GDT1 family protein

Overview
NameGDT1 family protein
Smed IDSMED30018827
Length (bp)1118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GDT1 family protein (SMED30018827) t-SNE clustered cells

Violin plots show distribution of expression levels for GDT1 family protein (SMED30018827) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GDT1 family protein (SMED30018827) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GDT1 family protein (SMED30018827) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018827

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30018827SMESG000008670.1 dd_Smed_v4_3586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018827SMESG000008670.1 dd_Smed_v4_3586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018827SMESG000008670.1 dd_Smed_v4_3586_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GDT1 family protein vs. Ensembl Human
Match: TMEM165 (transmembrane protein 165 [Source:HGNC Symbol;Acc:HGNC:30760])

HSP 1 Score: 224.942 bits (572), Expect = 1.886e-70
Identity = 141/267 (52.81%), Postives = 171/267 (64.04%), Query Frame = 3
Query:  246 SSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLL--ITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            + + LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLAL  MT LS   G ATTVIPR  TYY+S  LF IFG++M+++GL +  +       E QEE EEVQAEL+K++ EF ++KLL    D ETG  S+  P                      Q+      S +FV++  LTFLAEWGDRSQ+TTIVLAA +D  GV VGGT+GH LCTG+AVI GR IAQKI VR +T IGGI FL FA       P S 
Sbjct:   87 TQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLKMSPD-------EGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGT-SITVP----------------------QKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPDSG 323          
BLAST of GDT1 family protein vs. Ensembl Human
Match: TMEM165 (transmembrane protein 165 [Source:HGNC Symbol;Acc:HGNC:30760])

HSP 1 Score: 114.39 bits (285), Expect = 4.218e-30
Identity = 82/167 (49.10%), Postives = 103/167 (61.68%), Query Frame = 3
Query:  483 LFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLL--ITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTF 977
            LF IFG++M+++GL  K +P      E QEE EEVQAEL+K++ EF ++KLL    D ETG  S+  P                      Q+      S +FV++  LTFLAEWGDRSQ+TTIVLAA +D  GV VGGT+GH LCTG+AVI GR IAQKI VR  +F
Sbjct:    3 LFAIFGIRMLREGL--KMSP-----DEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGT-SITVP----------------------QKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTGSF 139          
BLAST of GDT1 family protein vs. Ensembl Human
Match: TMEM165 (transmembrane protein 165 [Source:HGNC Symbol;Acc:HGNC:30760])

HSP 1 Score: 71.2478 bits (173), Expect = 1.736e-14
Identity = 37/63 (58.73%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  852 AATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            A  +D  GV VGGT+GH LCTG+AVI GR IAQKI VR +T IGGI FL FA       P S 
Sbjct:   66 ARVEDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPDSG 128          
BLAST of GDT1 family protein vs. Ensembl Celegans
Match: Y54F10AL.1 (pep chromosome:WBcel235:III:2487769:2494340:1 gene:WBGene00021847.1 transcript:Y54F10AL.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10AL.1)

HSP 1 Score: 234.572 bits (597), Expect = 5.939e-75
Identity = 144/310 (46.45%), Postives = 191/310 (61.61%), Query Frame = 3
Query:  102 LILIVLQIWTCHSKPDKDNLLKDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHT-FISD 1028
            L+++V  +    S   KD    DVK +   AV +     + +K + K SS  + F HGFLAS  VI++SELGDKT+FIAVIMS+R+ RL V++GAM ALA MTVLSA LG  T VIPR +TYY+S  LF +FGLKM+ +G  +  N         QE YEE QAE+ KRE E    K  + +   GV S                           R +++  S++F+E+F LTF+AEWGDRSQ+TTI+L A +++ GVI GG LGHALCTGIAVI G+ +AQ+I VR +T IGG+ FL+FA+   FI+D
Sbjct:   12 LLILVPHVTVAESDAVKDVDTVDVKLD-ETAVVEKTEEKEAQKEHKKISSEDISFYHGFLASFSVIVVSELGDKTWFIAVIMSMRHSRLTVFSGAMGALALMTVLSACLGWITQVIPRAVTYYLSTALFALFGLKMLHEGWTMSPNE-------GQEGYEEAQAEVAKREGELDAGKFEMLEGGGGVAS-----------------------QSETRKIFLFTSRIFIEAFSLTFVAEWGDRSQLTTIILGARENIAGVIGGGILGHALCTGIAVIGGKIVAQRISVRTVTLIGGVVFLLFALSALFIND 290          
BLAST of GDT1 family protein vs. Ensembl Celegans
Match: Y54F10AL.1 (pep chromosome:WBcel235:III:2487769:2491933:1 gene:WBGene00021847.1 transcript:Y54F10AL.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10AL.1)

HSP 1 Score: 167.548 bits (423), Expect = 1.676e-49
Identity = 113/264 (42.80%), Postives = 151/264 (57.20%), Query Frame = 3
Query:   87 SCIFLLI---LIVLQIWTCHSKPDKDNLLKDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDV 869
            S  FLL+   ++V  +    S   KD    DVK +    V+       Q K + K SS  + F HGFLAS  VI++SELGDKT+FIAVIMS+R+ RL V++GAM ALA MTVLSA LG  T VIPR +TYY+S  LF +FGLKM+ +G  +  N         QE YEE QAE+ KRE E    K  + +   GV S  +                        R +++  S++F+E+F LTF+AEWGDRSQ+TTI+L A +++
Sbjct:    4 SLTFLLVSLLILVPHVTVAESDAVKDVDTVDVKLDETAVVEKTEEKEAQ-KEHKKISSEDISFYHGFLASFSVIVVSELGDKTWFIAVIMSMRHSRLTVFSGAMGALALMTVLSACLGWITQVIPRAVTYYLSTALFALFGLKMLHEGWTMSPNE-------GQEGYEEAQAEVAKREGELDAGKFEMLEGGGGVASQSET-----------------------RKIFLFTSRIFIEAFSLTFVAEWGDRSQLTTIILGARENI 236          
BLAST of GDT1 family protein vs. Ensembl Fly
Match: CG42542 (gene:FBgn0260659 transcript:FBtr0301102)

HSP 1 Score: 223.016 bits (567), Expect = 4.859e-70
Identity = 140/323 (43.34%), Postives = 197/323 (60.99%), Query Frame = 3
Query:   96 FLLILIVLQIWTCHSKPDK-DNLL--------KDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQ--SKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
             +++L    I    ++PD  DN +         DV+ ++N+   D++++ ++ K       ++  FI  F ASI VI+++ELGDKTFFIA IM++R+PRL+V+ GA+ ALA MTVLS A GMA   IP+  TYYIS  LFLIFGLKM+ DG       Y+M P ++QEE EEVQ +LRKRE E  +  +  L+ D E+G              + R  +  +T F            ++  ++F +TFLAEWGDRSQ+TTI+LAA+KDV GVI GG +GH +CTG+AVI GR +A KI VR +T +GGI F+ FA++     P
Sbjct:   30 LMVVLTFGTICAAEAQPDSADNAVIESGIQSNLDVQGDLNRPT-DLSSLAEKPKDAADRPKTKGTFIDAFTASISVILLTELGDKTFFIAAIMAMRHPRLIVFGGAIAALALMTVLSCAFGMAANFIPKIYTYYISTALFLIFGLKMLYDG-------YKMKPTDAQEELEEVQTDLRKREDELDRDVNAALVNDAESG--------------RRRPQKRGATYFTM----------RILAQAFTMTFLAEWGDRSQLTTIILAASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIGFAIYAVAIPP 320          
BLAST of GDT1 family protein vs. Ensembl Fly
Match: CG42542 (gene:FBgn0260659 transcript:FBtr0302324)

HSP 1 Score: 223.016 bits (567), Expect = 4.859e-70
Identity = 140/323 (43.34%), Postives = 197/323 (60.99%), Query Frame = 3
Query:   96 FLLILIVLQIWTCHSKPDK-DNLL--------KDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQ--SKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
             +++L    I    ++PD  DN +         DV+ ++N+   D++++ ++ K       ++  FI  F ASI VI+++ELGDKTFFIA IM++R+PRL+V+ GA+ ALA MTVLS A GMA   IP+  TYYIS  LFLIFGLKM+ DG       Y+M P ++QEE EEVQ +LRKRE E  +  +  L+ D E+G              + R  +  +T F            ++  ++F +TFLAEWGDRSQ+TTI+LAA+KDV GVI GG +GH +CTG+AVI GR +A KI VR +T +GGI F+ FA++     P
Sbjct:   30 LMVVLTFGTICAAEAQPDSADNAVIESGIQSNLDVQGDLNRPT-DLSSLAEKPKDAADRPKTKGTFIDAFTASISVILLTELGDKTFFIAAIMAMRHPRLIVFGGAIAALALMTVLSCAFGMAANFIPKIYTYYISTALFLIFGLKMLYDG-------YKMKPTDAQEELEEVQTDLRKREDELDRDVNAALVNDAESG--------------RRRPQKRGATYFTM----------RILAQAFTMTFLAEWGDRSQLTTIILAASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIGFAIYAVAIPP 320          
BLAST of GDT1 family protein vs. Ensembl Fly
Match: CG42542 (gene:FBgn0260659 transcript:FBtr0301101)

HSP 1 Score: 223.016 bits (567), Expect = 4.859e-70
Identity = 140/323 (43.34%), Postives = 197/323 (60.99%), Query Frame = 3
Query:   96 FLLILIVLQIWTCHSKPDK-DNLL--------KDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQ--SKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
             +++L    I    ++PD  DN +         DV+ ++N+   D++++ ++ K       ++  FI  F ASI VI+++ELGDKTFFIA IM++R+PRL+V+ GA+ ALA MTVLS A GMA   IP+  TYYIS  LFLIFGLKM+ DG       Y+M P ++QEE EEVQ +LRKRE E  +  +  L+ D E+G              + R  +  +T F            ++  ++F +TFLAEWGDRSQ+TTI+LAA+KDV GVI GG +GH +CTG+AVI GR +A KI VR +T +GGI F+ FA++     P
Sbjct:   30 LMVVLTFGTICAAEAQPDSADNAVIESGIQSNLDVQGDLNRPT-DLSSLAEKPKDAADRPKTKGTFIDAFTASISVILLTELGDKTFFIAAIMAMRHPRLIVFGGAIAALALMTVLSCAFGMAANFIPKIYTYYISTALFLIFGLKMLYDG-------YKMKPTDAQEELEEVQTDLRKREDELDRDVNAALVNDAESG--------------RRRPQKRGATYFTM----------RILAQAFTMTFLAEWGDRSQLTTIILAASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIGFAIYAVAIPP 320          
BLAST of GDT1 family protein vs. Ensembl Fly
Match: CG42542 (gene:FBgn0260659 transcript:FBtr0301103)

HSP 1 Score: 124.405 bits (311), Expect = 3.481e-31
Identity = 74/172 (43.02%), Postives = 109/172 (63.37%), Query Frame = 3
Query:   60 KYLIFLK--MKSCIFLLILIVLQIWT---CHSKPDK-DNLL--------KDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIK 533
            ++ ++LK   K  + L +++VL   T     ++PD  DN +         DV+ ++N+   D++++ ++ K       ++  FI  F ASI VI+++ELGDKTFFIA IM++R+PRL+V+ GA+ ALA MTVLS A GMA   IP+  TYYIS  LFLIFGLKM+ DG  +K
Sbjct:   13 RHNVYLKRSAKWHMALALMVVLTFGTICAAEAQPDSADNAVIESGIQSNLDVQGDLNRPT-DLSSLAEKPKDAADRPKTKGTFIDAFTASISVILLTELGDKTFFIAAIMAMRHPRLIVFGGAIAALALMTVLSCAFGMAANFIPKIYTYYISTALFLIFGLKMLYDGYKMK 183          

HSP 2 Score: 115.546 bits (288), Expect = 4.280e-28
Identity = 52/98 (53.06%), Postives = 71/98 (72.45%), Query Frame = 3
Query:  741 RVQRALYVIFS-KVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
            R Q+     F+ ++  ++F +TFLAEWGDRSQ+TTI+LAA+KDV GVI GG +GH +CTG+AVI GR +A KI VR +T +GGI F+ FA++     P
Sbjct:  403 RPQKRGATYFTMRILAQAFTMTFLAEWGDRSQLTTIILAASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIGFAIYAVAIPP 500          
BLAST of GDT1 family protein vs. Ensembl Fly
Match: CG42542 (gene:FBgn0260659 transcript:FBtr0301104)

HSP 1 Score: 124.405 bits (311), Expect = 3.481e-31
Identity = 74/172 (43.02%), Postives = 109/172 (63.37%), Query Frame = 3
Query:   60 KYLIFLK--MKSCIFLLILIVLQIWT---CHSKPDK-DNLL--------KDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIK 533
            ++ ++LK   K  + L +++VL   T     ++PD  DN +         DV+ ++N+   D++++ ++ K       ++  FI  F ASI VI+++ELGDKTFFIA IM++R+PRL+V+ GA+ ALA MTVLS A GMA   IP+  TYYIS  LFLIFGLKM+ DG  +K
Sbjct:   13 RHNVYLKRSAKWHMALALMVVLTFGTICAAEAQPDSADNAVIESGIQSNLDVQGDLNRPT-DLSSLAEKPKDAADRPKTKGTFIDAFTASISVILLTELGDKTFFIAAIMAMRHPRLIVFGGAIAALALMTVLSCAFGMAANFIPKIYTYYISTALFLIFGLKMLYDGYKMK 183          

HSP 2 Score: 115.546 bits (288), Expect = 4.280e-28
Identity = 52/98 (53.06%), Postives = 71/98 (72.45%), Query Frame = 3
Query:  741 RVQRALYVIFS-KVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
            R Q+     F+ ++  ++F +TFLAEWGDRSQ+TTI+LAA+KDV GVI GG +GH +CTG+AVI GR +A KI VR +T +GGI F+ FA++     P
Sbjct:  403 RPQKRGATYFTMRILAQAFTMTFLAEWGDRSQLTTIILAASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIGFAIYAVAIPP 500          
BLAST of GDT1 family protein vs. Ensembl Zebrafish
Match: tmem165 (transmembrane protein 165 [Source:ZFIN;Acc:ZDB-GENE-030131-3222])

HSP 1 Score: 221.861 bits (564), Expect = 1.050e-69
Identity = 143/333 (42.94%), Postives = 188/333 (56.46%), Query Frame = 3
Query:   48 HNSYKYLIFLKMKSCIFLLILIVLQIWTCHSKPDKDNLLKDVKENVNKAVKD--VNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            H   +++ FL       LL +++       ++ +K  + ++    V K   D       + ++ N       LGFIH F A+I VII+SELGDKTFFIA IM++R  RL V AGAMLAL  MT LS   G ATT+IPR  TYYIS  LF IFG++M+++GL +  +       E QEE EEVQAE++K++ E  + KL    P+    +    +P                    QR    + S +F+++  LTFLAEWGDRSQ+ TIVLAA +D  GV VGGTLGH LCTG+AVI GR +AQKI VR +T IGGI FL FA       P S 
Sbjct:    9 HGGGRFICFL------VLLSVVLFSAGVTATQEEKKVINEEQPAEVQKGTTDHAPGPAIRVDEPN----KGNLGFIHAFAAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTIIPRIYTYYISTALFAIFGVRMLREGLRMSPD-------EGQEELEEVQAEIKKKDEELQRYKLANGAPDVEAGTAANMLP--------------------QRKWPSLISPIFIQALTLTFLAEWGDRSQLATIVLAAREDPFGVAVGGTLGHCLCTGLAVIGGRMVAQKISVRTVTIIGGIVFLAFAFSALFIKPDSG 304          
BLAST of GDT1 family protein vs. Ensembl Xenopus
Match: grm1 (glutamate receptor, metabotropic 1 [Source:Xenbase;Acc:XB-GENE-980107])

HSP 1 Score: 123.25 bits (308), Expect = 1.002e-33
Identity = 66/106 (62.26%), Postives = 79/106 (74.53%), Query Frame = 3
Query:  228 KSNIKYSSS-RLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNP 542
             SN + SS+  LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLAL  MT LS   G ATTVIPR  TYY+S  LF IFGL+M+++GL  K +P
Sbjct:   10 SSNTELSSTANLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGLRMLREGL--KMSP 113          
BLAST of GDT1 family protein vs. Ensembl Mouse
Match: Tmem165 (transmembrane protein 165 [Source:MGI Symbol;Acc:MGI:894407])

HSP 1 Score: 209.92 bits (533), Expect = 8.371e-65
Identity = 140/266 (52.63%), Postives = 171/266 (64.29%), Query Frame = 3
Query:  246 SSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLI-TDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            + + LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLALA MT LS   G ATTVIPR  TYY+S  LF IFG++M+++GL +  +       E QEE EEVQAEL+K++ EF ++KLL   D ETG  + +                        Q+      S +FV++  LTFLAEWGDRSQ+TTIVLAA +D  GV VGGT+GH LCTG+AVI GR IAQKI VR +T IGGI FL FA       P S 
Sbjct:   87 AQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLKMSPD-------EGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIP-----------------------QKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPESG 322          
BLAST of GDT1 family protein vs. Ensembl Mouse
Match: Tmem165 (transmembrane protein 165 [Source:MGI Symbol;Acc:MGI:894407])

HSP 1 Score: 56.6102 bits (135), Expect = 6.493e-10
Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = 3
Query:  345 MSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKL 635
            M++R  RL V AGAMLALA MT LS   G ATTVIPR  TYY+S  LF IFG++M+++GL  K +P      E QEE EEVQAEL+K++ EF ++KL
Sbjct:    1 MAMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGL--KMSP-----DEGQEELEEVQAELKKKDEEFQRTKL 90          
BLAST of GDT1 family protein vs. UniProt/SwissProt
Match: sp|Q9HC07|TM165_HUMAN (Transmembrane protein 165 OS=Homo sapiens OX=9606 GN=TMEM165 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 9.056e-70
Identity = 141/267 (52.81%), Postives = 171/267 (64.04%), Query Frame = 3
Query:  246 SSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLL--ITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            + + LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLAL  MT LS   G ATTVIPR  TYY+S  LF IFG++M+++GL +  +       E QEE EEVQAEL+K++ EF ++KLL    D ETG  S+  P                      Q+      S +FV++  LTFLAEWGDRSQ+TTIVLAA +D  GV VGGT+GH LCTG+AVI GR IAQKI VR +T IGGI FL FA       P S 
Sbjct:   87 TQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLKMSPD-------EGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGT-SITVP----------------------QKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPDSG 323          
BLAST of GDT1 family protein vs. UniProt/SwissProt
Match: sp|P52875|TM165_MOUSE (Transmembrane protein 165 OS=Mus musculus OX=10090 GN=Tmem165 PE=1 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 5.855e-64
Identity = 140/266 (52.63%), Postives = 171/266 (64.29%), Query Frame = 3
Query:  246 SSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLI-TDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            + + LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLALA MT LS   G ATTVIPR  TYY+S  LF IFG++M+++GL +  +       E QEE EEVQAEL+K++ EF ++KLL   D ETG  + +                        Q+      S +FV++  LTFLAEWGDRSQ+TTIVLAA +D  GV VGGT+GH LCTG+AVI GR IAQKI VR +T IGGI FL FA       P S 
Sbjct:   87 AQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLKMSPD-------EGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIP-----------------------QKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPESG 322          
BLAST of GDT1 family protein vs. UniProt/SwissProt
Match: sp|Q4V899|TM165_RAT (Transmembrane protein 165 OS=Rattus norvegicus OX=10116 GN=Tmem165 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 8.900e-64
Identity = 140/266 (52.63%), Postives = 171/266 (64.29%), Query Frame = 3
Query:  246 SSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLI-TDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSN 1040
            + + LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLALA MT LS   G ATTVIPR  TYY+S  LF IFG++M+++GL +  +       E QEE EEVQAEL+K++ EF ++KLL   D ETG  + +                        Q+      S +FV++  LTFLAEWGDRSQ+TTIVLAA +D  GV VGGT+GH LCTG+AVI GR IAQKI VR +T IGGI FL FA       P S 
Sbjct:   87 TQANLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLKMSPD-------EGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIP-----------------------QKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPESG 322          
BLAST of GDT1 family protein vs. UniProt/SwissProt
Match: sp|Q10320|YD68_SCHPO (GDT1-like protein C17G8.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.08c PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.376e-40
Identity = 91/283 (32.16%), Postives = 152/283 (53.71%), Query Frame = 3
Query:  174 KENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVI-PRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFS--QSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKF-NRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAV 1010
            K+ V + + DV+ I   E+ +     +   F+   + SI +I   E+GDKTF +A +++  N RL V+AG+  AL  MT+L   LG A  ++ PRKLT  + G LF+IFG+KM+ +   +  +                         EF   ++++    P   ++            + R    + ++  ++ +  +  +FS +F+++F LTF++EWGDRSQ+ TI +AA+ +V GV +G  +GHA CT +AVISG++I+ KI V  + FIGGI F+ F +
Sbjct:   20 KKIVGEGMADVSAIKHPEEVH----PTNRDFLRSLIFSISMIFGCEIGDKTFIVAALLAFENSRLTVFAGSYSALFIMTLLGVLLGHAAPLLFPRKLTDILGGVLFVIFGIKMLMEAKEVMDSK-------------------ESMSDEFQNVRNEIAANGPIDQLLEEGAAPSHYTGHRSRSGHTLMSQLKSKGRNVMATLFSPLFIKAFALTFVSEWGDRSQIATIAMAASDNVYGVFMGANVGHACCTALAVISGKYISTKIKVHKVMFIGGILFIAFGL 279          
BLAST of GDT1 family protein vs. UniProt/SwissProt
Match: sp|P52876|Y615_SYNY3 (GDT1-like protein sll0615 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll0615 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.605e-36
Identity = 90/248 (36.29%), Postives = 124/248 (50.00%), Query Frame = 3
Query:  276 FLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTF 1019
            F A + +I +SELGDKTFFIA+I+++R PR  V  G +  LA+MT+LS  +G   T +P +   Y    LFLIFG K++ D   IK                         E E         D E  + S  K                  K   V R   ++     VESF LTF+AEWGDR+Q+ TI LAA+ +  GV  G  LGH +C  IAV+ G+F+A +I  + +T IGG+ F +FAV ++
Sbjct:    5 FTAGLLLITVSELGDKTFFIAMILAMRYPRRWVLVGVVGGLAAMTILSVLMGQIFTFLPTRYINYAEVALFLIFGTKLLWDARRIKATA-------------------NLEEME---------DAEKAIASGEK------------------KLKIVPRGWGIV-----VESFALTFVAEWGDRTQIATIALAASNNAWGVSAGAILGHTICAVIAVMGGKFVAGRISEKTVTLIGGLLFYLFAVVSW 201          
BLAST of GDT1 family protein vs. TrEMBL
Match: A0A267EAV8 (GDT1 family protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025780g1 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.677e-84
Identity = 159/308 (51.62%), Postives = 207/308 (67.21%), Query Frame = 3
Query:  138 SKPDKDNLLKDVK---ENVNKAVKDVNNIFKQEKS-NIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEF--SQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSNS 1043
            +KP+  + L + K   +N  KA +      K + S  ++ S+SR GFIH F+AS+ VII+SELGDKTFFIA IM++R+ RL+V+AGA+LALA+MT+LSA LG ATTVIPR  TYY+S  LF IFGLKM+++G ++K +          EEYEEVQA+L+KR+ E+  SQ+  +  D ETGV      I SP                  +  +Y   +KV +ESF LTFLAEWGDRSQ+ TI+LAA  DVVGVIVGGTLGHALCTG+AV+ GRFIAQ+I VR +T  GG+ FL+FA+   +  P SNS
Sbjct:   47 TKPEDSSFLHNFKNKIKNAMKANEKAERYLKGDSSATVESSASRFGFIHAFVASLSVIIVSELGDKTFFIAAIMAMRHSRLIVFAGAILALATMTILSAVLGYATTVIPRWFTYYVSSALFAIFGLKMLREGYYMKPDE-------GMEEYEEVQADLKKRDEEYCKSQTASVEQDMETGV------IRSPR-----------------RSIIYSFVNKVLIESFSLTFLAEWGDRSQIATIILAARDDVVGVIVGGTLGHALCTGLAVLGGRFIAQRISVRTVTLCGGVIFLLFAMSALVIGPESNS 324          
BLAST of GDT1 family protein vs. TrEMBL
Match: A0A267G383 (GDT1 family protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031712g1 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.770e-84
Identity = 159/308 (51.62%), Postives = 207/308 (67.21%), Query Frame = 3
Query:  138 SKPDKDNLLKDVK---ENVNKAVKDVNNIFKQEKS-NIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEF--SQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSNS 1043
            +KP+  + L + K   +N  KA +      K + S  ++ S+SR GFIH F+AS+ VII+SELGDKTFFIA IM++R+ RL+V+AGA+LALA+MT+LSA LG ATTVIPR  TYY+S  LF IFGLKM+++G ++K +          EEYEEVQA+L+KR+ E+  SQ+  +  D ETGV      I SP                  +  +Y   +KV +ESF LTFLAEWGDRSQ+ TI+LAA  DVVGVIVGGTLGHALCTG+AV+ GRFIAQ+I VR +T  GG+ FL+FA+   +  P SNS
Sbjct:   47 TKPEDSSFLHNFKNKIKNAMKANEKAERYLKGDSSATVESSASRFGFIHAFVASLSVIIVSELGDKTFFIAAIMAMRHSRLIVFAGAILALATMTILSAVLGYATTVIPRWFTYYVSSALFAIFGLKMLREGYYMKPDE-------GMEEYEEVQADLKKRDEEYCKSQTASVEQDMETGV------IRSPR-----------------RSIIYSFVNKVLIESFSLTFLAEWGDRSQIATIILAARDDVVGVIVGGTLGHALCTGLAVLGGRFIAQRISVRTVTLCGGVIFLLFAMSALVIGPESNS 324          
BLAST of GDT1 family protein vs. TrEMBL
Match: A0A3R7GW60 (GDT1 family protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=TMEM165 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.230e-79
Identity = 134/260 (51.54%), Postives = 171/260 (65.77%), Query Frame = 3
Query:  264 FIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSNS 1043
            F  GF AS+YVIIISELGDKTFFIA IMS+++PR +VYAGAM AL +MTVLSA LG ATTVIPR  T+Y+SG LFL+FG+KM+ D   +                          + E+ + KL +    +  + + K   S           +S+    V+  +  IFS +  E+F+LTFLAEWGDRSQ+TTIVLAATK V GVIVGG LGHA+CTG+AV+ GRF+AQ+IPV+ LT+IGG TFL+F + TF+ DP SNS
Sbjct:   69 FFRGFTASLYVIIISELGDKTFFIAAIMSMQHPRCLVYAGAMCALGTMTVLSAILGYATTVIPRSFTFYLSGVLFLLFGMKMIYDAYQMSPT---------------------DTQDEYEEVKLQLAQSNSTDLEMGKTDSSQ----------LSSTRETVRYTMKRIFSPILAEAFILTFLAEWGDRSQLTTIVLAATKSVSGVIVGGILGHAVCTGLAVLVGRFVAQRIPVKWLTYIGGTTFLLFGIFTFLGDPDSNS 297          
BLAST of GDT1 family protein vs. TrEMBL
Match: A0A2J7PCF2 (GDT1 family protein OS=Cryptotermes secundus OX=105785 GN=TMEM165_3 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.325e-79
Identity = 143/280 (51.07%), Postives = 188/280 (67.14%), Query Frame = 3
Query:  201 DVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQ--SKLLITDPETGVM-SVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
            D+N+  K E+       S LGFIH F+AS+ VII+SELGDKTFFIA IM++R+PRL V+ GA+ AL  MT+LS   G A T+IPR  TYYIS  LF IFGLKM+K+G ++  N        +QEE+EEVQ++LRKRE E+ +  S  L+ DPE+GV+   VKP                       + +  + S++F+++F LTFLAEWGDRSQ+TT++LA  +DV+GV VGG LGHALCTG+AV+ GRFIAQKI VR +T IGG+ FL+FA+     DP
Sbjct:   61 DINSGNKNEQK------SNLGFIHAFIASVSVIIVSELGDKTFFIAAIMAMRHPRLTVFVGAITALGLMTILSVVFGWAATIIPRAYTYYISTALFAIFGLKMLKEGYYMSANE-------AQEEFEEVQSDLRKREDEYEKEASASLVQDPESGVIRKSVKP----------------------AKTILSLISRIFIQAFTLTFLAEWGDRSQLTTMILATREDVIGVTVGGILGHALCTGLAVVGGRFIAQKISVRTVTLIGGVVFLLFAITALFFDP 305          
BLAST of GDT1 family protein vs. TrEMBL
Match: A0A2P8Y7Q0 (GDT1 family protein OS=Blattella germanica OX=6973 GN=TMEM165 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 6.477e-79
Identity = 147/320 (45.94%), Postives = 208/320 (65.00%), Query Frame = 3
Query:   81 MKSCIFLLILIVLQIWTCHSKPDKDNLLKDV-KENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKL--LITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
            +K  +F+L++IVL  +   ++ +K+ +  +V K +   +V+  +   +    N + + S LGFIH F+AS+ VI++SELGDKTFFIA IM++R+PRL V+ GA+ ALA MTVLS A G   TVIPR  TYYIS  LF +FGLKM+K+G ++  N         QEE+EEVQ +LRKR+ E+ +     L+ DPE+G++                      K  +  + +  + S++F+++F LTF+AEWGDRSQ+TTI+L A +DVVGV +GGTLGHALCTG+AV+ GR IAQKI VR +T IGG+ FL+FAV     DP
Sbjct:   13 LKRFVFVLLIIVL--FLSFTEAEKEPIEAEVLKSDDPPSVRGHSERIEINTENGEETKSNLGFIHAFVASLSVIVVSELGDKTFFIAAIMAMRHPRLTVFLGALSALALMTVLSVAFGWIATVIPRVYTYYISTALFALFGLKMLKEGYYMSPNE-------GQEEFEEVQLDLRKRDDEYEKEATTSLVQDPESGIIR---------------------KSAKTAQPILSLISRIFIQAFTLTFVAEWGDRSQLTTILLGAREDVVGVTIGGTLGHALCTGLAVLGGRMIAQKISVRTVTLIGGVVFLVFAVTALFFDP 302          
BLAST of GDT1 family protein vs. Ensembl Cavefish
Match: tmem165 (transmembrane protein 165 [Source:NCBI gene;Acc:103045178])

HSP 1 Score: 227.639 bits (579), Expect = 4.348e-72
Identity = 137/297 (46.13%), Postives = 182/297 (61.28%), Query Frame = 3
Query:  147 DKDNLLKDVKENVNKAV--KDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
            ++  + +D +++V KA   +       Q+++    S + LGFIH F+A+I VII+SELGDKTFFIA IM++R  RL V AGAMLAL  MT LS   G ATT+IPR  TYYIS  LF IFG++M+++GL +  +         QEE EEVQAE++K++ E  + KL    P+    + V  +P                    QR  + + S +F+++  LTFLAEWGDRSQ+ TIVLAA +D  GV VGGTLGH LCTG+AV+ GR +AQKI VR +T IGGI FL FA       P
Sbjct:   34 EEKRVNEDPQQHVEKAATGQPAGPAVSQDET----SKANLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTIIPRIYTYYISTALFAIFGVRMLREGLRMSADE-------GQEELEEVQAEIKKKDEELQRYKLANGAPDVETGAAVTMLP--------------------QRKWHSVISPIFIQALTLTFLAEWGDRSQLATIVLAAREDPFGVAVGGTLGHCLCTGLAVVGGRMVAQKISVRTVTIIGGIVFLAFAFSALFIKP 299          
BLAST of GDT1 family protein vs. Ensembl Yeast
Match: GDT1 (Calcium transporter localized to the cis- and medial-Golgi apparatus; required for protein glycosylation; GFP-fusion protein localizes to the vacuole; TMEM165, a human gene which causes Congenital Disorders of Glycosylation is orthologous and functionally complements the null allele; expression pattern and physical interactions suggest a possible role in ribosome biogenesis; expression reduced in a gcr1 null mutant [Source:SGD;Acc:S000000391])

HSP 1 Score: 133.265 bits (334), Expect = 5.880e-37
Identity = 87/257 (33.85%), Postives = 139/257 (54.09%), Query Frame = 3
Query:  246 SSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGM-ATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKF-NRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAV 1010
            SSS L     FL S+ +I +SE+GDKTF IA +M++R+ R++V++ A  +LA MT+LS  +G  A   +  + T + +G LFL+FG K+  +GL + K+      +   EE   ++   +  +           D E G           A DK      I  K  +R++     +FS V+V+ F++ FL E GDRSQ++ I +A   D   VI G  +GHA+C+G+AV+ G+ +A +I +R +T    + F IFA+
Sbjct:   35 SSSHL---KSFLMSVSMIGLSEIGDKTFLIAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFGYKLTMEGLEMSKDAGVEEEMAEVEEEIAIKDMNQDMD-----------DVEKG--------GDTAYDKQLKNASIGKKIVHRIRELASFMFSPVWVQIFLMVFLGELGDRSQISIIAMATDSDYWYVIAGAVIGHAICSGLAVVGGKLLATRISIRTITLASSLLFFIFAL 269          
BLAST of GDT1 family protein vs. Ensembl Nematostella
Match: EDO28717 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5P3])

HSP 1 Score: 242.662 bits (618), Expect = 2.616e-79
Identity = 145/252 (57.54%), Postives = 179/252 (71.03%), Query Frame = 3
Query:  264 FIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTF 1019
            FIHGF A+I +II+SELGDKTFFIA IMS+R+ RLVV++GAM+AL  MT+LSA LG ATTVIPRK T YIS  LF+ FGLKM+K+G       YEM P E QEE EEVQAEL+K+E+E  + ++   DPETGV+   K                S  F      ++ I S + ++SF LTFLAEWGDRSQ+ TI+L A ++V+GVI+GGTLGH LCTG+AV+ GRFIAQKI VR +T +GGI FLIFAV  F
Sbjct:    1 FIHGFAAAISMIIVSELGDKTFFIAAIMSMRHSRLVVFSGAMMALGFMTILSAVLGYATTVIPRKFTLYISTALFVFFGLKMLKEG-------YEMDPSEGQEELEEVQAELKKKEAELEKQEMATQDPETGVIRGGKK---------------SLSF------VHNICSTILLQSFTLTFLAEWGDRSQLATILLGARENVIGVILGGTLGHGLCTGLAVVGGRFIAQKISVRTVTILGGIVFLIFAVSAF 224          
BLAST of GDT1 family protein vs. Ensembl Medaka
Match: tmem165 (transmembrane protein 165 [Source:NCBI gene;Acc:101162916])

HSP 1 Score: 216.853 bits (551), Expect = 7.703e-68
Identity = 137/299 (45.82%), Postives = 178/299 (59.53%), Query Frame = 3
Query:  192 AVKDVNNIFKQEKSNIKYSSSR-----------------LGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLL--ITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDP 1031
            A+++ +  F++     K S++R                 LGFIH F+AS  VII+SELGDKTFFIA IM++R  RL V  GA+LALA MT LS   G A T+IPR  TYY+S  LF IFG++M+++GL  K +P      E QEE EEVQAE++K++ E  +SKL     D E G                       T     Q   Y + S +F+++F L+FLAEWGDRSQ+TTI+LAA ++  GV VGGT+GH LCTG+AVI GR IAQ+I VR +T IGGI FL FA+      P
Sbjct:   34 AIQEESKTFQEHNQQEKASTARPAEPAVVEDQDGSSKANLGFIHAFVASFSVIIVSELGDKTFFIAAIMAMRYNRLTVLTGAILALAIMTCLSVLFGYAATIIPRIYTYYVSTALFAIFGVRMLREGL--KMSP-----DEGQEELEEVQAEIKKKDEELQRSKLANGTADLEAG-----------------------TGITLPQTKWYSLCSPIFIQAFTLSFLAEWGDRSQLTTIILAARENPFGVAVGGTVGHCLCTGLAVIGGRMIAQRISVRTVTIIGGIVFLAFAISALFIKP 302          
BLAST of GDT1 family protein vs. Planmine SMEST
Match: SMESG000008670.1 (SMESG000008670.1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 311/321 (96.88%), Postives = 312/321 (97.20%), Query Frame = 3
Query:   81 MKSCIFLLILIVLQIWTCHSKPDKDNLLKDVKENVNKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWIKKNPYXXXXXXXXXXXXXXXXXXRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSNS 1043
            MKSCIFLLILIVLQIWTCHSKPDKDNLLKDVKEN+NKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIA IMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKD        YEMSPLESQEEYEEVQAELRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSNS
Sbjct:    1 MKSCIFLLILIVLQIWTCHSKPDKDNLLKDVKENINKAVKDVNNIFKQEKSNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAAIMSIRNPRLVVYAGAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDA-------YEMSPLESQEEYEEVQAELRKRESEFSQSKLLITDPETGVMSVVKPIPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRSQMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFIGGITFLIFAVHTFISDPLSNS 314          
The following BLAST results are available for this feature:
BLAST of GDT1 family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM1651.886e-7052.81transmembrane protein 165 [Source:HGNC Symbol;Acc:... [more]
TMEM1654.218e-3049.10transmembrane protein 165 [Source:HGNC Symbol;Acc:... [more]
TMEM1651.736e-1458.73transmembrane protein 165 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y54F10AL.15.939e-7546.45pep chromosome:WBcel235:III:2487769:2494340:1 gene... [more]
Y54F10AL.11.676e-4942.80pep chromosome:WBcel235:III:2487769:2491933:1 gene... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425424.859e-7043.34gene:FBgn0260659 transcript:FBtr0301102[more]
CG425424.859e-7043.34gene:FBgn0260659 transcript:FBtr0302324[more]
CG425424.859e-7043.34gene:FBgn0260659 transcript:FBtr0301101[more]
CG425423.481e-3143.02gene:FBgn0260659 transcript:FBtr0301103[more]
CG425423.481e-3143.02gene:FBgn0260659 transcript:FBtr0301104[more]
back to top
BLAST of GDT1 family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1651.050e-6942.94transmembrane protein 165 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
grm11.002e-3362.26glutamate receptor, metabotropic 1 [Source:Xenbase... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmem1658.371e-6552.63transmembrane protein 165 [Source:MGI Symbol;Acc:M... [more]
Tmem1656.493e-1056.70transmembrane protein 165 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of GDT1 family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC07|TM165_HUMAN9.056e-7052.81Transmembrane protein 165 OS=Homo sapiens OX=9606 ... [more]
sp|P52875|TM165_MOUSE5.855e-6452.63Transmembrane protein 165 OS=Mus musculus OX=10090... [more]
sp|Q4V899|TM165_RAT8.900e-6452.63Transmembrane protein 165 OS=Rattus norvegicus OX=... [more]
sp|Q10320|YD68_SCHPO2.376e-4032.16GDT1-like protein C17G8.08c OS=Schizosaccharomyces... [more]
sp|P52876|Y615_SYNY31.605e-3636.29GDT1-like protein sll0615 OS=Synechocystis sp. (st... [more]
back to top
BLAST of GDT1 family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EAV81.677e-8451.62GDT1 family protein OS=Macrostomum lignano OX=2823... [more]
A0A267G3831.770e-8451.62GDT1 family protein OS=Macrostomum lignano OX=2823... [more]
A0A3R7GW603.230e-7951.54GDT1 family protein (Fragment) OS=Clonorchis sinen... [more]
A0A2J7PCF26.325e-7951.07GDT1 family protein OS=Cryptotermes secundus OX=10... [more]
A0A2P8Y7Q06.477e-7945.94GDT1 family protein OS=Blattella germanica OX=6973... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1654.348e-7246.13transmembrane protein 165 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GDT1 family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GDT15.880e-3733.85Calcium transporter localized to the cis- and medi... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO287172.616e-7957.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GDT1 family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1657.703e-6845.82transmembrane protein 165 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of GDT1 family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008670.10.000e+096.88SMESG000008670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018827 ID=SMED30018827|Name=GDT1 family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1118bp
TTAAGAACGTATTTAAAAAACATTTTTAATAATATTTCAAATATTTGCAC
AACTCTTATAAATATTTAATTTTTTTAAAGATGAAGTCATGCATTTTTTT
GCTAATATTAATTGTGCTTCAAATTTGGACGTGCCATTCAAAACCCGACA
AAGATAATTTATTAAAGGACGTGAAAGAAAATGTTAACAAAGCTGTAAAG
GATGTTAATAATATTTTCAAACAAGAAAAATCTAATATTAAATATTCAAG
TTCTCGATTAGGATTTATTCATGGGTTTTTAGCTTCAATATATGTAATAA
TTATATCTGAACTCGGTGACAAAACTTTCTTCATTGCAGTAATTATGTCA
ATTAGAAACCCGAGATTAGTAGTTTATGCTGGAGCGATGTTAGCTTTAGC
TTCAATGACAGTATTATCAGCTGCTTTGGGTATGGCAACTACTGTAATTC
CTCGGAAATTAACTTATTATATTTCTGGATTTTTGTTTTTAATATTCGGT
CTTAAAATGATGAAAGATGGCTTGTGGATTAAAAAAAATCCATATGAAAT
GTCTCCATTGGAGTCTCAAGAAGAATATGAGGAAGTTCAAGCGGAGTTAC
GTAAACGCGAAAGTGAATTTTCCCAATCGAAACTATTAATCACTGACCCG
GAGACTGGAGTAATGTCAGTTGTTAAACCCATTCCTTCACCAGCATCAGA
TAAATATCGTGTTACAGAATTTATATCGACGAAATTCAACAGAGTTCAAC
GAGCTTTATATGTGATATTTTCCAAAGTCTTTGTTGAATCATTTGTTTTG
ACGTTTCTAGCGGAATGGGGAGACAGATCTCAAATGACTACAATTGTTTT
GGCAGCTACAAAAGATGTGGTCGGTGTAATTGTTGGTGGAACTCTAGGAC
ACGCCCTTTGCACTGGAATCGCTGTGATATCGGGCCGCTTCATAGCACAG
AAAATCCCCGTGAGAGCACTGACATTTATCGGTGGAATCACATTTCTGAT
ATTTGCTGTTCACACATTTATCTCAGATCCGCTCTCGAACTCTTGATTTG
ATTTGATTTATCTCTGTTATCATATATTTTTAAGTTTAAATTAATAAAAT
TGACTTTTATTGAAACAA
back to top

protein sequence of SMED30018827-orf-1

>SMED30018827-orf-1 ID=SMED30018827-orf-1|Name=SMED30018827-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MKSCIFLLILIVLQIWTCHSKPDKDNLLKDVKENVNKAVKDVNNIFKQEK
SNIKYSSSRLGFIHGFLASIYVIIISELGDKTFFIAVIMSIRNPRLVVYA
GAMLALASMTVLSAALGMATTVIPRKLTYYISGFLFLIFGLKMMKDGLWI
KKNPYEMSPLESQEEYEEVQAELRKRESEFSQSKLLITDPETGVMSVVKP
IPSPASDKYRVTEFISTKFNRVQRALYVIFSKVFVESFVLTFLAEWGDRS
QMTTIVLAATKDVVGVIVGGTLGHALCTGIAVISGRFIAQKIPVRALTFI
GGITFLIFAVHTFISDPLSNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001727Gdt1
Vocabulary: biological process
TermDefinition
GO:0032472Golgi calcium ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 28..48
NoneNo IPR availablePANTHERPTHR12608:SF1TRANSMEMBRANE PROTEIN 165coord: 61..315
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.9
NoneNo IPR availableTMHMMTMhelixcoord: 60..79
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 292..314
NoneNo IPR availableTMHMMTMhelixcoord: 122..141
IPR001727Gdt1 familyPFAMPF01169UPF0016coord: 68..140
e-value: 2.4E-19
score: 69.4
coord: 236..309
e-value: 8.7E-21
score: 74.0
IPR001727Gdt1 familyPANTHERPTHR12608TRANSMEMBRANE PROTEIN HTP-1 RELATEDcoord: 61..315
IPR001727Gdt1 familyPROSITEPS01214UPF0016coord: 77..86