DENTICLELESS PROTEIN RETINOIC ACID-REGULATED NUCLEAR MATRIX-ASSOCIATED PROTEINcoord: 15..551
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 246..260
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 108..191
score: 16.454
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 227..268
score: 9.283
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 66..411