ATP-dependent 6-phosphofructokinase

Overview
NameATP-dependent 6-phosphofructokinase
Smed IDSMED30018823
Length (bp)2788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent 6-phosphofructokinase (SMED30018823) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent 6-phosphofructokinase (SMED30018823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent 6-phosphofructokinase (SMED30018823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent 6-phosphofructokinase (SMED30018823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018823SMESG000029088.1 Contig5520newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018823SMESG000029088.1 Contig5520uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018823SMESG000045085.1 SMESG000045072.1 Contig5520newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018823SMESG000045085.1 SMESG000045072.1 Contig5520uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018823SMESG000029088.1 Contig48346uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018823SMESG000029088.1 Contig48346newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30018823SMESG000029088.1 dd_Smed_v4_1604_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Human
Match: PFKM (phosphofructokinase, muscle [Source:HGNC Symbol;Acc:HGNC:8877])

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 448/751 (59.65%), Postives = 570/751 (75.90%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:  118 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 859          

HSP 2 Score: 120.939 bits (302), Expect = 3.160e-27
Identity = 106/372 (28.49%), Postives = 173/372 (46.51%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LR---------LSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D  ++ TW  V     LGG+++G+ R            K FRE    LR         ++ + VIGG  +       +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:  117 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR-----------CKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGA---DTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 453          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Human
Match: PFKM (phosphofructokinase, muscle [Source:HGNC Symbol;Acc:HGNC:8877])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/751 (59.65%), Postives = 570/751 (75.90%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 120.553 bits (301), Expect = 2.787e-27
Identity = 107/372 (28.76%), Postives = 174/372 (46.77%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LR---------LSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D  ++ TW  V     LGG+++G+ R            K FRE    LR         ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR-----------CKDFREREGRLRAAYNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Human
Match: PFKM (phosphofructokinase, muscle [Source:HGNC Symbol;Acc:HGNC:8877])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/751 (59.65%), Postives = 570/751 (75.90%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 120.553 bits (301), Expect = 2.787e-27
Identity = 107/372 (28.76%), Postives = 174/372 (46.77%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LR---------LSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D  ++ TW  V     LGG+++G+ R            K FRE    LR         ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR-----------CKDFREREGRLRAAYNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Human
Match: PFKM (phosphofructokinase, muscle [Source:HGNC Symbol;Acc:HGNC:8877])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/751 (59.65%), Postives = 570/751 (75.90%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 120.553 bits (301), Expect = 2.787e-27
Identity = 107/372 (28.76%), Postives = 174/372 (46.77%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LR---------LSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D  ++ TW  V     LGG+++G+ R            K FRE    LR         ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR-----------CKDFREREGRLRAAYNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Human
Match: PFKM (phosphofructokinase, muscle [Source:HGNC Symbol;Acc:HGNC:8877])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/751 (59.65%), Postives = 570/751 (75.90%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 120.553 bits (301), Expect = 2.787e-27
Identity = 107/372 (28.76%), Postives = 174/372 (46.77%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LR---------LSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D  ++ TW  V     LGG+++G+ R            K FRE    LR         ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR-----------CKDFREREGRLRAAYNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Celegans
Match: pfk-1.1 (ATP-dependent 6-phosphofructokinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZL8])

HSP 1 Score: 863.988 bits (2231), Expect = 0.000e+0
Identity = 439/801 (54.81%), Postives = 573/801 (71.54%), Query Frame = 2
Query:   98 EKLD---RKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK-RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQI-ENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            E+LD   ++ L R  ++    G EG  I  D FKG+++A+ TSGGDSQGMNSAVR++ RM IYCG  V+ I EGY+G+ +GG  I EATW  VS I+Q GGT+IGSAR  +F+TREG L AA NLI+R I  LV IGGDGSLTGAN FRLEW  L++EL++  R+T    +K  ++ IVG+VGSIDNDFCGTDMTIGTDSAL RII + DA+ +TAQSHQR F++EVMGRHCGYLALVAALASEA++ FIPE P   +W   LC KL   R  GQR+NII+V+EGAID +   IT++ +K  +  +L  DTRVT+LGHVQRGG PSAFDR+LG RMGAEAV ALM  E    SE CVISIDGN  VRVPLL+CVE+T+ V +AM  K++  AV LRGRSF  NLETY  L+K++  +   +  ++ HK  +A+ NVGAPA G+NA +RS+VR+ +     + G+   F+GL +   +   W+ V  WA  GGS LGT++ LP+E     +A   ++  +  +L++GGFEA+ S   L E R++YPEF IP+ VIP TISNN+PGT  SLG+DT++NEI +++DKIKQSA GTKRRVF++ET GGYCGYLAT+S L+ GAD AYI EE F + DL  DVD + +K+E   +R L++ NE A+ N +TDFV  L+  EGK  F TR N+ GH+QQGG PTPFDRNMGTK+ A+A ++L  Q+ EN   ++ V   S  T  LLGL  R++ FTPV +L  +ETDF+HR+P  QWW+ LRPL+R++A+H+S  ES +I+  +E+
Sbjct:   11 EELDFIRQRALRRFDSIVPTAGREGTEIASDIFKGRTLAIYTSGGDSQGMNSAVRSITRMAIYCGCKVYLIYEGYEGMIEGGDFIKEATWNTVSDIIQQGGTIIGSARSSEFRTREGRLKAATNLINRGIGRLVCIGGDGSLTGANTFRLEWTDLVQELVKNQRVTAAAAKKIPYIQIVGLVGSIDNDFCGTDMTIGTDSALQRIISSIDAVVATAQSHQRAFVIEVMGRHCGYLALVAALASEADFCFIPEWPAPENWRDVLCDKLSQMRSEGQRLNIIIVAEGAIDRDGKAITAEDVKTAVKEKLKYDTRVTILGHVQRGGAPSAFDRLLGCRMGAEAVFALM--EMTEESEPCVISIDGNVMVRVPLLKCVERTQMVQKAMADKDWTTAVMLRGRSFQRNLETYKLLTKMRTVEK--DNLSEGHKFNVAVINVGAPAGGMNAAVRSYVRMALYHQCTVYGIEDSFEGLANGSFKQFKWSDVTNWAMNGGSFLGTQKSLPTEKTMPQLAAQLKKHNIQALLLVGGFEAYHSTIILAENREKYPEFCIPMCVIPCTISNNVPGTMVSLGSDTAINEICQMIDKIKQSATGTKRRVFIVETMGGYCGYLATLSALSSGADNAYIFEEPFTVQDLSDDVDVILSKMEVGAKRYLVVRNEWADKNLTTDFVQNLFDSEGKKNFTTRVNVLGHVQQGGSPTPFDRNMGTKLAARALEFLLIQLKENLTADNKVIAKSAHTATLLGLKGRKVVFTPVQDL-KKETDFEHRLPSEQWWMALRPLLRVLARHRSTVESSAILESVEE 806          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Celegans
Match: pfk-1.2 (ATP-dependent 6-phosphofructokinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27483])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 316/764 (41.36%), Postives = 454/764 (59.42%), Query Frame = 2
Query:  188 KGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSE--------ACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETY-----IKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIED-NVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAK 2437
            K   + VLTSGGDSQGMN+AVR+VVR  I  G   + I+EGY GL +G  NI  A WA V+ +  LGG++IG++RC +F+T +G   AA  + D+ I +L+VIGGDGSL GA   + EW    +EL  + +IT+    +   L++ G+VGSIDND   +D +IG+D+ALHRI EA D +  TAQSHQR F++EVMGRHCGYLAL AA+A EA++VF PE+PP   W  +LC +L   R  G+R N+I++ EG  +     I   Q+K  I ++L ++ R+  LGH+QRGG PS  DR++G+RMG EAV  ++  +              A V+ + G+   R  L R + +T    E +  ++ + A +LRG  F +  +TY     I LS   P +T         K  A+ ++G+P  G+NA   SF R+    G ++IG+  G+ GL + D + LTW  V+GWA  GGSMLGT+R LPSE+  D++A+      + G+++IGGF AF S   L + R EY    IPI+VIPATISNN PGT  SLG DT+LNEI R VD I Q+A+G+K +V +IET G   G+LATM+ L+ G+  A I + E    DL K     + +++  N+++ L++ +E A+    +  V +++ +  K  +  R    G+ Q GG P+ FDR MG +MG +A     E I N      VK    D  C++GL    + + PV  L  ++  F+H +P N WWL+L PL+  M K
Sbjct:    9 KDHGVGVLTSGGDSQGMNAAVRSVVRETIRQGHRCYLIREGYNGLING--NIELAKWAHVANVTHLGGSMIGTSRCDEFRTTDGRKKAAAIMFDKRIFHLIVIGGDGSLMGAQKLKEEWGRFGEELFAEGKITEEVANEGRELHLAGIVGSIDNDCIESDKSIGSDTALHRICEAIDGLVMTAQSHQRVFVVEVMGRHCGYLALTAAIAVEADYVFYPEIPPDEKWPEQLCHQLGSVRKMGKRQNVIILGEGVTNSKGQRIDVRQVKEEIETRLQLEVRIATLGHLQRGGAPSFLDRLIGLRMGYEAVQEVLKGKEEKEGAVVTGQKTIAKVMCLRGHNIQRNELSRVIRQTETANEEIMQRHSDLACRLRGFGFLDK-QTYLNFVSIPLSTTMPSRT---------KTFAVVHIGSPCAGMNAATYSFTRMANHSGIQVIGIKHGWDGLKNKDVKLLTWANVQGWAQFGGSMLGTKRQLPSEM--DLIAEGLNSNNVDGLVIIGGFMAFESALILQQNRSEYTCLSIPIVVIPATISNNCPGTCMSLGVDTALNEICRQVDNISQNAIGSKNKVMIIETMGSRSGFLATMTALSTGSQFALIRQVETNEKDLEKLAIETKERLDSGNLEKFLLIRSEGASDEIYSPDVKKIFDKVMKNKYGVRITNLGYSQLGGHPSCFDRQMGIRMGVRA----FEGIVNP-----VKMGDRDC-CVIGLRGSSLRYVPVQGLG-KKVCFEHGVPHNMWWLDLHPLVEAMTK 747          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Fly
Match: Pfk (gene:FBgn0003071 transcript:FBtr0088422)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 473/777 (60.88%), Postives = 590/777 (75.93%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK--RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG-VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            +++ +   K K +AV TSGGDSQGMN+AVRA VRM IY G  V+FI+EGYQG+ DGG  I EA WA VS I+  GGT+IGSARC DF+ R+G L AA NLI R I NLVVIGGDGSLTGAN FR EW+SLL EL++   IT  Q EK + L+IVG+VGSIDNDFCGTDMTIGTD+ALHRIIEA DAISSTA SHQR FIMEVMGRHCGYLALV  LA EA+++FIPEMPP +DW  +LC +L   R  GQR+NI++V+EGA+D   +PIT++ +K +I  +L  D R+TVLGHVQRGGNPSAFDRIL  RMGAEA LALM+A    +S   VIS+DGNQ VRVPL+ CVE+T+AV +AM  K + +AVKLRGRSF  NLETY  L++L+PPK   +   +  +  R+A+ ++GAPACG+NA +RSFVR  I +G  + G++ G +GLI  +  +L W+ V GW G GG+ LGT+R LP E  F  +A   +E ++ G+L+IGGFE++ +  ++ ++R  YP+F IPI+VIP+TISNN+PGT+FSLG DT LNEIT I D+I+QSA GTKRRVFVIET GGYCGYLAT++GLAGGADAAYI+EE+F I DL++DV HM +K+ + V RGLIL NEKA+ NYSTDF+YRLYSEEGKG+F  R NI GH+QQGG PTPFDRNMGTKM AK  DWL+ QI+ + + +G V   S DT  LLG+  RQ  F+P+ +L I ET+F  RIP  QWWL LRPL+RI+AKH S YE E +   +E+
Sbjct:    8 RFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRMGAEATLALMEATK--DSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLP-EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL-IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE 780          

HSP 2 Score: 125.561 bits (314), Expect = 4.132e-29
Identity = 110/342 (32.16%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNA-AKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP----ITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
             +R L T +     +P  E    D    +G  +AV+  G  + GMN+AVR+ VR  IY G  V+ I +G +GL  G  N+ E  W+DVSG +  GG  +G+ R +     EG     A  L +  I  L++IGG  S   A              +   R    Q   C  + IV +  +I N+  GT+ ++G D+ L+ I E CD I  +AQ + +R F++E MG +CGYLA +A LA  A+  +I E   S+    +    +      G    +IL +E A +         + S++ K L T ++NI      LGH+Q+GG+P+ FDR +G +M A+ V
Sbjct:  380 FERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAG--NVRELGWSDVSGWVGQGGAYLGTKRTLP----EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQ------------IADQRDNYPQF--C--IPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNI------LGHMQQGGSPTPFDRNMGTKMAAKCV 693          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Fly
Match: Pfk (gene:FBgn0003071 transcript:FBtr0088420)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 474/770 (61.56%), Postives = 587/770 (76.23%), Query Frame = 2
Query:  185 FKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK--RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG-VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            FK K +AV TSGGDSQGMN+AVRA VRM IY G  V+FI+EGYQG+ DGG  I EA WA VS I+  GGT+IGSARC DF+ R+G L AA NLI R I NLVVIGGDGSLTGAN FR EW+SLL EL++   IT  Q EK + L+IVG+VGSIDNDFCGTDMTIGTD+ALHRIIEA DAISSTA SHQR FIMEVMGRHCGYLALV  LA EA+++FIPEMPP +DW  +LC +L   R  GQR+NI++V+EGA+D   +PIT++ +K +I  +L  D R+TVLGHVQRGGNPSAFDRIL  RMGAEA LALM+A    +S   VIS+DGNQ VRVPL+ CVE+T+AV +AM  K + +AVKLRGRSF  NLETY  L++L+PPK   +   +  +  R+A+ ++GAPACG+NA +RSFVR  I +G  + G++ G +GLI  +  +L W+ V GW G GG+ LGT+R LP E  F  +A   +E ++ G+L+IGGFE++ +  ++ ++R  YP+F IPI+VIP+TISNN+PGT+FSLG DT LNEIT I D+I+QSA GTKRRVFVIET GGYCGYLAT++GLAGGADAAYI+EE+F I DL++DV HM +K+ + V RGLIL NEKA+ NYSTDF+YRLYSEEGKG+F  R NI GH+QQGG PTPFDRNMGTKM AK  DWL+ QI+ + + +G V   S DT  LLG+  RQ  F+P+ +L I ET+F  RIP  QWWL LRPL+RI+AKH S YE E +   +E+
Sbjct:  177 FKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRMGAEATLALMEATK--DSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLP-EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL-IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE 942          

HSP 2 Score: 125.946 bits (315), Expect = 4.079e-29
Identity = 110/342 (32.16%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNA-AKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP----ITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
             +R L T +     +P  E    D    +G  +AV+  G  + GMN+AVR+ VR  IY G  V+ I +G +GL  G  N+ E  W+DVSG +  GG  +G+ R +     EG     A  L +  I  L++IGG  S   A              +   R    Q   C  + IV +  +I N+  GT+ ++G D+ L+ I E CD I  +AQ + +R F++E MG +CGYLA +A LA  A+  +I E   S+    +    +      G    +IL +E A +         + S++ K L T ++NI      LGH+Q+GG+P+ FDR +G +M A+ V
Sbjct:  542 FERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAG--NVRELGWSDVSGWVGQGGAYLGTKRTLP----EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQ------------IADQRDNYPQF--C--IPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNI------LGHMQQGGSPTPFDRNMGTKMAAKCV 855          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Fly
Match: Pfk (gene:FBgn0003071 transcript:FBtr0304925)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 471/770 (61.17%), Postives = 586/770 (76.10%), Query Frame = 2
Query:  185 FKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK--RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG-VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            FK K +AV TSGGDSQGMN+AVRA VRM IY G  V+FI+EGYQG+ DGG  I EA WA VS I+  GGT+IGSARC DF+ R+G L AA NLI R I NLVVIGGDGSLTGAN FR EW+SLL EL++   IT  Q EK + L+IVG+VGSIDNDFCGTDMTIGTD+ALHRIIEA DAISSTA SHQR FIMEVMGRHCGYL++VA + SEA++VF+PE PP  DW  +L  KL+  R  GQR+NI++V+EGA+D   +PIT++ +K +I  +L  D R+TVLGHVQRGGNPSAFDRIL  RMGAEA LALM+A    +S   VIS+DGNQ VRVPL+ CVE+T+AV +AM  K + +AVKLRGRSF  NLETY  L++L+PPK   +   +  +  R+A+ ++GAPACG+NA +RSFVR  I +G  + G++ G +GLI  +  +L W+ V GW G GG+ LGT+R LP E  F  +A   +E ++ G+L+IGGFE++ +  ++ ++R  YP+F IPI+VIP+TISNN+PGT+FSLG DT LNEIT I D+I+QSA GTKRRVFVIET GGYCGYLAT++GLAGGADAAYI+EE+F I DL++DV HM +K+ + V RGLIL NEKA+ NYSTDF+YRLYSEEGKG+F  R NI GH+QQGG PTPFDRNMGTKM AK  DWL+ QI+ + + +G V   S DT  LLG+  RQ  F+P+ +L I ET+F  RIP  QWWL LRPL+RI+AKH S YE E +   +E+
Sbjct:  177 FKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLSVVAGIISEADYVFLPESPPQADWPDRLVLKLEQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRMGAEATLALMEATK--DSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLP-EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL-IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE 942          

HSP 2 Score: 125.946 bits (315), Expect = 4.009e-29
Identity = 110/342 (32.16%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNA-AKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP----ITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
             +R L T +     +P  E    D    +G  +AV+  G  + GMN+AVR+ VR  IY G  V+ I +G +GL  G  N+ E  W+DVSG +  GG  +G+ R +     EG     A  L +  I  L++IGG  S   A              +   R    Q   C  + IV +  +I N+  GT+ ++G D+ L+ I E CD I  +AQ + +R F++E MG +CGYLA +A LA  A+  +I E   S+    +    +      G    +IL +E A +         + S++ K L T ++NI      LGH+Q+GG+P+ FDR +G +M A+ V
Sbjct:  542 FERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAG--NVRELGWSDVSGWVGQGGAYLGTKRTLP----EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQ------------IADQRDNYPQF--C--IPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNI------LGHMQQGGSPTPFDRNMGTKMAAKCV 855          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Fly
Match: Pfk (gene:FBgn0003071 transcript:FBtr0088421)

HSP 1 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 470/777 (60.49%), Postives = 592/777 (76.19%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK--RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG-VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            +++ +   K K +AV TSGGDSQGMN+AVRA VRM IY G  V+FI+EGYQG+ DGG  I EA WA VS I+  GGT+IGSARC DF+ R+G L AA NLI R I NLVVIGGDGSLTGAN FR EW+SLL EL++   IT  Q EK + L+IVG+VGSIDNDFCGTDMTIGTD+ALHRIIEA DAISSTA SHQR FIMEVMGRHCGYLA+ AA+A+EA+++FIPE P S++W+ ++C KL   R  GQR+NI++V+EGA+D   +PIT++ +K +I  +L  D R+TVLGHVQRGGNPSAFDRIL  RMGAEA LALM+A    +S   VIS+DGNQ VRVPL+ CVE+T+AV +AM  K + +AVKLRGRSF  NLETY  L++L+PPK   +   +  +  R+A+ ++GAPACG+NA +RSFVR  I +G  + G++ G +GLI  +  +L W+ V GW G GG+ LGT+R LP E  F  +A   +E ++ G+L+IGGFE++ +  ++ ++R  YP+F IPI+VIP+TISNN+PGT+FSLG DT LNEIT I D+I+QSA GTKRRVFVIET GGYCGYLAT++GLAGGADAAYI+EE+F I DL++DV HM +K+ + V RGLIL NEKA+ NYSTDF+YRLYSEEGKG+F  R NI GH+QQGG PTPFDRNMGTKM AK  DWL+ QI+ + + +G V   S DT  LLG+  RQ  F+P+ +L I ET+F  RIP  QWWL LRPL+RI+AKH S YE E +   +E+
Sbjct:    8 RFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPVSVNWKDEICVKLHQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRMGAEATLALMEATK--DSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLP-EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL-IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE 780          

HSP 2 Score: 125.946 bits (315), Expect = 3.564e-29
Identity = 110/342 (32.16%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNA-AKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP----ITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
             +R L T +     +P  E    D    +G  +AV+  G  + GMN+AVR+ VR  IY G  V+ I +G +GL  G  N+ E  W+DVSG +  GG  +G+ R +     EG     A  L +  I  L++IGG  S   A              +   R    Q   C  + IV +  +I N+  GT+ ++G D+ L+ I E CD I  +AQ + +R F++E MG +CGYLA +A LA  A+  +I E   S+    +    +      G    +IL +E A +         + S++ K L T ++NI      LGH+Q+GG+P+ FDR +G +M A+ V
Sbjct:  380 FERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAG--NVRELGWSDVSGWVGQGGAYLGTKRTLP----EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQ------------IADQRDNYPQF--C--IPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNI------LGHMQQGGSPTPFDRNMGTKMAAKCV 693          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Fly
Match: Pfk (gene:FBgn0003071 transcript:FBtr0333067)

HSP 1 Score: 852.818 bits (2202), Expect = 0.000e+0
Identity = 446/735 (60.68%), Postives = 559/735 (76.05%), Query Frame = 2
Query:  290 VFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK--RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG-VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            V+FI+EGYQG+ DGG  I EA WA VS I+  GGT+IGSARC DF+ R+G L AA NLI R I NLVVIGGDGSLTGAN FR EW+SLL EL++   IT  Q EK + L+IVG+VGSIDNDFCGTDMTIGTD+ALHRIIEA DAISSTA SHQR FIMEVMGRHCGYL++VA + SEA++VF+PE PP  DW  +L  KL+  R  GQR+NI++V+EGA+D   +PIT++ +K +I  +L  D R+TVLGHVQRGGNPSAFDRIL  RMGAEA LALM+A    +S   VIS+DGNQ VRVPL+ CVE+T+AV +AM  K + +AVKLRGRSF  NLETY  L++L+PPK   +   +  +  R+A+ ++GAPACG+NA +RSFVR  I +G  + G++ G +GLI  +  +L W+ V GW G GG+ LGT+R LP E  F  +A   +E ++ G+L+IGGFE++ +  ++ ++R  YP+F IPI+VIP+TISNN+PGT+FSLG DT LNEIT I D+I+QSA GTKRRVFVIET GGYCGYLAT++GLAGGADAAYI+EE+F I DL++DV HM +K+ + V RGLIL NEKA+ NYSTDF+YRLYSEEGKG+F  R NI GH+QQGG PTPFDRNMGTKM AK  DWL+ QI+ + + +G V   S DT  LLG+  RQ  F+P+ +L I ET+F  RIP  QWWL LRPL+RI+AKH S YE E +   +E+
Sbjct:  184 VYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLSVVAGIISEADYVFLPESPPQADWPDRLVLKLEQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRMGAEATLALMEATK--DSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLP-EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL-IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE 914          

HSP 2 Score: 126.331 bits (316), Expect = 2.871e-29
Identity = 110/342 (32.16%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNA-AKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP----ITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
             +R L T +     +P  E    D    +G  +AV+  G  + GMN+AVR+ VR  IY G  V+ I +G +GL  G  N+ E  W+DVSG +  GG  +G+ R +     EG     A  L +  I  L++IGG  S   A              +   R    Q   C  + IV +  +I N+  GT+ ++G D+ L+ I E CD I  +AQ + +R F++E MG +CGYLA +A LA  A+  +I E   S+    +    +      G    +IL +E A +         + S++ K L T ++NI      LGH+Q+GG+P+ FDR +G +M A+ V
Sbjct:  514 FERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAG--NVRELGWSDVSGWVGQGGAYLGTKRTLP----EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQ------------IADQRDNYPQF--C--IPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNI------LGHMQQGGSPTPFDRNMGTKMAAKCV 827          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Zebrafish
Match: pfkpa (phosphofructokinase, platelet a [Source:ZFIN;Acc:ZDB-GENE-091112-22])

HSP 1 Score: 914.064 bits (2361), Expect = 0.000e+0
Identity = 451/755 (59.74%), Postives = 578/755 (76.56%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            GK+IAVLTSGGD+QGMN+AVRAVVRMGIY G+ V+F+ EGYQG+ DGG NI EATW +VS ++Q+GGTVIGSARC DF+T EG L AA NLI R I NL VIGGDGSLTGAN FR EW+ LL EL++Q  I +   +K S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WV IPEMPP   WE K+CQKL   R   +R+NII+V+EGAID    PITS+ +KNL+ S+L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL+  E   N+ ACV+S+ GNQ+VR+PL+ CV+ T+ V +AM+ K FEEAV+LRGRSF NNL+TY  L+  +P   L +     +  +A+ NVGAPA G+NA +RS VR+ I++G+++  V+ GF+G      +++ W  V GW G GGS+LGT+R LP++   D +A+  R+  ++ +LVIGGFEA++ + EL E R+ Y E  +P++++PAT+SNN+PG+D S+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GADAAYI EE F I DL+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LY+EEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+++++  S     V  N+ D+ CLLG+ +R M F PV +L   ETDF HRIP  QWWL LRPLM+I+AK+++ Y+
Sbjct:   17 GKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEEKMCQKLSAKRAGMKRLNIIIVAEGAIDRKNQPITSEHVKNLVVSRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALL--ETTANTPACVVSLCGNQSVRLPLMECVQMTQEVQKAMDGKRFEEAVQLRGRSFENNLKTYKLLAHRKPESELPHS----NFNVAVLNVGAPAAGMNAAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAK-HIDKIAEQMRKYNINALLVIGGFEAYLGIMELLEARRTYEELCVPMVMVPATVSNNVPGSDLSIGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIFEEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYTEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWITKKLNESYRRGRVFANTEDSACLLGMRRRAMVFQPVVQL-KDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYD 763          

HSP 2 Score: 129.413 bits (324), Expect = 3.224e-30
Identity = 109/366 (29.78%), Postives = 172/366 (46.99%), Query Frame = 2
Query: 1337 KTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEK------------------RQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHE--EEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKA----NVNYSTDFVYRL-YSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            K      T   K IA+   G  A G+NA +R+ VR+ I  G ++  VH G++G++D  D+ ++ TW  V     +GG+++G+ R     +  G    A    +  ++ + VIGG  +        E+                   Q+Y    I  +V   +I N+  GTD ++G D++L+ I  +VD I  +A  + +R FV+E  G +CGYLA +S LA GAD   I E   E G ++  K    + AK     +  +I++ E A    N   +++ V  L  S  G   FDTR  I GH+Q+GG P+ FDR + ++MG +A   L E            T +N   C++ L   Q    P+ E
Sbjct:    7 KRFFENLTGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMV--GSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTA-QSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEE--KMCQKLSAKRAGMKRLNIIIVAEGAIDRKNQPITSEHVKNLVVSRLG---FDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLE------------TTANTPACVVSLCGNQSVRLPLME 352          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Zebrafish
Match: pfkma (phosphofructokinase, muscle a [Source:ZFIN;Acc:ZDB-GENE-040912-135])

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 446/754 (59.15%), Postives = 574/754 (76.13%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDI---VAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            G++IAVLTSGGD+QGMN+AVRA VR+G+Y G+ VFF+ EGYQGL DGG +I  ATW  VS ++QLGGTVIGSARC DF+TREG L AA NL+   I NL VIGGDGSLTGAN FR EW+ LLK+ + + +IT+ + +  SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  D+I++TAQSHQR FI+EVMGRHCGYLALV ALA  A+WVFIPEMPP   WE  LC++L   R+ G R+N+I+V+EGAI+    PIT DQ+K+L+T +L  DTR T+LGHVQRGG PSAFDR+LG RMG EAV+AL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V  AMN   F++AVKLRGRSF NN  TY  L+ ++PP    ++ + I+  +AI NVGAP  G+NA +R+ VR+ I +G+ ++ VH GF+GL     E +TWN V  W G GGS LGT+R LP +   +I   +AKY     +  +++IGGFEAF    E+ + R++Y E  IP+++IPAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLATMSGL+ GADAAYI EE+FGI DL ++V+H+  K++  V+RGLIL NE +N NY+TDF++ LYSEEGKG+FD R N+ GH+QQGG PTPFDRN  TKMGAKA  WL+E++++      +  N+ D+ C+LG+ KR +   P++EL   ETDF+HRIP +QWWL LRP+M+I+AK++
Sbjct:   17 GRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGLVDGGDHIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRLKAAYNLVKLGITNLCVIGGDGSLTGANIFRTEWSDLLKDHVSKGKITKEEAKASSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDSITTTAQSHQRAFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDGWEEHLCRRLTETRNAGSRLNVIIVAEGAINKEGQPITCDQLKDLVTKRLGFDTRATILGHVQRGGTPSAFDRVLGSRMGVEAVMALLEA--TPETPACVVSLTGNQAVRLPLMECVQVTKDVTIAMNEGRFDDAVKLRGRSFENNWNTYKLLAHIRPP----DKKSNIN--VAILNVGAPCAGMNAAVRAAVRIGIIQGHNMLAVHDGFEGLAQAKIEPITWNTVGDWTGKGGSDLGTKRLLPGKYMEEISLNIAKY----NIHALVIIGGFEAFSGGLEMVQGREKYEELCIPMVIIPATVSNNVPGSDFSIGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMSGLSAGADAAYIFEEKFGIRDLERNVEHLVEKMKTTVKRGLILRNENSNSNYTTDFIFNLYSEEGKGVFDCRKNVLGHMQQGGTPTPFDRNFATKMGAKAVLWLTEKLKDCYRHGRIFANTPDSACVLGMRKRGLVLQPLAEL-KEETDFEHRIPKSQWWLKLRPIMKILAKYK 757          

HSP 2 Score: 124.405 bits (311), Expect = 1.241e-28
Identity = 103/369 (27.91%), Postives = 172/369 (46.61%), Query Frame = 2
Query: 1352 EPTQ--IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKA--------NVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            +PT+  + + IA+   G  A G+NA +R+ VR+ +  G ++  VH G++GL+D  D     TW  V     LGG+++G+ R     +  G    A    +L ++ + VIGG  +       N  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  +VD I  +A  + +R F++E  G +CGYLA ++ LA GAD  +I   E   DD  +  +H+  ++ +    G    +I++ E A          +   D V +         FDTR  I GH+Q+GG P+ FDR +G++MG +A   L E    +              C++ LT  Q    P+ E
Sbjct:   10 DPTKMGVGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGLVDGGDHIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRLKAAYNLVKLGITNLCVIGGDGSLTGA---NIFRTEWSDLLKDHVSKGKITKEEAKASSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDSITTTA-QSHQRAFILEVMGRHCGYLALVTALACGADWVFI--PEMPPDDGWE--EHLCRRLTETRNAGSRLNVIIVAEGAINKEGQPITCDQLKDLVTKRLG------FDTRATILGHVQRGGTPSAFDRVLGSRMGVEAVMALLEATPETP------------ACVVSLTGNQAVRLPLME 352          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Zebrafish
Match: pfkpa (phosphofructokinase, platelet a [Source:ZFIN;Acc:ZDB-GENE-091112-22])

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 453/755 (60.00%), Postives = 575/755 (76.16%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            GK+IAVLTSGGD+QGMN+AVRAVVRMGIY G+ V+F+ EGYQG+ DGG NI EATW +VS ++Q+GGTVIGSARC DF+T EG L AA NLI R I NL VIGGDGSLTGAN FR EW+ LL EL++Q  I +   +K S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WV IPEMPP   WE K+CQKL   R  G R+NII+V+EGAID +   ITS  +K+L+ S+L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL+  E   N+ ACV+S+ GNQ+VR+PL+ CV+ T+ V +AM+ K FEEAV+LRGRSF NNL+TY  L+  +P   L +     +  +A+ NVGAPA G+NA +RS VR+ I++G+++  V+ GF+G      +++ W  V GW G GGS+LGT+R LP++   D +A+  R+  ++ +LVIGGFEA   + +LNE R +Y EF IP+ ++PATISNN+PGTD S+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GADAAYI EE F I DL+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LY+EEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+++++  S     V  N+ D+ CLLG+ +R M F PV +L   ETDF HRIP  QWWL LRPLM+I+AK+++ Y+
Sbjct:   17 GKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEEKMCQKLSATRSRGSRLNIIIVAEGAIDRHGKAITSSIVKDLVVSRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALL--ETTANTPACVVSLCGNQSVRLPLMECVQMTQEVQKAMDGKRFEEAVQLRGRSFENNLKTYKLLAHRKPESELPHS----NFNVAVLNVGAPAAGMNAAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAK-HIDKIAEQMRKYNINALLVIGGFEALECLLQLNEARAKYEEFCIPLCMLPATISNNVPGTDLSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIFEEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYTEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWITKKLNESYRRGRVFANTEDSACLLGMRRRAMVFQPVVQL-KDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYD 763          

HSP 2 Score: 126.331 bits (316), Expect = 2.824e-29
Identity = 103/363 (28.37%), Postives = 167/363 (46.01%), Query Frame = 2
Query: 1337 KTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEK------------------RQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHE--EEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSE--EGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            K      T   K IA+   G  A G+NA +R+ VR+ I  G ++  VH G++G++D  D+ ++ TW  V     +GG+++G+ R     +  G    A    +  ++ + VIGG  +        E+                   Q+Y    I  +V   +I N+  GTD ++G D++L+ I  +VD I  +A  + +R FV+E  G +CGYLA +S LA GAD   I E   E G ++  K    + A      +  +I++ E A   +       +  +    +  FDTR  I GH+Q+GG P+ FDR + ++MG +A   L E            T +N   C++ L   Q    P+ E
Sbjct:    7 KRFFENLTGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMV--GSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTA-QSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEE--KMCQKLSATRSRGSRLNIIIVAEGAIDRHGKAITSSIVKDLVVSRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLE------------TTANTPACVVSLCGNQSVRLPLME 352          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Zebrafish
Match: pfkpa (phosphofructokinase, platelet a [Source:ZFIN;Acc:ZDB-GENE-091112-22])

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 450/755 (59.60%), Postives = 577/755 (76.42%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            GK+IAVLTSGGD+QGMN+AVRAVVRMGIY G+ V+F+ EGYQG+ DGG NI EATW +VS ++Q+GGTVIGSARC DF+T EG L AA NLI R I NL VIGGDGSLTGAN FR EW+ LL EL++Q  I +   +K S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WV IPEMPP   WE K+CQKL   R  G R+NII+V+EGAID +   ITS  +K+L+ S+L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL+  E   N+ ACV+S+ GNQ+VR+PL+ CV+ T+ V +AM+ K FEEAV+LRGRSF NNL+TY  L+  +P   L +     +  +A+ NVGAPA G+NA +RS VR+ I++G+++  V+ GF+G      +++ W  V GW G GGS+LGT+R LP++   D +A+  R+  ++ +LVIGGFEA++ + EL E R+ Y E  +P++++PAT+SNN+PG+D S+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GADAAYI EE F I DL+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LY+EEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+++++  S     V  N+ D+ CLLG+ +R M F PV +L   ETDF HRIP  QWWL LRPLM+I+AK+++ Y+
Sbjct:   17 GKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEEKMCQKLSATRSRGSRLNIIIVAEGAIDRHGKAITSSIVKDLVVSRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALL--ETTANTPACVVSLCGNQSVRLPLMECVQMTQEVQKAMDGKRFEEAVQLRGRSFENNLKTYKLLAHRKPESELPHS----NFNVAVLNVGAPAAGMNAAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWADVGGWTGQGGSLLGTKRTLPAK-HIDKIAEQMRKYNINALLVIGGFEAYLGIMELLEARRTYEELCVPMVMVPATVSNNVPGSDLSIGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIFEEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYTEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWITKKLNESYRRGRVFANTEDSACLLGMRRRAMVFQPVVQL-KDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYD 763          

HSP 2 Score: 126.331 bits (316), Expect = 3.274e-29
Identity = 103/363 (28.37%), Postives = 167/363 (46.01%), Query Frame = 2
Query: 1337 KTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEK------------------RQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHE--EEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSE--EGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            K      T   K IA+   G  A G+NA +R+ VR+ I  G ++  VH G++G++D  D+ ++ TW  V     +GG+++G+ R     +  G    A    +  ++ + VIGG  +        E+                   Q+Y    I  +V   +I N+  GTD ++G D++L+ I  +VD I  +A  + +R FV+E  G +CGYLA +S LA GAD   I E   E G ++  K    + A      +  +I++ E A   +       +  +    +  FDTR  I GH+Q+GG P+ FDR + ++MG +A   L E            T +N   C++ L   Q    P+ E
Sbjct:    7 KRFFENLTGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDNIKEATWENVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLAELVQQGLIDEDAAQKYSALHIVGMV--GSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTA-QSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEE--KMCQKLSATRSRGSRLNIIIVAEGAIDRHGKAITSSIVKDLVVSRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLE------------TTANTPACVVSLCGNQSVRLPLME 352          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Zebrafish
Match: pfkpb (phosphofructokinase, platelet b [Source:ZFIN;Acc:ZDB-GENE-070912-634])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 450/764 (58.90%), Postives = 576/764 (75.39%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            KYI+     GK I VLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQG+ DGG NI EA+W  VS ++Q+GGTVIGSARC DF+T EG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL EL++  +I++   +  S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WV IPE PP   WE ++CQKL  NR + +R+NII+V+EGAID N  PIT+D IK+L+ S+L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL++A  +  + ACV+S+ GNQ VRVPL+ CV+ T+ V +AM+ K FEEAVKLRGRSF NNL TY    KL   + +  E       +A+ NVGAPA G+NA +RS VR+ IT+G+ +  V  GF+G      +++ W  V GW G GGS+LGT+R LP++   D +A+  R   ++ +LVIGGFEA++ + EL   R ++ E  +P++++PAT+SNNIPG+D S+GADT++N IT   D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GADAAYI+EE F I DL+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LYSEEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+S++++    +  V  N+ D+ CLLG+ +R + F PV +L   ETDF HRIP  QWWL LRPLM+I+AK+++ Y+
Sbjct:    6 KYIENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVDGGDNIKEASWESVSSMLQVGGTVIGSARCKDFRTHEGRLCAALNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLDELVQSGQISEDAAQTHSALHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPERPPKDGWEEQMCQKLSENRADKKRLNIIIVAEGAIDQNNKPITTDHIKDLVVSRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEA--SPGTPACVVSLCGNQAVRVPLMECVQMTQEVQKAMDEKRFEEAVKLRGRSFENNLNTY----KLLSHRKIDTELPHSSFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHTMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAK-HVDKIAEQMRIHNINALLVIGGFEAYLGLMELQAARSKHAELCVPMVMVPATVSNNIPGSDLSIGADTAINAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKIAAKAMQWISKKLKEFYRDGRVFANTEDSACLLGMRRRALLFQPVVQL-KDETDFVHRIPKEQWWLRLRPLMKILAKYKTSYD 761          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Xenopus
Match: pfkp (phosphofructokinase, platelet [Source:NCBI gene;Acc:394825])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 447/771 (57.98%), Postives = 584/771 (75.75%), Query Frame = 2
Query:  143 AQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            AQP  + K  +    KGK+I VLTSGGD+QGMN+AVRAVVRMGIY  + V+FI EGYQG+ DGG NI E +W  VS I+Q+GGTVIGSARC  F+TREG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL EL++  +I      + +HLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPE PP   WE  +C KL  NR   +R+NII+VSEGAID +   ITSD +K+L+  +L  DTRVT+LGHVQRGG PSAFDRIL  RMG + VLAL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ + F++AV+LRGRSF NNL TY    KL   K  + +  + +  +A+ NVGAPA G+NA +RS VR+ IT+G++++ V+ GF+G      +D+ W  V GW G GGS+LGT+R LP++  FD +A+  R  +++ +LVIGGFEA++ + E+ E R +Y EF IP++++PAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLA M GLA GADAAYI EE F I +L+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LYSEEG+G+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+S++++ +  +  V  N++D++CLLG+ +R + F PV++L   ETDFKHRIP  QWWL +RPLM+I+AK+++ Y+
Sbjct:    2 AQP--DRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMVDGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVDCVLALLEATP--ETPACVVSLCGNQAVRLPLMECVQMTQEVQKAMDERRFDDAVRLRGRSFENNLNTY----KLLSHKKNVADLPKSNFTVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKY-FDKIAEQIRTHKINALLVIGGFEAYLGLMEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEESFDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGRVFANTDDSVCLLGMRRRNLLFQPVTQL-KDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD 762          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Xenopus
Match: pfkp (phosphofructokinase, platelet [Source:NCBI gene;Acc:394825])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 447/772 (57.90%), Postives = 584/772 (75.65%), Query Frame = 2
Query:  140 TAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            TA P +  K  +    KGK+I VLTSGGD+QGMN+AVRAVVRMGIY  + V+FI EGYQG+ DGG NI E +W  VS I+Q+GGTVIGSARC  F+TREG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL EL++  +I      + +HLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPE PP   WE  +C KL  NR   +R+NII+VSEGAID +   ITSD +K+L+  +L  DTRVT+LGHVQRGG PSAFDRIL  RMG + VLAL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ + F++AV+LRGRSF NNL TY    KL   K  + +  + +  +A+ NVGAPA G+NA +RS VR+ IT+G++++ V+ GF+G      +D+ W  V GW G GGS+LGT+R LP++  FD +A+  R  +++ +LVIGGFEA++ + E+ E R +Y EF IP++++PAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLA M GLA GADAAYI EE F I +L+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LYSEEG+G+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+S++++ +  +  V  N++D++CLLG+ +R + F PV++L   ETDFKHRIP  QWWL +RPLM+I+AK+++ Y+
Sbjct:    6 TASP-LNRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMVDGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVDCVLALLEA--TPETPACVVSLCGNQAVRLPLMECVQMTQEVQKAMDERRFDDAVRLRGRSFENNLNTY----KLLSHKKNVADLPKSNFTVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKY-FDKIAEQIRTHKINALLVIGGFEAYLGLMEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEESFDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGRVFANTDDSVCLLGMRRRNLLFQPVTQL-KDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD 768          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Xenopus
Match: pfkp (phosphofructokinase, platelet [Source:NCBI gene;Acc:394825])

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 450/788 (57.11%), Postives = 584/788 (74.11%), Query Frame = 2
Query:  143 AQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSK-----------------LQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            AQP  + K  +    KGK+I VLTSGGD+QGMN+AVRAVVRMGIY  + V+FI EGYQG+ DGG NI E +W  VS I+Q+GGTVIGSARC  F+TREG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL EL++  +I      + +HLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPE PP   WE  +C KL  NR   +R+NII+VSEGAID +   ITSD +K+L+  +L  DTRVT+LGHVQRGG PSAFDRIL  RMG + VLAL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ + F++AV+LRGRSF NNL TY  LS                  L   K  L    Q +  +A+ NVGAPA G+NA +RS VR+ IT+G++++ V+ GF+G      +D+ W  V GW G GGS+LGT+R LP++  FD +A+  R  +++ +LVIGGFEA++ + E+ E R +Y EF IP++++PAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLA M GLA GADAAYI EE F I +L+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LYSEEG+G+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+S++++ +  +  V  N++D++CLLG+ +R + F PV++L   ETDFKHRIP  QWWL +RPLM+I+AK+++ Y+
Sbjct:    2 AQP--DRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMVDGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVDCVLALLEA--TPETPACVVSLCGNQAVRLPLMECVQMTQEVQKAMDERRFDDAVRLRGRSFENNLNTYKLLSHKKNVADLPKVRWAVALGLCIKKKKLPFTLQSNFTVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKY-FDKIAEQIRTHKINALLVIGGFEAYLGLMEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEESFDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGRVFANTDDSVCLLGMRRRNLLFQPVTQL-KDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD 783          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Xenopus
Match: pfkp (phosphofructokinase, platelet [Source:NCBI gene;Acc:394825])

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 450/773 (58.21%), Postives = 580/773 (75.03%), Query Frame = 2
Query:  143 AQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANE--SGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            AQP  + K  +    KGK+I VLTSGGD+QGMN+AVRAVVRMGIY  + V+FI EGYQG+ DGG NI E +W  VS I+Q+GGTVIGSARC  F+TREG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL EL++  +I      + +HLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPE PP   WE  +C KL  NR   +R+NII+VSEGAID +   ITSD +K+L+  +L  DTRVT+LGHVQRGG PSAFDRIL  RMG + VLAL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ + F++AV+LRGRSF NNL TY    KL   K  + +  + +  +A+ NVGAPA G+NA +RS VR+ IT+G++++ V+ GF+G      +D+ W  V GW G GGS+LGT+R LP++  FD +A+  R  +++ +LVIGGFEAF S+ +L E R  Y E+ IP+ V+PATISNN+PGTD SLGADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLA M GLA GADAAYI EE F I +L+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LYSEEG+G+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+S++++ +  +    V  N++D++CLLG+ +R + F PV++L   ETDFKHRIP  QWWL +RPLM+I+AK+++ Y+
Sbjct:    2 AQP--DRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMVDGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVDCVLALLEA--TPETPACVVSLCGNQAVRLPLMECVQMTQEVQKAMDERRFDDAVRLRGRSFENNLNTY----KLLSHKKNVADLPKSNFTVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKY-FDKIAEQIRTHKINALLVIGGFEAFESMVQLAEARGIYEEYCIPMCVLPATISNNVPGTDLSLGADTALNAIMETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEESFDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKVPGRVFANTDDSVCLLGMRRRNLLFQPVTQL-KDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD 764          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Xenopus
Match: ENSXETT00000054028.1 (phosphofructokinase, muscle [Source:NCBI gene;Acc:100216266])

HSP 1 Score: 890.182 bits (2299), Expect = 0.000e+0
Identity = 452/758 (59.63%), Postives = 575/758 (75.86%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ-SLYESE 2461
            GK+IAVLTSGGD+QGMN+AVRAVVR+GIY G+ V+F+ EGYQGL DGG NI EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ + I NL VIGGDGSLTGA+ FR EW++LL +L++  RIT  + +K SHLNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLAL+ ALA  A+WVFIPE PP  +WE  LC++L   R  G R+NII+V+EGAID+N  PITSD +K+L+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ +R+PL+ CV+ T+ V +AM  K F+EA+KLRGRSF NN + Y  L+ ++P        T+    +AI NVGAPA G+NA +RS VR+ I +G+ +  VH GF+GL     E++ W+ V GW G GGS LGT+R LP +  F+ ++       + G+++IGGFEAF    EL E R +Y E  IPI+VIPAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLATM+G A GADAAYI+EE+F I DL+ +V+H+  K++  V+RGLIL NE+ N NYSTDF++ LYSEEGKG+FD R N+ GH+QQGG PTPFDRN GTKMGAKA  W++ +++  +    +  N+ D+ CLLG+ KR + F P+ EL   +TDF+HR+P  QWWL LRP+++I+AK+  SL  SE
Sbjct:   44 GKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGLVDGGDNIKEATWESVSMMLQLGGTVIGSARCQDFRGREGRLKAACNLVKKGITNLCVIGGDGSLTGADTFRTEWSNLLADLVKAGRITADESKKSSHLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITALACGADWVFIPESPPEENWEEHLCRRLSETRGRGSRLNIIIVAEGAIDLNGKPITSDLVKDLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAIRLPLMECVQVTKDVTQAMTEKRFDEALKLRGRSFENNWKVYRTLAHVRP------TATKSGYNLAILNVGAPAAGMNAAVRSTVRIGIIQGHTMFAVHDGFEGLAKGQLEEIGWSGVGGWTGQGGSRLGTKRTLPKKY-FEDISNTISNYNIHGLIIIGGFEAFTGSLELMEGRCKYEELCIPIVVIPATVSNNVPGSDFSIGADTALNTITVTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGFAAGADAAYIYEEQFSIHDLQINVEHLTEKMKTTVKRGLILRNERCNDNYSTDFIFNLYSEEGKGVFDCRKNVLGHMQQGGTPTPFDRNFGTKMGAKAVLWMTGKVKECSRHGRIFANTPDSACLLGMRKRSLVFQPLVEL-KEQTDFEHRLPKEQWWLKLRPILKILAKYNISLDTSE 791          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Mouse
Match: Pfkm (phosphofructokinase, muscle [Source:MGI Symbol;Acc:MGI:97548])

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 447/751 (59.52%), Postives = 571/751 (76.03%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG++I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +       +H  +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +   + ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVS----KGGLHT-VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-NLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 119.398 bits (298), Expect = 4.890e-27
Identity = 102/361 (28.25%), Postives = 170/361 (47.09%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKE--DLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  +   + TW  V     LGG+++G+ R        G    A    +  ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Mouse
Match: Pfkm (phosphofructokinase, muscle [Source:MGI Symbol;Acc:MGI:97548])

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 447/751 (59.52%), Postives = 571/751 (76.03%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG++I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +       +H  +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +   + ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVS----KGGLHT-VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-NLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 119.398 bits (298), Expect = 4.890e-27
Identity = 102/361 (28.25%), Postives = 170/361 (47.09%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKE--DLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  +   + TW  V     LGG+++G+ R        G    A    +  ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Mouse
Match: Pfkm (phosphofructokinase, muscle [Source:MGI Symbol;Acc:MGI:97548])

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 447/751 (59.52%), Postives = 571/751 (76.03%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG++I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +       +H  +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +   + ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVS----KGGLHT-VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-NLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 119.398 bits (298), Expect = 4.890e-27
Identity = 102/361 (28.25%), Postives = 170/361 (47.09%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKE--DLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  +   + TW  V     LGG+++G+ R        G    A    +  ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIVEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Mouse
Match: Pfkp (phosphofructokinase, platelet [Source:MGI Symbol;Acc:MGI:1891833])

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 438/764 (57.33%), Postives = 571/764 (74.74%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            KY++     GK+I VLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQGL DGG NIVEA W  VS I+Q+GGT+IGSARC  F++REG L AA NL    I NL VIGGDGSLTGAN FR EW+ LL+EL     I    ++K S+LN+VGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+AL   A+WVF+PE PP  DWE  +C KL  NR   +R+NII+VSEGAID+   PITS++IK L+   L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAV+AL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ + F+EAVKLRGR F  NL TY +L+   P + ++         +A+ NVGAPA G+NA +RS VR+ I  G+++  ++ GF+G  +   +++ W  V GW G GGS+LGT+R LP +   + +A+      ++ +L+IGGFEA++ + EL   R+++  F +P++++PAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLA M  LA GADAAYI EE F I DL+ +V H+  K++ ++QRGL+L NE  +VNY+TDF+Y+LYSEEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA +W+S +++ S   +G K  S+D+IC+LG+ KR + F PV+EL  + TDF+HRIP  QWWL LRP+M+I+AK+++ Y+
Sbjct:   14 KYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEA--TPETPACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIKLPDEKIVKSNCN----VAVINVGAPAAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKRTLPGKY-LEKIAEQMHSHSINALLIIGGFEAYLGLLELAAAREKHEAFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEPFDIGDLQSNVVHLTEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSQG-TGKKFVSDDSICVLGICKRDLLFQPVAEL-KKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYD 768          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Mouse
Match: Pfkp (phosphofructokinase, platelet [Source:MGI Symbol;Acc:MGI:1891833])

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 439/764 (57.46%), Postives = 564/764 (73.82%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            KY++     GK+I VLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQGL DGG NIVEA W  VS I+Q+GGT+IGSARC  F++REG L AA NL    I NL VIGGDGSLTGAN FR EW+ LL+EL     I    ++K S+LN+VGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+AL   A+WVF+PE PP  DWE  +C KL  NR   +R+NII+VSEGAID+   PITS++IK L+   L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAV+AL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ + F+EAVKLRGR F  NL TY +L+   P + ++         +A+ NVGAPA G+NA +RS VR+ I  G+++  ++ GF+G  +   +++ W  V GW G GGS+LGT+R LP +   + +A+      ++ +L+IGGFE +     L+E R  + EF IPI V+PATISN+IPG+D S+G DT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLA M  LA GADAAYI EE F I DL+ +V H+  K++ ++QRGL+L NE  +VNY+TDF+Y+LYSEEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA +W+S +++ S   +G K  S+D+IC+LG+ KR + F PV+EL  + TDF+HRIP  QWWL LRP+M+I+AK+++ Y+
Sbjct:   14 KYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEA--TPETPACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIKLPDEKIVKSNCN----VAVINVGAPAAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKRTLPGKY-LEKIAEQMHSHSINALLIIGGFEGYHGAIMLSEARNNHEEFCIPICVLPATISNDIPGSDISIGCDTALNVIVETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEPFDIGDLQSNVVHLTEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSQG-TGKKFVSDDSICVLGICKRDLLFQPVAEL-KKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYD 768          
BLAST of ATP-dependent 6-phosphofructokinase vs. UniProt/SwissProt
Match: sp|Q27778|PFKA_SCHMA (ATP-dependent 6-phosphofructokinase OS=Schistosoma mansoni OX=6183 GN=PFK PE=1 SV=1)

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 512/782 (65.47%), Postives = 625/782 (79.92%), Query Frame = 2
Query:  155 MEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKL-QPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLL---GLTKRQMTFTPVSELFIRE-TDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            MEGKY+ +  F G+ IAVLTSGGD+QGMN+AVRAVVRMGIYCG  VFFI+EGYQGL DGG+NI EA+WADVSGI+QLGGT IGSARCMDF+ R G L AA+NL+   I NLVVIGGDGSLTGAN FR EW+SLL+EL+  N+I+    ++   LNIVG+VGSIDNDFCGTDMTIG DSALHRIIEA DAIS+TA SHQRCFI+EVMGRHCGYLALVA++A EA+WVFIPEMPP+ DW  KLC KL++NR++GQRVNII+V+EGAID  C PIT + +KNLI S+L +DTR+TVLGHVQRGG+PSAFDRILG RMGAEAVLALMDA+ + N  +CVIS+DGNQ VRVPL++CV++TR V EAM A +F+ AV+LRG SF NNL TYIKLSK+ QP +++++    +  RI I NVGAPACGINA +R F RL ITKGY++IG+H GF GL+  D  ++ W  VRGW G+GGSMLGTRR  P+ +G D VA  F+EL+LSG+L+IGGFEA+  + EL E R++YPE  IP+ ++PATISNN+PGTDFSLG DT+LNEIT ++DKIKQSA+GTKRRVFV+ET GGYCGYLATMS LAGGADAAYI EE F IDDLR+DV H+RAKI+DNV+RGL+L  +      +++F+++LY++EG+GIFD R N+ GH+QQG  P+PFDR++GTK  +KA DWL EQI  +AN   +  + + T  L      T     F    EL  RE TDF HR+P  +WWL+LRPLMRIMAKH SLYESESIM G ++
Sbjct:    5 MEGKYVARGQFTGECIAVLTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGLVDGGQNIQEASWADVSGILQLGGTKIGSARCMDFRERYGRLKAAENLVKNQITNLVVIGGDGSLTGANLFRAEWSSLLEELVTSNKISAESAKQFHRLNIVGLVGSIDNDFCGTDMTIGADSALHRIIEATDAISTTAHSHQRCFILEVMGRHCGYLALVASMACEADWVFIPEMPPTDDWREKLCHKLRMNREHGQRVNIIMVAEGAIDRACKPITCEIVKNLIVSELQLDTRITVLGHVQRGGSPSAFDRILGSRMGAEAVLALMDADRDPNLPSCVISLDGNQAVRVPLVKCVDRTRQVAEAMKACDFDHAVELRGTSFMNNLATYIKLSKIEQPRQSVMSSENNL--RIGIVNVGAPACGINAVIRGFTRLGITKGYKVIGIHEGFSGLVKGDASEIQWADVRGWVGMGGSMLGTRRDTPNGLGIDKVAAKFKELKLSGLLIIGGFEAYECMIELVEGREKYPELCIPMAMVPATISNNVPGTDFSLGCDTALNEITSVLDKIKQSALGTKRRVFVVETMGGYCGYLATMSALAGGADAAYIFEEPFTIDDLREDVVHLRAKIDDNVKRGLVLRADMLINTITSEFIHQLYAQEGQGIFDCRCNVLGHMQQGDRPSPFDRSLGTKFASKAIDWLDEQI--NANIVQILQSIHQTFMLYINWYCTSSDNLFKYSLEL--REHTDFVHRLPKEEWWLSLRPLMRIMAKHDSLYESESIMAGTDR 780          
BLAST of ATP-dependent 6-phosphofructokinase vs. UniProt/SwissProt
Match: sp|P52034|PFKA_DROME (ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2)

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 473/777 (60.88%), Postives = 590/777 (75.93%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK--RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG-VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            +++ +   K K +AV TSGGDSQGMN+AVRA VRM IY G  V+FI+EGYQG+ DGG  I EA WA VS I+  GGT+IGSARC DF+ R+G L AA NLI R I NLVVIGGDGSLTGAN FR EW+SLL EL++   IT  Q EK + L+IVG+VGSIDNDFCGTDMTIGTD+ALHRIIEA DAISSTA SHQR FIMEVMGRHCGYLALV  LA EA+++FIPEMPP +DW  +LC +L   R  GQR+NI++V+EGA+D   +PIT++ +K +I  +L  D R+TVLGHVQRGGNPSAFDRIL  RMGAEA LALM+A    +S   VIS+DGNQ VRVPL+ CVE+T+AV +AM  K + +AVKLRGRSF  NLETY  L++L+PPK   +   +  +  R+A+ ++GAPACG+NA +RSFVR  I +G  + G++ G +GLI  +  +L W+ V GW G GG+ LGT+R LP E  F  +A   +E ++ G+L+IGGFE++ +  ++ ++R  YP+F IPI+VIP+TISNN+PGT+FSLG DT LNEIT I D+I+QSA GTKRRVFVIET GGYCGYLAT++GLAGGADAAYI+EE+F I DL++DV HM +K+ + V RGLIL NEKA+ NYSTDF+YRLYSEEGKG+F  R NI GH+QQGG PTPFDRNMGTKM AK  DWL+ QI+ + + +G V   S DT  LLG+  RQ  F+P+ +L I ET+F  RIP  QWWL LRPL+RI+AKH S YE E +   +E+
Sbjct:    8 RFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRMGAEATLALMEATK--DSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLP-EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL-IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE 780          

HSP 2 Score: 125.561 bits (314), Expect = 4.142e-28
Identity = 110/342 (32.16%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNA-AKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP----ITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
             +R L T +     +P  E    D    +G  +AV+  G  + GMN+AVR+ VR  IY G  V+ I +G +GL  G  N+ E  W+DVSG +  GG  +G+ R +     EG     A  L +  I  L++IGG  S   A              +   R    Q   C  + IV +  +I N+  GT+ ++G D+ L+ I E CD I  +AQ + +R F++E MG +CGYLA +A LA  A+  +I E   S+    +    +      G    +IL +E A +         + S++ K L T ++NI      LGH+Q+GG+P+ FDR +G +M A+ V
Sbjct:  380 FERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAG--NVRELGWSDVSGWVGQGGAYLGTKRTLP----EGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQ------------IADQRDNYPQF--C--IPIVVIPSTISNNVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNI------LGHMQQGGSPTPFDRNMGTKMAAKCV 693          
BLAST of ATP-dependent 6-phosphofructokinase vs. UniProt/SwissProt
Match: sp|Q0IIG5|PFKAM_BOVIN (ATP-dependent 6-phosphofructokinase, muscle type OS=Bos taurus OX=9913 GN=PFKM PE=2 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 452/751 (60.19%), Postives = 571/751 (76.03%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GIY G+ VFF+ EGYQGL DGG NI EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRIIE  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R+ G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V  AM+ + F+EA+KLRGRSF NN E Y  L+ ++PPK+     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R++Y E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI E+ F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  NS D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   14 GKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDGGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTRAMDERRFDEALKLRGRSFMNNWEVYKLLAHVRPPKSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRMLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEDPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVFQPVTEL-KEQTDFEHRIPKEQWWLKLRPILKILAKYE 755          

HSP 2 Score: 121.709 bits (304), Expect = 6.838e-27
Identity = 103/361 (28.53%), Postives = 171/361 (47.37%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D+  + TW  V     LGG+++G+ R        G    A    +  ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   13 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDGGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 349          
BLAST of ATP-dependent 6-phosphofructokinase vs. UniProt/SwissProt
Match: sp|P52784|PFKAM_CANLF (ATP-dependent 6-phosphofructokinase, muscle type OS=Canis lupus familiaris OX=9615 GN=PFKM PE=2 SV=2)

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 447/751 (59.52%), Postives = 571/751 (76.03%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRIIE  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS++IK L+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AMN + F+EA+KLRGRSF NN E Y  L+ ++PP   +++ +     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEEIKELVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMNDRKFDEAMKLRGRSFMNNWEVYKLLAHIRPP---VSKTSATMHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLIIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTEL-KDQTDFDHRIPKEQWWLKLRPILKILAKYE 758          

HSP 2 Score: 121.324 bits (303), Expect = 9.099e-27
Identity = 104/361 (28.81%), Postives = 170/361 (47.09%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D   + TW  V     LGG+++G+ R        G    A    +  ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SEE K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEEIKELVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. UniProt/SwissProt
Match: sp|P08237|PFKAM_HUMAN (ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 448/751 (59.65%), Postives = 570/751 (75.90%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRAVVR+GI+ G+ VFF+ EGYQGL DGG +I EATW  VS ++QLGGTVIGSARC DF+ REG L AA NL+ R I NL VIGGDGSLTGA+ FR EW+ LL +L +  +IT  +  K S+LNIVG+VGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV +L+  A+WVFIPE PP  DWE  LC++L   R  G R+NII+V+EGAID N  PITS+ IKNL+  +L  DTRVTVLGHVQRGG PSAFDRILG RMG EAV+AL+  E   ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EA+KLRGRSF NN E Y  L+ ++PP +     T     +A+ NVGAPA G+NA +RS VR+ + +G  ++ VH GF+GL     E+  W+ V GW G GGS LGT+R LP +  F+ ++    +  + G+++IGGFEA+    EL E R+++ E  IP +VIPAT+SNN+PG+DFS+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI EE F I DL+ +V+H+  K++  V+RGL+L NEK N NY+TDF++ LYSEEGKGIFD+R N+ GH+QQGG PTPFDRN  TKMGAKA +W+S +I+ S     +  N+ D+ C+LG+ KR + F PV+EL   +TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALL--EGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHT-----VAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKK-SFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAEL-KDQTDFEHRIPKEQWWLKLRPILKILAKYE 756          

HSP 2 Score: 120.553 bits (301), Expect = 1.339e-26
Identity = 107/372 (28.76%), Postives = 174/372 (46.77%), Query Frame = 2
Query: 1364 IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LR---------LSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGI------FDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            I K IA+   G  A G+NA +R+ VR+ I  G  +  VH G++GL+D  D  ++ TW  V     LGG+++G+ R            K FRE    LR         ++ + VIGG     S+   +  R E+ +                     + I+ +  +I N+  GTD ++G D++L+ I  IVD I  +A  + +R FV+E  G +CGYLA ++ L+ GAD  +I E     DD     +H+  ++ +   RG    +I++ E A           + SE+ K +      +DTR  + GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   14 IGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSAR-----------CKDFREREGRLRAAYNLVKRGITNLCVIGGDG---SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTA-QSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPD-DDWE---EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKP----ITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTP------------ACVVSLSGNQAVRLPLME 350          
BLAST of ATP-dependent 6-phosphofructokinase vs. TrEMBL
Match: H2KSW1 (ATP-dependent 6-phosphofructokinase OS=Clonorchis sinensis OX=79923 GN=CLF_110477 PE=3 SV=1)

HSP 1 Score: 1092.03 bits (2823), Expect = 0.000e+0
Identity = 535/789 (67.81%), Postives = 640/789 (81.12%), Query Frame = 2
Query:  125 RRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQ-PPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQI-ENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            RRQT+  QPGMEGKY+ +  F+GK+IAV TSGGD+QGMN+AVRAVVRMGIYCG  VFFI+EGYQG+ DGG+NIVEA WADVS I++ GGTVIGSARC DF+ REG L AA NL+   I NLV IGGDGSLTGAN FR+EW +LL+EL+ +N I + Q  + SHLNIVG+VGSIDNDFCGTDMTIG DSALHRIIEA DAIS+TA SHQRCFI+EVMGRHCGYLALVA++A EA+WVFIPE+PP+ DW+ K+C KL++NRD GQRVNII+V+EGAID +CNPIT + ++ LI S+L  DTR+TVLGHVQRGG PSAFDRILG RMGAEAVLALMDA+ N    ACVIS+DGNQ VRVPL+RCVEKTR V  A+  K+F+ AV+LRG SF  NL TY+KLSKL+ P K+ +N     + R+ I NVGAPACG+NA MRSF RL ITKGY ++G+H GF GL++    ++ WN VRGW  +GGS LGTRR  PSE+G   VA+  +E RL+G+LVIGGFEA+  + EL   R  YPE  IP+++IPATISNN+PGTDFSLG+DT+LNEIT I+DKIKQSA+GTKRRVFV+ET GGYCGYLAT+SGLAGGADAAYI EEEF IDDLR+DV H+RAKI DNVQRGLIL  E AN NY++DF+YRLY+EEGKGIFD R N+ GH+QQG  P+PFDRN+GTK+G+KA DWL EQI  N   +  V T ++++  LLG+ ++  TF+ V +L    TDFKHR+P  +WWLNLRPLMRIMAKH SLYESESIM G+EK
Sbjct:   45 RRQTMV-QPGMEGKYVARGQFRGKAIAVFTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGMVDGGENIVEAGWADVSNIIEKGGTVIGSARCKDFRDREGRLKAAHNLVRHGITNLVAIGGDGSLTGANEFRIEWPTLLEELVAKNLIKKEQATEFSHLNIVGLVGSIDNDFCGTDMTIGADSALHRIIEATDAISTTASSHQRCFILEVMGRHCGYLALVASMACEADWVFIPELPPAEDWKEKMCDKLRLNRDLGQRVNIIMVAEGAIDRHCNPITCEDVRKLIVSELGFDTRITVLGHVQRGGRPSAFDRILGSRMGAEAVLALMDADRNHELPACVISLDGNQAVRVPLMRCVEKTRMVATALKEKDFDRAVELRGPSFMGNLWTYLKLSKLKRPRKSQMN-----NMRLGILNVGAPACGVNAAMRSFARLAITKGYVVVGIHEGFLGLVNGAVSEIHWNTVRGWVSIGGSALGTRRDKPSELGLPTVAEKIKEHRLNGLLVIGGFEAYECMIELASARDLYPELCIPMVMIPATISNNVPGTDFSLGSDTALNEITVILDKIKQSAMGTKRRVFVVETMGGYCGYLATLSGLAGGADAAYIFEEEFTIDDLRQDVVHLRAKIADNVQRGLILRAEYANKNYTSDFIYRLYAEEGKGIFDCRCNVLGHMQQGHEPSPFDRNLGTKLGSKAIDWLDEQIASNLTGDGNVCTTNSNSCVLLGIIRQHATFSEVLQLR-DHTDFKHRLPREEWWLNLRPLMRIMAKHDSLYESESIMAGVEK 826          
BLAST of ATP-dependent 6-phosphofructokinase vs. TrEMBL
Match: A0A3R7FKN4 (ATP-dependent 6-phosphofructokinase (Fragment) OS=Clonorchis sinensis OX=79923 GN=PFK PE=3 SV=1)

HSP 1 Score: 1091.64 bits (2822), Expect = 0.000e+0
Identity = 536/789 (67.93%), Postives = 640/789 (81.12%), Query Frame = 2
Query:  125 RRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQ-PPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQI-ENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            RRQT+  QPGMEGKY+ +  F+GK+IAV TSGGD+QGMN+AVRAVVRMGIYCG  VFFI+EGYQG+ DGG+NIVEA WADVS I++ GGTVIGSARC DF+ REG L AA NL+   I NLV IGGDGSLTGAN FR+EW SLL+EL+ +N I + Q  + SHLNIVG+VGSIDNDFCGTDMTIG DSALHRIIEA DAIS+TA SHQRCFI+EVMGRHCGYLALVA++A EA+WVFIPE+PP+ DW+ K+C KL++NRD GQRVNII+V+EGAID +CNPIT + ++ LI S+L  DTR+TVLGHVQRGG PSAFDRILG RMGAEAVLALMDA+ N    ACVIS+DGNQ VRVPL+RCVEKTR V  A+  K+F+ AV+LRG SF  NL TY+KLSKL+ P K+ +N     + R+ I NVGAPACG+NA MRSF RL ITKGY ++G+H GF GL++    ++ WN VRGW  +GGS LGTRR  PSE+G   VA+  +E RL+G+LVIGGFEA+  + EL   R  YPE  IP+++IPATISNN+PGTDFSLG+DT+LNEIT I+DKIKQSA+GTKRRVFV+ET GGYCGYLAT+SGLAGGADAAYI EEEF IDDLR+DV H+RAKI DNVQRGLIL  E AN NY++DF+YRLY+EEGKGIFD R N+ GH+QQG  P+PFDRN+GTK+G+KA DWL EQI  N   +  V T ++++  LLG+ ++  TF+ V +L    TDFKHR+P  +WWLNLRPLMRIMAKH SLYESESIM G+EK
Sbjct:   72 RRQTMV-QPGMEGKYVARGQFRGKAIAVFTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGMVDGGENIVEAGWADVSNIIEKGGTVIGSARCKDFRDREGRLKAAHNLVRHGITNLVAIGGDGSLTGANEFRIEWPSLLEELVAKNLIKKEQATEFSHLNIVGLVGSIDNDFCGTDMTIGADSALHRIIEATDAISTTASSHQRCFILEVMGRHCGYLALVASMACEADWVFIPELPPAEDWKEKMCDKLRLNRDLGQRVNIIMVAEGAIDRHCNPITCEDVRKLIVSELGFDTRITVLGHVQRGGRPSAFDRILGSRMGAEAVLALMDADRNHELPACVISLDGNQAVRVPLMRCVEKTRMVATALKEKDFDRAVELRGPSFMGNLWTYLKLSKLKRPRKSQMN-----NMRLGILNVGAPACGVNAAMRSFARLAITKGYVVVGIHEGFLGLVNGAVSEIHWNTVRGWVSIGGSALGTRRDKPSELGLPTVAEKIKEHRLNGLLVIGGFEAYECMIELASARDLYPELCIPMVMIPATISNNVPGTDFSLGSDTALNEITVILDKIKQSAMGTKRRVFVVETMGGYCGYLATLSGLAGGADAAYIFEEEFTIDDLRQDVVHLRAKIADNVQRGLILRAEYANKNYTSDFIYRLYAEEGKGIFDCRCNVLGHMQQGHEPSPFDRNLGTKLGSKAIDWLDEQIASNLTGDGNVCTTNSNSCVLLGIIRQHATFSEVLQLR-DHTDFKHRLPREEWWLNLRPLMRIMAKHDSLYESESIMAGVEK 853          
BLAST of ATP-dependent 6-phosphofructokinase vs. TrEMBL
Match: A0A074ZTV8 (ATP-dependent 6-phosphofructokinase OS=Opisthorchis viverrini OX=6198 GN=T265_06027 PE=3 SV=1)

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 535/790 (67.72%), Postives = 638/790 (80.76%), Query Frame = 2
Query:  125 RRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQ-PPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESG--VKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            RRQT+  QPGMEGKY+ +  F+GK+IAV TSGGD+QGMN+AVRAVVRMGIYCG  VFFI+EGYQG+ DGG+NIVEA WADVS I++ GGTVIGSARC DF+ REG L AA NL+   I NLV IGGDGSLTGAN FR+EW SLL+EL+ ++ I Q Q  +CSHLNIVG+VGSIDNDFCGTDMTIG DSALHRIIEA DAI +TA SHQRCFI+EVMGRHCGYLALVA++A EA+WVFIPE+PP+ DW+ K+C KL++NRD GQRVNII+V+EGAID  CNPIT ++++ LI S+L  DTR+TVLGHVQRGG PSAFDRILG RMGAEAVLALMDA+ +    ACVIS+DGNQ VRVPL+RCVEKTR V  A+  K+F+ AV+LRG SF  NL TY+KLSKL+ P K+ +N     + R+ I NVGAPACG+NA MRSF RL ITKGY ++G+H GF GL+     ++ WN VRGW  +GGS LGTRR  PSE+G   VA+  +E RL+G+LVIGGFEA+  + EL   R  YPE  IP+++IPATISNN+PGTDFSLG+DT+LNEIT I+DKIKQSA+GTKRRVFV+ET GGYCGYLAT+SGLAGGADAAYI EEEF IDDLR+DV H+RAKI DNVQRGLIL  E AN NY++DF+YRLY+EEGKGIFD R N+ GH+QQG  P+PFDRN+GTK+G+KA DWL EQI ++    G     NSN  + LLG+ ++  TF+ + +L    TDFKHR+P  +WWLNLRPLMRIMAKH SLYESESIM G+EK
Sbjct:   88 RRQTMV-QPGMEGKYVARGQFRGKAIAVFTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGMVDGGENIVEAGWADVSNIIEKGGTVIGSARCKDFREREGRLKAAHNLVRHGITNLVAIGGDGSLTGANEFRIEWPSLLEELVAKHLINQEQATECSHLNIVGLVGSIDNDFCGTDMTIGADSALHRIIEATDAICTTASSHQRCFILEVMGRHCGYLALVASMACEADWVFIPELPPADDWKEKMCGKLRLNRDLGQRVNIIMVAEGAIDRQCNPITCEEVRKLIVSELGFDTRITVLGHVQRGGRPSAFDRILGSRMGAEAVLALMDADRDHELPACVISLDGNQAVRVPLMRCVEKTRMVATALKEKDFDRAVQLRGPSFMGNLWTYLKLSKLKRPRKSQMN-----NMRLGILNVGAPACGVNAAMRSFARLAITKGYAVLGIHEGFLGLVHGAVSEIHWNTVRGWVSMGGSALGTRRDKPSELGLPTVAEKIKEHRLNGLLVIGGFEAYECMIELASARDLYPELCIPMVMIPATISNNVPGTDFSLGSDTALNEITVILDKIKQSAMGTKRRVFVVETMGGYCGYLATLSGLAGGADAAYIFEEEFTIDDLRQDVVHLRAKIADNVQRGLILRAEFANKNYTSDFIYRLYAEEGKGIFDCRCNVLGHMQQGHEPSPFDRNLGTKLGSKAIDWLDEQIASNLTGDGNVCAINSNSCV-LLGVIRQHATFSEILQLR-DHTDFKHRLPREEWWLNLRPLMRIMAKHDSLYESESIMAGVEK 869          
BLAST of ATP-dependent 6-phosphofructokinase vs. TrEMBL
Match: A0A4S2L9W3 (ATP-dependent 6-phosphofructokinase OS=Opisthorchis felineus OX=147828 GN=CRM22_008900 PE=3 SV=1)

HSP 1 Score: 1088.56 bits (2814), Expect = 0.000e+0
Identity = 530/795 (66.67%), Postives = 639/795 (80.38%), Query Frame = 2
Query:  104 LDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQI-ENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            +D++   RRQT+  QPGMEGKY+ +  F+GK+IAV TSGGD+QGMN+AVRAVVRMGIYCG  VFFI+EGYQG+ DG +NIVEA WADVS I++ GGTVIGSARC DF+ REG L AA NL+   I NLV IGGDGSLTGAN FR+EW SLL+EL+ ++ I Q Q  +CSHL+IVG+VGSIDNDFCGTDMTIG DSALHRIIEA DAI +TA SHQRCFI+EVMGRHCGYLALVA++A EA+WVFIPE+PP+ DW  K+C KL++NRD GQRVNII+V+EGAID  CNPIT ++++ LI S+L  DTR+TVLGHVQRGG PSAFDRILG RMGAEAVLALMDA+ +    ACV+S+DGNQ VRVPL+RCVEKTR V  A+  K+F+ AV+LRG SF  NL TY+KLSKL+ P+    E    + R+ I NVGAPACG+NA MRSF RL ITKGY ++G+H GF GL+     ++ WN VRGW  +GGS LGTRR  PSE+G   VA+  +E RL+G+LVIGGFEA+  + EL   R  YPE  IP+++IPATISNN+PGTDFSLG+DT+LNEIT I+DKIKQSA+GTKRRVFV+ET GGYCGYLAT+SGLAGGADAAYI EE+F IDDLR+DV H+RAKI DNVQRGLIL  E AN NY++DF+++LY+EEGKGIFD R NI GH+QQG  P+PFDRN+GTK+G+KA DWL EQI  N   +  V T ++D+  LLG+ ++  TF+ + +L    TDFKHR+P  +WWLNLRPLMRIMAKH SLYESESIM G+EK
Sbjct:    1 MDQRRFERRQTMV-QPGMEGKYVARGQFRGKAIAVFTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGMVDGEENIVEAGWADVSNIIEKGGTVIGSARCKDFRDREGRLKAAHNLVRHGITNLVAIGGDGSLTGANEFRIEWPSLLEELVTKDLIKQEQATECSHLSIVGLVGSIDNDFCGTDMTIGADSALHRIIEATDAICTTASSHQRCFILEVMGRHCGYLALVASMACEADWVFIPELPPADDWREKMCGKLRLNRDLGQRVNIIMVAEGAIDRQCNPITCEEVRKLIVSELGFDTRITVLGHVQRGGRPSAFDRILGSRMGAEAVLALMDADRDHELPACVVSLDGNQAVRVPLMRCVEKTRMVATALKEKDFDRAVELRGPSFMGNLWTYLKLSKLKRPR----ESQMNNMRLGILNVGAPACGVNAAMRSFARLAITKGYTVLGIHEGFLGLVHGAVSEIHWNTVRGWVSMGGSALGTRRDKPSELGLPTVAEKIKEHRLNGLLVIGGFEAYECMIELASARDLYPELCIPMVMIPATISNNVPGTDFSLGSDTALNEITVILDKIKQSAMGTKRRVFVVETMGGYCGYLATLSGLAGGADAAYIFEEQFTIDDLRQDVVHLRAKIADNVQRGLILRAEYANKNYTSDFIHKLYAEEGKGIFDCRCNILGHMQQGHEPSPFDRNLGTKLGSKAIDWLDEQIASNLTGDGNVCTTNSDSCVLLGVIRQHATFSEILQLR-DHTDFKHRLPREEWWLNLRPLMRIMAKHDSLYESESIMAGVEK 789          
BLAST of ATP-dependent 6-phosphofructokinase vs. TrEMBL
Match: A0A4S2L961 (ATP-dependent 6-phosphofructokinase OS=Opisthorchis felineus OX=147828 GN=CRM22_008900 PE=3 SV=1)

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 529/788 (67.13%), Postives = 635/788 (80.58%), Query Frame = 2
Query:  125 RRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQI-ENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            RRQT+  QPGMEGKY+ +  F+GK+IAV TSGGD+QGMN+AVRAVVRMGIYCG  VFFI+EGYQG+ DG +NIVEA WADVS I++ GGTVIGSARC DF+ REG L AA NL+   I NLV IGGDGSLTGAN FR+EW SLL+EL+ ++ I Q Q  +CSHL+IVG+VGSIDNDFCGTDMTIG DSALHRIIEA DAI +TA SHQRCFI+EVMGRHCGYLALVA++A EA+WVFIPE+PP+ DW  K+C KL++NRD GQRVNII+V+EGAID  CNPIT ++++ LI S+L  DTR+TVLGHVQRGG PSAFDRILG RMGAEAVLALMDA+ +    ACV+S+DGNQ VRVPL+RCVEKTR V  A+  K+F+ AV+LRG SF  NL TY+KLSKL+ P+    E    + R+ I NVGAPACG+NA MRSF RL ITKGY ++G+H GF GL+     ++ WN VRGW  +GGS LGTRR  PSE+G   VA+  +E RL+G+LVIGGFEA+  + EL   R  YPE  IP+++IPATISNN+PGTDFSLG+DT+LNEIT I+DKIKQSA+GTKRRVFV+ET GGYCGYLAT+SGLAGGADAAYI EE+F IDDLR+DV H+RAKI DNVQRGLIL  E AN NY++DF+++LY+EEGKGIFD R NI GH+QQG  P+PFDRN+GTK+G+KA DWL EQI  N   +  V T ++D+  LLG+ ++  TF+ + +L    TDFKHR+P  +WWLNLRPLMRIMAKH SLYESESIM G+EK
Sbjct:   25 RRQTMV-QPGMEGKYVARGQFRGKAIAVFTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGMVDGEENIVEAGWADVSNIIEKGGTVIGSARCKDFRDREGRLKAAHNLVRHGITNLVAIGGDGSLTGANEFRIEWPSLLEELVTKDLIKQEQATECSHLSIVGLVGSIDNDFCGTDMTIGADSALHRIIEATDAICTTASSHQRCFILEVMGRHCGYLALVASMACEADWVFIPELPPADDWREKMCGKLRLNRDLGQRVNIIMVAEGAIDRQCNPITCEEVRKLIVSELGFDTRITVLGHVQRGGRPSAFDRILGSRMGAEAVLALMDADRDHELPACVVSLDGNQAVRVPLMRCVEKTRMVATALKEKDFDRAVELRGPSFMGNLWTYLKLSKLKRPR----ESQMNNMRLGILNVGAPACGVNAAMRSFARLAITKGYTVLGIHEGFLGLVHGAVSEIHWNTVRGWVSMGGSALGTRRDKPSELGLPTVAEKIKEHRLNGLLVIGGFEAYECMIELASARDLYPELCIPMVMIPATISNNVPGTDFSLGSDTALNEITVILDKIKQSAMGTKRRVFVVETMGGYCGYLATLSGLAGGADAAYIFEEQFTIDDLRQDVVHLRAKIADNVQRGLILRAEYANKNYTSDFIHKLYAEEGKGIFDCRCNILGHMQQGHEPSPFDRNLGTKLGSKAIDWLDEQIASNLTGDGNVCTTNSDSCVLLGVIRQHATFSEILQLR-DHTDFKHRLPREEWWLNLRPLMRIMAKHDSLYESESIMAGVEK 806          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Cavefish
Match: pfkma (ATP-dependent 6-phosphofructokinase, muscle type-like [Source:NCBI gene;Acc:103038352])

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 446/758 (58.84%), Postives = 566/758 (74.67%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLS-------GILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            G++IAVLTSGGD+QGMN+AVRA VR+G+Y G+ VFF+ EGYQGL DGG NI  ATW  VS ++QLGGTVIGSARC DF+TREG + AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL +L+ + +IT  + +  SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRI+E  D+I++TAQSHQR FI+EVMGRHCGYLALV ALA  A+WVFIPEMPP   WE  LC++L   R+ G R+N+I+V+EGA+  +  PIT DQIK L++ +L  DTR T+LGHVQRGG PSAFDRILG RMG EAV+AL++A    ++ ACV+S+ GNQ VR+PL+ CV+ T+ V  AM    +++AVKLRGRSF NN  TY  L+ +  P+T  N        +AI NVGAP  G+NA +R+ VR+ I +G+ ++ VH GF+GL     E + WN V GW G GGS+LGT+R LP        AK+  E+ L+        +++IGGFEAF    EL + RQ+Y E  IP++VIPAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLATMSGLA GADAAYI+E++FGI DL  +V+H+  K++  V+RGLIL NE  N NY+TDF++ LYSEEGKGIFD R N+ GH+QQGG PTPFDRN  TKMGAK+  WL+E+++       +  NS D+ C+LG+ KR + F  ++EL   ETDF+HRIP  +WWL LRP+++I+AK++
Sbjct:   17 GRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGLVDGGDNIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRIKAAYNLVKRGITNLCVIGGDGSLTGANLFRTEWSGLLGDLVSKGKITGDEAKSASHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEVVDSITTTAQSHQRAFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDGWEEHLCRRLMETRNRGSRLNVIIVAEGAMGRDGKPITCDQIKELVSKRLGYDTRATILGHVQRGGTPSAFDRILGSRMGVEAVMALLEA--TPDTPACVVSLSGNQAVRLPLMECVQVTKDVTVAMKEGRYDDAVKLRGRSFENNWNTYKLLAHVHLPETKSN------INVAILNVGAPCAGMNAAVRAAVRIGIIQGHNMLAVHDGFEGLAQGKIEPINWNSVGGWTGKGGSVLGTKRVLP--------AKHIEEISLNIAKHNIHALVIIGGFEAFSGGLELVQARQKYEELCIPMVVIPATVSNNVPGSDFSIGADTALNTITSTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMSGLAAGADAAYIYEDKFGIRDLEANVEHLVEKMKTTVKRGLILRNENCNANYTTDFIFNLYSEEGKGIFDCRKNVLGHMQQGGTPTPFDRNFATKMGAKSVLWLTEKLKECYRHGRIFANSADSACVLGMKKRGLMFQALAEL-KEETDFEHRIPKTEWWLKLRPILKILAKYK 757          

HSP 2 Score: 124.02 bits (310), Expect = 1.472e-28
Identity = 103/365 (28.22%), Postives = 176/365 (48.22%), Query Frame = 2
Query: 1352 EPTQ--IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKA----NVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            +PT+  I + IA+   G  A G+NA +R+ VR+ +  G ++  VH G++GL+D  D+    TW  V     LGG+++G+ R     +  G    A    +  ++ + VIGG  +       N  R E+                       + I+ +  +I N+  GTD ++G D++L+ I  +VD I  +A  + +R F++E  G +CGYLA ++ LA GAD  +I   E   DD  +  +H+  ++ +   RG    +I++ E A        + D +  L S+  +  +DTR  I GH+Q+GG P+ FDR +G++MG +A   L E   ++              C++ L+  Q    P+ E
Sbjct:   10 DPTKMGIGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGLVDGGDNIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRIKAAYNLVKRGITNLCVIGGDGSLTGA---NLFRTEWSGLLGDLVSKGKITGDEAKSASHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEVVDSITTTAQ-SHQRAFILEVMGRHCGYLALVTALACGADWVFI--PEMPPDDGWE--EHLCRRLMETRNRGSRLNVIIVAEGAMGRDGKPITCDQIKELVSK--RLGYDTRATILGHVQRGGTPSAFDRILGSRMGVEAVMALLEATPDTP------------ACVVSLSGNQAVRLPLME 352          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Cavefish
Match: pfkpb (ATP-dependent 6-phosphofructokinase, platelet type-like [Source:NCBI gene;Acc:103025406])

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 442/764 (57.85%), Postives = 574/764 (75.13%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            K+ +     GK I VLTSGGD+QGMN+AVRAVVRMGIY  + V+FI EGYQG+ DGG NI EATW  VS ++QLGGTVIGSARC +F+T EG L AA NL+   I NL VIGGDGSLTGAN FR EW+ LL+EL++  +I +      S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WV IPE+PP   WE ++CQKL  NR + +R+NII+++EGAID++  PIT+D +K+L+   L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL++A  + ++ ACV+S+ GNQ +R+PL+ CV+ T+ V +AM+ KNFEEAVKLRGRSF NNL TY  LS  +P     +E ++    +A+ NVGAPA G+NA +RS VR+ IT+G+ +  V  GF+G       ++ W  V GW G GGS+LGT+R LP+    + +A+  R   ++ +LVIGGFEA++ + EL   R ++PE  +P++++P+T+SNNIPG+D S+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLAT+  LA GADAAYI+EE F I DL+ +V+H+  K++  +QRGL+L NE  N N++TDF+Y+LYSEEGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AKA  W+S++++    E  V  N+ D+ CLLG+ +R + F PV+EL   E+DF HRIP  QWWL LRPLM+I+AK+++ Y+
Sbjct:    6 KFFENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVRAKVYFIHEGYQGMVDGGDNIKEATWESVSSMLQLGGTVIGSARCKEFRTHEGRLRAALNLVRLGITNLCVIGGDGSLTGANLFRTEWSGLLEELVQTGQIDEQAAVTHSALHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPELPPEDGWEEQMCQKLSENRADKKRLNIIIIAEGAIDVHNKPITTDYVKDLVVRSLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEA--SPDTPACVVSLRGNQAIRLPLMECVQMTQQVQKAMDEKNFEEAVKLRGRSFENNLNTYKLLSYRKPD----SEVSKSSFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHTMFAVQDGFEGFSKGQINEIKWGDVGGWTGQGGSLLGTKRTLPAN-HLNKIAEQMRIHNINALLVIGGFEAYLGLLELLAARSKHPELCVPMVMVPSTVSNNIPGSDLSIGADTALNAITNTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGALAAGADAAYIYEEPFTIRDLQTNVEHLTEKMKTGIQRGLVLRNESCNENFTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKIAAKAIQWISKKLKEFYVEGRVFANTEDSACLLGMRRRALVFQPVTEL-KEESDFVHRIPKEQWWLKLRPLMKILAKYKTSYD 761          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Cavefish
Match: pfkmb (phosphofructokinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-081114-1])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 441/751 (58.72%), Postives = 564/751 (75.10%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            GK+IAVLTSGGD+QGMN+AVRA VR+GIY G+ V+F+ EGYQGL DGG +I  ATW  VS ++QLGGTVIGSARC DF+T+EG   AA NL+   I NL VIGGDGSLTGAN FR EW+ LL+ LL+  +IT  +  + SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI++TAQSHQR FI+EVMGRHCGYLALV+ALAS A+WVFIPEMPP   WE  LC++L   R  G R+N+I+V+EGA+D +  PIT + IKNL+T +L  DTR T+LGHVQRGG PSAFDRILG RMG EAV+AL++A     + ACV+S+ GNQ VR+PL+ CV+ T+ V +AM    FEEAVKLRG+SF NN  TY  L+ + P +   N        IA+ NVGAP  G+NA +RS VR+ I +G+ ++ +H GF+GL   + E ++W  V  W G GGS LGT+R LP+ +  + ++    +  +  +++IGGFEAF+   EL   R++Y E  IPI+VIPAT+SNN+PG+DFS+GADT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLATM+GLA GADAAYI+EE FGI DL  +V+H+  K++  V+RGLIL NE  N NY+TDF++ LY+EEGKG+FD R N+ GH+QQGG P+PFDRN GTKMGAKA  WL+++++       +  N+ D+ C+LG+ KR + F P+++L    TDF+HRIP  QWWL LRP+++I+AK++
Sbjct:  119 GKAIAVLTSGGDAQGMNAAVRATVRVGIYTGAKVYFVHEGYQGLVDGGDHIRLATWESVSMMLQLGGTVIGSARCKDFRTKEGRTKAACNLVKLGITNLCVIGGDGSLTGANEFRTEWSELLQILLKAGKITAEEARRSSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAITTTAQSHQRAFILEVMGRHCGYLALVSALASGADWVFIPEMPPDDGWEDHLCRRLANQRSLGYRLNVIIVAEGAMDRSGKPITCEMIKNLVTKKLGFDTRATILGHVQRGGTPSAFDRILGSRMGVEAVMALLEA--TPETPACVVSLSGNQAVRLPLMECVQVTKDVTKAMTEGRFEEAVKLRGKSFENNWNTYKLLAHVNPAEVKSN------INIALMNVGAPCSGMNAAVRSAVRIGILQGHHMLAIHDGFEGLAHGNIEPISWAAVGNWTGQGGSNLGTKRSLPASM-MEEISLNIAKFNIHALVIIGGFEAFVGGLELVTGREKYEELCIPIVVIPATVSNNVPGSDFSVGADTALNTITSTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEEPFGIHDLEINVEHLVEKMKTTVKRGLILRNENCNSNYTTDFIFNLYTEEGKGVFDCRKNVLGHMQQGGTPSPFDRNFGTKMGAKAVLWLTDKLKECYRHGRIFANTPDSACVLGMRKRALVFQPLADL-KSNTDFEHRIPKTQWWLKLRPILKILAKYK 859          

HSP 2 Score: 132.494 bits (332), Expect = 4.133e-31
Identity = 107/365 (29.32%), Postives = 177/365 (48.49%), Query Frame = 2
Query: 1352 EPTQ--IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINE----KANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSE 2347
            +PT   + K IA+   G  A G+NA +R+ VR+ I  G ++  VH G++GL+D  D     TW  V     LGG+++G+ R     ++ G    A    +L ++ + VIGG  +       NE R E+ E                     + I+ +  +I N+  GTD ++G D++L+ I  +VD I  +A  + +R F++E  G +CGYLA +S LA GAD  +I   E   DD  +  DH+  ++ +    G    +I++ E    ++    + + +  L ++  K  FDTR  I GH+Q+GG P+ FDR +G++MG +A   L E    +              C++ L+  Q    P+ E
Sbjct:  112 DPTTMGVGKAIAVLTSGGDAQGMNAAVRATVRVGIYTGAKVYFVHEGYQGLVDGGDHIRLATWESVSMMLQLGGTVIGSARCKDFRTKEGRTKAACNLVKLGITNLCVIGGDGSLTGA---NEFRTEWSELLQILLKAGKITAEEARRSSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAITTTA-QSHQRAFILEVMGRHCGYLALVSALASGADWVFI--PEMPPDDGWE--DHLCRRLANQRSLGYRLNVIIVAEGAMDRSGKPITCEMIKNLVTK--KLGFDTRATILGHVQRGGTPSAFDRILGSRMGVEAVMALLEATPETP------------ACVVSLSGNQAVRLPLME 454          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Cavefish
Match: pfklb (ATP-dependent 6-phosphofructokinase, liver type [Source:NCBI gene;Acc:103036959])

HSP 1 Score: 876.315 bits (2263), Expect = 0.000e+0
Identity = 425/755 (56.29%), Postives = 560/755 (74.17%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            GK+IAVLTSGGD+QGMN+AVRAV RMGIY G+ V+ I EGYQGL DGG+NI  A W  V+ I+QLGGTVIGSARC  F TREG L+AA +L+ R I NL V GGDGSLTGAN FR EW  LL +L+++ RIT    ++ +HLNIVG+VGSIDNDFCGTDMTIG DSALHRI+E  DAIS+TAQSHQR F++EVMGRHCGYLA+V+ALAS A+WVFIPE PP   WE  +C +L  +R  G R+NI++++EGAID +  PITS+ +K+L+  +L  DTRVTVLGHVQRGG PSAFDR+L  ++G EAV+AL++A     + ACVI + GNQ +R+PL+ CV  T+ V +AMN K F+EA++LRG+SF NN  TY  L+  +P +      ++    +AI NVGAPA G+NA +RS VR+ + +G  +  V+ GF+GL  D   ++ W+ V GW G GGS+LGT+R LP+    + + +  R+  +  +L IGGFEA+  V +L E R  Y E  I + VIPATISNN+PGT+FSLGADT++N      DKIKQSA GTKRRVF++ET GGYCGYLAT +G+A GADAAYI EE F I DL  +V+H+  K++ ++QRGL+L NEK + +Y+TDF++ LYS EGKGIFD R NI GH+QQGGVPTPFDRN GTKMG KA  WL+E++  +  +  V  N+ +T C++G+ ++ M+F PV+EL    TDF+HR+P  QWW+NLR +++++A++Q+ ++
Sbjct:   14 GKAIAVLTSGGDAQGMNAAVRAVTRMGIYVGAKVYLIYEGYQGLVDGGENIKIANWQSVTNIIQLGGTVIGSARCKAFTTREGRLSAAFHLVQRGITNLCVCGGDGSLTGANIFRSEWAELLAQLVKEGRITDTLAQQYTHLNIVGLVGSIDNDFCGTDMTIGADSALHRIMEVIDAISTTAQSHQRTFVLEVMGRHCGYLAVVSALASGADWVFIPEAPPEEGWEDHMCARLGESRSKGSRLNIVIIAEGAIDKHGQPITSNYVKDLVVQRLGYDTRVTVLGHVQRGGTPSAFDRVLSSKLGVEAVVALLEA--TPETPACVIGLSGNQAMRLPLMECVNMTKEVQKAMNEKRFDEAIQLRGKSFENNWNTYKLLAHQKPAQ------SKSEHSMAILNVGAPAAGMNAAVRSAVRVGLAQGLRVYTVNDGFEGLAKDMVTEVHWHDVAGWTGQGGSLLGTKRTLPNSC-MEKIVETLRKYNIQSLLAIGGFEAYEGVLQLVEARGRYDELCIVMCVIPATISNNVPGTNFSLGADTAVNAAMESCDKIKQSASGTKRRVFIVETMGGYCGYLATTTGIAVGADAAYIFEEPFNIHDLEMNVEHLTEKMKKDIQRGLVLRNEKCHKHYTTDFIHNLYSAEGKGIFDCRVNILGHLQQGGVPTPFDRNFGTKMGVKAVQWLTEKMRETHRQGRVFANAPETACVIGMNRKVMSFIPVAEL-KEHTDFEHRMPKEQWWINLRVMLKMLARYQTHFD 758          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Cavefish
Match: pfkla (ATP-dependent 6-phosphofructokinase, liver type-like [Source:NCBI gene;Acc:103032887])

HSP 1 Score: 863.988 bits (2231), Expect = 0.000e+0
Identity = 428/755 (56.69%), Postives = 562/755 (74.44%), Query Frame = 2
Query:  191 GKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            GK+IAVLTSGGD+QGMN+AVRAV RMGIY G+ V+ I EGYQGL DGG NI  A W  V+ I+QLGGTVIGSARC  F TREG + AA NL+ R I NL V GGDGSLTGAN FR EW+ LL EL+ + RIT    +K  HLNIVG+VGSIDNDFCGTDMTIG DSALHRI+E  DAI++TA SHQR F++EVMGRHCGYLALV+ALAS A+W+FIPE PP   WE  +C +L  +R  G R+NII+V+EGAI+   +PI+S  IK+L+  +L  DTRVTVLGHVQRGG PSAFDR+L  ++G EAV+ALM+A    ++ ACVI + GNQTVR+PL+  VE T+ V +AMN K FEEA++LRGRSF NN   Y  L+  +P +   N        +AI NVGAPA G+NA +RS VR+ +  G+ +  V  GF+GL + +  +++W+ V GW G GGS+LGT+R LPS    + + +   +  +  +LV+GGFEA+  + EL + R  Y E  IP+ +IPATISNN+PGTDFSLGADT++N      DKIKQSA GTKRRVFV+ET GGYCGYLAT +G+A GADAAYI+E+ F I +L+ +V+H+  K++ ++QRGL+L NEK++ +Y+TDF+Y LYS EGKG+FD R N+ GH+QQGG P+PFDRN GTK+G +A  WL+E++ ++  +  V  NS DT+C++GL K+ +T+ PV+E+  ++TDF+HR+P  QWWL LR L++++AK+Q+ ++
Sbjct:   15 GKAIAVLTSGGDAQGMNAAVRAVTRMGIYVGAKVYLIYEGYQGLVDGGDNIKLAHWHSVTNIIQLGGTVIGSARCKAFTTREGRVAAAFNLVKRGITNLCVCGGDGSLTGANIFRSEWSGLLAELVTKGRITPETAKKHDHLNIVGLVGSIDNDFCGTDMTIGADSALHRIMEIVDAITTTAISHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWEDVMCARLGESRSVGSRLNIIIVAEGAINKKGDPISSSYIKDLVVKRLGYDTRVTVLGHVQRGGTPSAFDRVLSSKLGMEAVVALMEA--TPDTPACVIGLSGNQTVRLPLMEAVEMTKEVQKAMNEKRFEEAIQLRGRSFENNWNIYKLLAYQKPAQEKSN------FSVAILNVGAPAAGMNAAVRSAVRMGLAAGHRVYTVSDGFEGLANGEVNEVSWHSVAGWTGQGGSLLGTKRTLPSTC-MEKLVENLNKYNIQSLLVVGGFEAYEGILELFDARGHYDELCIPMCIIPATISNNVPGTDFSLGADTAVNAAMESCDKIKQSATGTKRRVFVVETMGGYCGYLATTTGIAVGADAAYIYEDAFDIHELKTNVEHLTEKMKKDIQRGLVLRNEKSHKHYTTDFIYNLYSAEGKGVFDCRVNVLGHLQQGGAPSPFDRNFGTKLGVRAVQWLTEKMTDTYRQGRVFANSPDTVCVVGLNKKALTYCPVTEV-KKQTDFEHRMPKEQWWLGLRLLLKMLAKYQTSFD 759          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007452.1 (pep scaffold:Pmarinus_7.0:GL477249:14695:58282:1 gene:ENSPMAG00000006711.1 transcript:ENSPMAT00000007452.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 411/716 (57.40%), Postives = 519/716 (72.49%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHK---RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLI------------------LINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIE 2248
            K+++     G++I VLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQG+ DGG++I EA+W  VS I+QLGGTVIGSARC DF+ REG L AA NL+ R I+NL VIGGDGSLTGAN FR EW+ LL+EL+  ++IT    +K +HLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI++TAQSHQR F++EVMGRHCGYLALV AL   A+W FIPE PP   WE K+C  L   R  G R+NI++V+EGAID +  PITSD I+ LI   L  DTRVT+LGHVQRGG PSAFDRILG RMG EAVLAL++A    ++ ACV+S+ GNQ VR+PL+ CVE T+ V +AM+   F+EAVKLRGRSF NNL  Y         + L ++ ++I K    +A+  VGAPA G+NA +R+ +R+ I++G+ +  VH GF+GL     E+  W  V GW G GG+ LGT+R LP++   D + +  ++  +S +L+IGGFEA     +L   R ++ E  IP+ VIPATISNN+PGTDFS+G DT+LN I    D+IKQSA GTK RVF+IET GGYCGYLATMSGLA GADAAYI+EE F I DL+ +V+H+  K++ N+ RGL+                  LINE  N NY+TDF+Y LYS EGKG+FD R N+ GH+QQGG P+PFDRN GTK+ AK   W+S++++
Sbjct:    7 KFLESLSGAGRAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGEHIQEASWDRVSSILQLGGTVIGSARCKDFREREGRLKAALNLVQRGISNLCVIGGDGSLTGANLFREEWSGLLEELVNNDQITGEMAQKFTHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAITTTAQSHQRSFVLEVMGRHCGYLALVTALVCGADWTFIPECPPEDGWEDKMCSTLSDTRGRGVRLNIVIVAEGAIDRHGKPITSDSIRQLIKKCLGFDTRVTILGHVQRGGTPSAFDRILGSRMGVEAVLALLEA--AADTPACVVSLSGNQAVRLPLMECVEMTKDVQKAMDECRFDEAVKLRGRSFENNLNIY---------RLLAHKKSEIKKSGFSVAVLCVGAPAAGMNAAVRAAIRVGISEGHRMYAVHDGFEGLAKGQVEEFGWGDVGGWTGRGGATLGTKRTLPNKF-LDKIVEQIQKHSISALLIIGGFEALEGAMQLASGRSKFEELCIPMCVIPATISNNVPGTDFSIGTDTALNAIVETCDRIKQSASGTKHRVFIIETMGGYCGYLATMSGLAAGADAAYIYEEPFSIRDLQMNVEHLTEKMKGNIHRGLVIRIRLPFTSLVIKLLPPFLINENCNPNYTTDFIYHLYSAEGKGVFDCRKNVLGHMQQGGCPSPFDRNFGTKIAAKGVQWVSKKLQ 710          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005911.1 (pep scaffold:Pmarinus_7.0:GL478489:7235:45113:1 gene:ENSPMAG00000005246.1 transcript:ENSPMAT00000005911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 346/664 (52.11%), Postives = 459/664 (69.13%), Query Frame = 2
Query:  305 EGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNI-----------DTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANE 2263
            +GYQG+ DGG NI EATW  VSGI+QLGGTVIGSARC DF+ R+G   AA +L++  I NL +IGGDGSLTGAN FR EW   ++ LL+Q +I++    +CS+L++VG+VGSIDNDFCGTDMTIG DSALHRI+E  DAI +TA SHQR F++EVMGRHCGYLALV+AL   A+WVFIPE PP   WE ++C KL   R   +R  I          N N +    +++LI     +             ++  LG +Q+   P +FDR    RMG EAVLAL++A     + A V+++ GNQ VR  L++CV++T+AV +AM+   FE+AV+LRG+SF NNL +Y   +  + P +      +    +A+ +VGAPA G+NA +RS VR+ +T G  ++ V+ GF+GL     +++TW+ V GW G GGS+LGT+R LP ++  ++V++  ++  +  +LVIGGFEA++ V EL   R ++ E  IP++V+PAT+SNN+PGTDF LGADT+LN I    D IKQSA GTKRRVFVIET GG+CGYLAT   LA GADAAYI+EE FGI  L+ DV  +  K++  VQRGL+L NE  N NYSTDFVY LY+EEGKG+FD R N+ GH+QQGGVP+PFDRN GTKM AKA  WLSE+++ S  +
Sbjct:    8 QGYQGMVDGGDNIREATWESVSGILQLGGTVIGSARCKDFRGRDGREQAALHLLEHGITNLCIIGGDGSLTGANMFRQEWGEHVQSLLKQGKISEEVAGRCSNLHVVGLVGSIDNDFCGTDMTIGADSALHRIVEVVDAIMTTATSHQRTFVLEVMGRHCGYLALVSALTCGADWVFIPESPPQDGWEDRMCDKLSAVRAVPRRKRI----------NENTLAHGHVEHLIAGLQTVYKGGAIRIAAESKKLRTLGELQK--TPPSFDREEASRMGFEAVLALLEA--TPETPAYVVALTGNQIVRNSLMQCVQQTQAVQKAMDEGRFEDAVRLRGKSFQNNLNSYNLFANNKAPVS----KAKTAFTVAVLSVGAPAAGVNAAVRSAVRVGMTCGLRVLTVNDGFQGLASGQVQEMTWDSVGGWTGQGGSILGTKRTLPGKILKEVVSE-IQKNDIQALLVIGGFEAYLGVLELEAARAQHDELCIPMVVVPATVSNNVPGTDFCLGADTALNIIMHTCDHIKQSASGTKRRVFVIETMGGFCGYLATAGALAAGADAAYIYEEPFGIAQLQADVIRLVEKMKSGVQRGLVLRNEHCNTNYSTDFVYHLYTEEGKGVFDCRKNVLGHMQQGGVPSPFDRNFGTKMAAKAIQWLSEKLKESYKQ 652          

HSP 2 Score: 130.568 bits (327), Expect = 1.490e-31
Identity = 102/310 (32.90%), Postives = 162/310 (52.26%), Query Frame = 2
Query:  197 SIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRN-INNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQ-SHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNP-ITSDQIKNLITSQLN--IDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAV 1111
            ++AVL+ G  + G+N+AVR+ VR+G+ CG  V  + +G+QGL  G   + E TW  V G    GG+++G+ R +  K    +L    + I +N I  L+VIGG  +  G              +LE         E C  + +V +  ++ N+  GTD  +G D+AL+ I+  CD I  +A  + +R F++E MG  CGYLA   ALA+ A+  +I E P  +        +L     +G +  ++L +E     +CN   ++D + +L T +     D R  VLGH+Q+GG PS FDR  G +M A+A+
Sbjct:  357 TVAVLSVGAPAAGVNAAVRSAVRVGMTCGLRVLTVNDGFQGLASG--QVQEMTWDSVGGWTGQGGSILGTKRTLPGK----ILKEVVSEIQKNDIQALLVIGGFEAYLG--------------VLELEAARAQHDELC--IPMVVVPATVSNNVPGTDFCLGADTALNIIMHTCDHIKQSASGTKRRVFVIETMGGFCGYLATAGALAAGADAAYIYEEPFGIAQLQADVIRLVEKMKSGVQRGLVLRNE-----HCNTNYSTDFVYHLYTEEGKGVFDCRKNVLGHMQQGGVPSPFDRNFGTKMAAKAI 639          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008968.1 (pep scaffold:Pmarinus_7.0:GL478229:3907:42159:-1 gene:ENSPMAG00000008107.1 transcript:ENSPMAT00000008968.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 318/532 (59.77%), Postives = 404/532 (75.94%), Query Frame = 2
Query:  233 GMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRI 1828
            GMN+AVRAVVRMGIY G+ V+F+ EGYQG+ DGG +I EA W  VS I+QLGGTVIGSARC +F+TREG L AA +L+ R I+NL VIGGDGSLTGAN FR EW+ LL+EL++Q +I+    E+ SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPE PP   WE K+C KL  NR   +R+N+++VSEGAID    PI+S +IK+L+T  L +DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL++A     + ACV+S+ GNQ++R+PL+ CV+ T+ V +AM+ + F +AVKLRGRSF NNL TY    KL   K + +   +    IA+ NVGAPA G+NA +RS VR+ IT+G+ I+ V+ GF+G      +++ W  V GW G GGS+LGT+R LP +   D +A+  RE  ++ +L+IGGFEAF+S  EL E R  +P F IP++V+PAT+SNN+PG+DFS+GADT+LN IT +
Sbjct:    1 GMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDHIEEANWESVSSILQLGGTVIGSARCKEFRTREGRLAAAFHLVQRGISNLCVIGGDGSLTGANIFREEWSGLLQELIKQGKISNDVAERYSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPESPPEEGWEEKMCTKLTENRLRKKRLNVMIVSEGAIDSFNKPISSQKIKDLVTKSLGLDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEA--TPETPACVVSLSGNQSIRLPLMECVQLTQEVQKAMDERRFADAVKLRGRSFENNLNTY----KLLANKKVDSAYPKSQFTIAVLNVGAPAAGMNAAVRSAVRVGITEGHNILAVNDGFEGFAKGQIKEIKWRDVGGWTGQGGSLLGTKRTLPKKY-LDQIAEKIRENNVNALLIIGGFEAFLSGLELVEARDSHPAFCIPMVVVPATVSNNVPGSDFSVGADTALNTITDV 525          

HSP 2 Score: 118.242 bits (295), Expect = 5.216e-28
Identity = 92/303 (30.36%), Postives = 153/303 (50.50%), Query Frame = 2
Query: 1409 GINATMRSFVRLMITKGYEIIGVHGGFKGLID--DDKEDLTWNRVRGWAGLGGSMLGTRR--HLPSEVGFDIVAKYFRELRLSGILVIGG-----------------FEAFISVCEL-NEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEE--EFGIDDLRKDVDHMRAKIEDNVQR----GLILINEKA----NVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKA 2221
            G+NA +R+ VR+ I  G ++  VH G++G++D  D  E+  W  V     LGG+++G+ R     +  G    A +  +  +S + VIGG                  +  I   ++ N+  + Y    I  +V   +I N+  GTD ++G D++L+ I  +VD I  +A  + +R FV+E  G +CGYLA +S LA GAD  +I E   E G ++       M  K+ +N  R     +++++E A    N   S+  +  L ++      DTR  I GH+Q+GG P+ FDR + ++MG +A
Sbjct:    1 GMNAAVRAVVRMGIYVGAKVYFVHEGYQGMVDGGDHIEEANWESVSSILQLGGTVIGSARCKEFRTREGRLAAAFHLVQRGISNLCVIGGDGSLTGANIFREEWSGLLQELIKQGKISNDVAERYSHLNIVGMV--GSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTA-QSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPESPPEEGWEE------KMCTKLTENRLRKKRLNVMIVSEGAIDSFNKPISSQKIKDLVTKSLG--LDTRVTILGHVQRGGTPSAFDRILASRMGVEA 292          

HSP 3 Score: 73.9442 bits (180), Expect = 7.851e-14
Identity = 61/204 (29.90%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  113 KLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGG-DGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSH----LNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE 709
            KLL  ++  +A P        K  F   +IAVL  G  + GMN+AVR+ VR+GI  G ++  + +G++G   G   I E  W DV G    GG+++G+ R +  K    L   A+ + + N+N L++IGG +  L+G             EL+E          + SH    + +V +  ++ N+  G+D ++G D+AL+ I +
Sbjct:  358 KLLANKKVDSAYP--------KSQF---TIAVLNVGAPAAGMNAAVRSAVRVGITEGHNILAVNDGFEGFAKG--QIKEIKWRDVGGWTGQGGSLLGTKRTLPKKY---LDQIAEKIRENNVNALLIIGGFEAFLSGL------------ELVEA---------RDSHPAFCIPMVVVPATVSNNVPGSDFSVGADTALNTITD 524          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008974.1 (pep scaffold:Pmarinus_7.0:GL478229:3949:42166:-1 gene:ENSPMAG00000008107.1 transcript:ENSPMAT00000008974.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 284/479 (59.29%), Postives = 362/479 (75.57%), Query Frame = 2
Query:  386 GGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEIT 1822
            GGTVIGSARC +F+TREG L AA +L+ R I+NL VIGGDGSLTGAN FR EW+ LL+EL++Q +I+    E+ SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPE PP   WE K+C KL  NR   +R+N+++VSEGAID    PI+S +IK+L+T  L +DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL++A     + ACV+S+ GNQ++R+PL+ CV+ T+ V +AM+ + F +AVKLRGRSF NNL TY    KL   K + +   +    IA+ NVGAPA G+NA +RS VR+ IT+G+ I+ V+ GF+G      +++ W  V GW G GGS+LGT+R LP +   D +A+  RE  ++ +L+IGGFEAF+S  EL E R  +P F IP++V+PAT+SNN+PG+DFS+GADT+LN IT
Sbjct:   83 GGTVIGSARCKEFRTREGRLAAAFHLVQRGISNLCVIGGDGSLTGANIFREEWSGLLQELIKQGKISNDVAERYSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPESPPEEGWEEKMCTKLTENRLRKKRLNVMIVSEGAIDSFNKPISSQKIKDLVTKSLGLDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEA--TPETPACVVSLSGNQSIRLPLMECVQLTQEVQKAMDERRFADAVKLRGRSFENNLNTY----KLLANKKVDSAYPKSQFTIAVLNVGAPAAGMNAAVRSAVRVGITEGHNILAVNDGFEGFAKGQIKEIKWRDVGGWTGQGGSLLGTKRTLPKKY-LDQIAEKIRENNVNALLIIGGFEAFLSGLELVEARDSHPAFCIPMVVVPATVSNNVPGSDFSVGADTALNTIT 554          

HSP 2 Score: 89.3521 bits (220), Expect = 1.038e-18
Identity = 62/185 (33.51%), Postives = 100/185 (54.05%), Query Frame = 2
Query: 1697 NEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEE--EFGIDDLRKDVDHMRAKIEDNVQR----GLILINEKA----NVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKA 2221
            N+  + Y    I  +V   +I N+  GTD ++G D++L+ I  +VD I  +A  + +R FV+E  G +CGYLA +S LA GAD  +I E   E G ++       M  K+ +N  R     +++++E A    N   S+  +  L ++      DTR  I GH+Q+GG P+ FDR + ++MG +A
Sbjct:  150 NDVAERYSHLNIVGMV--GSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQ-SHQRTFVLEVMGRHCGYLALVSALACGADWVFIPESPPEEGWEE------KMCTKLTENRLRKKRLNVMIVSEGAIDSFNKPISSQKIKDLVTKSLG--LDTRVTILGHVQRGGTPSAFDRILASRMGVEA 323          

HSP 3 Score: 73.559 bits (179), Expect = 1.068e-13
Identity = 61/204 (29.90%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  113 KLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGG-DGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSH----LNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE 709
            KLL  ++  +A P        K  F   +IAVL  G  + GMN+AVR+ VR+GI  G ++  + +G++G   G   I E  W DV G    GG+++G+ R +  K    L   A+ + + N+N L++IGG +  L+G             EL+E          + SH    + +V +  ++ N+  G+D ++G D+AL+ I +
Sbjct:  389 KLLANKKVDSAYP--------KSQF---TIAVLNVGAPAAGMNAAVRSAVRVGITEGHNILAVNDGFEGFAKG--QIKEIKWRDVGGWTGQGGSLLGTKRTLPKKY---LDQIAEKIRENNVNALLIIGGFEAFLSGL------------ELVEA---------RDSHPAFCIPMVVVPATVSNNVPGSDFSVGADTALNTITD 555          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007362.1 (pep scaffold:Pmarinus_7.0:GL493177:1250:4583:-1 gene:ENSPMAG00000006644.1 transcript:ENSPMAT00000007362.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.722 bits (722), Expect = 1.399e-89
Identity = 141/212 (66.51%), Postives = 169/212 (79.72%), Query Frame = 2
Query:  578 RITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVE 1213
            +IT    +K SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRI+E  DAI++TAQSHQR F++EVMGRHCGYLALV  L   A++VF+PEMPP+  WE +LC  L   R  G R+NII+V+EGAID +   ITSDQIK+++T +L  DTRVTVLGHVQRGG PSAFDRIL  RMG EAVLAL+DA  +  + ACV+S+ GNQ VR+PL+ CV+
Sbjct:    2 KITAEVAKKNSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEVVDAITTTAQSHQRSFVLEVMGRHCGYLALVTGLTCGADFVFLPEMPPADGWEDQLCATLTETRSRGVRLNIIIVAEGAIDRHGKAITSDQIKDMVTKRLGFDTRVTVLGHVQRGGTPSAFDRILASRMGVEAVLALLDA--SPETPACVVSLSGNQAVRLPLMECVQ 211          

HSP 2 Score: 88.9669 bits (219), Expect = 2.918e-20
Identity = 53/163 (32.52%), Postives = 92/163 (56.44%), Query Frame = 2
Query: 1754 TISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGI---DDLRKDVDHMRAKIEDNVQRGLILINEKANVNY----STDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKA 2221
            +I N+  GTD ++G D++L+ I  +VD I  +A  + +R FV+E  G +CGYLA ++GL  GAD  ++ E        D L   +   R++    V+  +I++ E A   +    ++D +  + ++     FDTR  + GH+Q+GG P+ FDR + ++MG +A
Sbjct:   22 SIDNDFCGTDMTIGTDSALHRIMEVVDAITTTA-QSHQRSFVLEVMGRHCGYLALVTGLTCGADFVFLPEMPPADGWEDQLCATLTETRSR---GVRLNIIIVAEGAIDRHGKAITSDQIKDMVTKRLG--FDTRVTVLGHVQRGGTPSAFDRILASRMGVEA 178          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Yeast
Match: PFK2 (Beta subunit of heterooctameric phosphofructokinase; involved in glycolysis; indispensable for anaerobic growth; activated by fructose-2,6-bisphosphate and AMP; mutation inhibits glucose induction of cell cycle-related genes [Source:SGD;Acc:S000004818])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 317/763 (41.55%), Postives = 468/763 (61.34%), Query Frame = 2
Query:  194 KSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKN-IVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPP-SLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDK-EDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRG----LILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSN-------DTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKH 2440
            K+IAV+TSGGD+ GMNS VRA+VR  I+ G   F + EGY+GL  GG   I E  W DV G    GGT IG+ARCM+FK REG L  A++LI+  ++ L+V GGDGSLTGA+ FR EW SL++ELL+ NRI+  Q E+  HLNI G VGSIDND   TD TIG  SAL RI +A D + +TA SH R F++EVMGR+CG+LAL+A +A+ A+++FIPE P  S +W+ ++C  +  +R  G+R  I++V+EGAI  +  PI+   +  ++  +L +DTR+T LGHVQRGG   A+DRIL    G EAV A++  E   ++ + +I+++ N+ VR PL+  V+ T+AV EA+ AK+F+ A+ LR   F  +L  ++ ++     +  L  P     +IAI NVGAPA GIN+ + S     +++G+    ++ G+ GL   +    L W  + GW   GGS +GT R  P E    ++A YF++    G++++GGFEAF S+ +L   R+ YP F+IP+++IPAT+SNN+PGT++SLG+DT+LN +    D +KQSA  T+ R FV++ QGG  GYLAT + LA GA  +Y+ EE   ++ L +D++++    E    RG    LIL +  A+   S   +  + + E  G FD +   PGH+QQGG+P+P DR   T+M  KA  ++ +     A     + N N       DT  ++G+    + +  + +L+  ET+   R+P    W       R++A H
Sbjct:  197 KAIAVMTSGGDAPGMNSNVRAIVRSAIFKGCRAFVVMEGYEGLVRGGPEYIKEFHWEDVRGWSAEGGTNIGTARCMEFKKREGRLLGAQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIEELLKTNRISNEQYERMKHLNICGTVGSIDNDMSTTDATIGAYSALDRICKAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYIFIPEKPATSSEWQDQMCDIVSKHRSRGKRTTIVVVAEGAIAADLTPISPSDVHKVLVDRLGLDTRITTLGHVQRGGTAVAYDRILATLQGLEAVNAVL--ESTPDTPSPLIAVNENKIVRKPLMESVKLTKAVAEAIQAKDFKRAMSLRDTEFIEHLNNFMAINSADHNEPKL--PKDKRLKIAIVNVGAPAGGINSAVYSMATYCMSQGHRPYAIYNGWSGLARHESVRSLNWKDMLGWQSRGGSEIGTNRVTPEEADLGMIAYYFQKYEFDGLIIVGGFEAFESLHQLERARESYPAFRIPMVLIPATLSNNVPGTEYSLGSDTALNALMEYCDVVKQSASSTRGRAFVVDCQGGNSGYLATYASLAVGAQVSYVPEEGISLEQLSEDIEYLAQSFEKAEGRGRFGKLILKSTNASKALSATKLAEVITAEADGRFDAKPAYPGHVQQGGLPSPIDRTRATRMAIKAVGFIKDNQAAIAEARAAEENFNADDKTISDTAAVVGVKGSHVVYNSIRQLYDYETEVSMRMPKVIHW----QATRLIADH 951          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Yeast
Match: PFK1 (Alpha subunit of heterooctameric phosphofructokinase; involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes [Source:SGD;Acc:S000003472])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 316/775 (40.77%), Postives = 472/775 (60.90%), Query Frame = 2
Query:  188 KGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMP-PSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDD-DKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDV----DHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNS--------------------NDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMA 2434
            K K IAV+TSGGDS GMN+AVRAVVR GI+ G  VF + EGY+GL  GGK + +  W DV G +  GGT+IG+AR M+F+ REG   AA NLI + I+ LVV GGDGSLTGA+ FR EW SL+ EL+ + R T+ ++    +L+IVG+VGSIDND  GTD TIG  SAL RI E  D I +TA+SH R F++EVMGRHCG+LAL+A +A+ A+++FIPE   P   W+ +L +  + +R  G+R N I+V+EGA+D   NP+T++ +K+ +  +L +DT+VT+LGHVQRGG   A DR L    G +AV A++  E    + + +I I  N+ +R+PL+  V+ T++V  A+  K+F++A+ LR   F    E ++  +       LL  P      I I +VGAP+  +NA  R+     ++ G++   +  GF GLI   + ++L+W  V  W  LGGS +GT R + SE     +A YF++ +L G++++GGFE F S+ +L + R ++P F IP+ +IPAT+SNN+PGT++SLG DT LN +    D IKQSA  T+RRVFV E QGG+ GY+A+ +GL  GA + Y  E++  +  +R+D+    ++ R    +N    L++ NE+A+  YST  +  + SE  KG F  R  IPGH+QQGGVP+  DR   ++   K   ++ +   N  NE+   T++                    +D+  ++ +    ++F P++ L+  ET+ + R      W     +  I++
Sbjct:  204 KKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFAVYEGYEGLLRGGKYLKKMAWEDVRGWLSEGGTLIGTARSMEFRKREGRRQAAGNLISQGIDALVVCGGDGSLTGADLFRHEWPSLVDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFIPERAVPHGKWQDELKEVCQRHRSKGRRNNTIIVAEGALDDQLNPVTANDVKDALI-ELGLDTKVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVL--EFTPETPSPLIGILENKIIRMPLVESVKLTKSVATAIENKDFDKAISLRDTEFIELYENFLSTTVKDDGSELL--PVSDRLNIGIVHVGAPSAALNAATRAATLYCLSHGHKPYAIMNGFSGLIQTGEVKELSWIDVENWHNLGGSEIGTNRSVASE-DLGTIAYYFQKNKLDGLIILGGFEGFRSLKQLRDGRTQHPIFNIPMCLIPATVSNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRRRVFVCEVQGGHSGYIASFTGLITGAVSVYTPEKKIDLASIREDITLLKENFRHDKGENRNGKLLVRNEQASSVYSTQLLADIISEASKGKFGVRTAIPGHVQQGGVPSSKDRVTASRFAVKCIKFIEQW--NKKNEASPNTDAKVLRFKFDTHGEKVPTVEHEDDSAAVICVNGSHVSFKPIANLWENETNVELRKGFEVHWAEYNKIGDILS 970          

HSP 2 Score: 113.235 bits (282), Expect = 6.364e-26
Identity = 94/327 (28.75%), Postives = 154/327 (47.09%), Query Frame = 2
Query: 1358 TQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDK--EDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRE----LRLSGILVIGGFEAFI------SVCELNEKRQEYPEF-------------------QIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFG----IDDLRKDVDHMRAKIEDN----VQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKA 2221
            +Q  K+IA+   G  + G+NA +R+ VR  I  G ++  V+ G++GL+   K  + + W  VRGW   GG+++GT R +            FR+     + +G L+  G +A +      S+   +  R E+P                      + I+ +  +I N++ GTD ++GA ++L  I  +VD I  +A  +  R FV+E  G +CG+LA M+G+A GAD  +I E         D+L++     R+K   N    V  G   ++++ N   + D V     E G    DT+  I GH+Q+GG     DR + T  G  A
Sbjct:  202 SQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFAVYEGYEGLLRGGKYLKKMAWEDVRGWLSEGGTLIGTARSME-----------FRKREGRRQAAGNLISQGIDALVVCGGDGSLTGADLFRHEWPSLVDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATA-KSHSRAFVVEVMGRHCGWLALMAGIATGADYIFIPERAVPHGKWQDELKEVCQRHRSKGRRNNTIIVAEG--ALDDQLNPVTAND-VKDALIELG---LDTKVTILGHVQRGGTAVAHDRWLATLQGVDA 510          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Medaka
Match: ENSORLT00000040840.1 (phosphofructokinase, platelet [Source:NCBI gene;Acc:101163356])

HSP 1 Score: 910.983 bits (2353), Expect = 0.000e+0
Identity = 454/796 (57.04%), Postives = 579/796 (72.74%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKL--------------------------------KINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            K+++    +GK IAVLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQG+ DGG NI EATW  VS ++Q+GGTVIGSARC +F+T EG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL ELLEQ  I +  +   S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPEMPP   WE  +CQKL                                K NR + +R+NII+V+EGAID +   IT D IK+L+   L  DTRVT+LGHVQRGG PSAFDRILG RMG EAVLAL++A  + ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EAV+LRGRSF NNL TY  LS  +    L N    +    A+ NVGAPA G+NA +RS VR+ IT+G+++  V+ GF+G      +++ W  V GW G GGS+LGT+R LP++     +A+  R   ++ +LVIGGFEA++ + EL+  R EYPEF +P++++PAT+SNNIPG+D S+G+DT+LN IT   D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GAD  YI+EE F I DL+ +V+H+  K++  +QRGL+L NE  N N++TDF+Y+LYSEEG+G+FD R NI GH+QQGG P+PFDRN GTK+ AKA  W++  ++ S     V TN+ DT CLLG+ +R M F PV++L   ETDF+HRIP +QWWL LRPLM+I+AK+++ Y+
Sbjct:   14 KFVENLSGEGKCIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLNELLEQGLINEEAVSSNSVLHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEMPPDDGWEDNMCQKLSESRSRGSRLNIIIVAEGATDRQGQHITSSFVKDNRADKKRLNIIIVAEGAIDSHNKAITPDCIKDLVVRCLGFDTRVTILGHVQRGGTPSAFDRILGSRMGVEAVLALLEA--STDTPACVVSLVGNQAVRLPLMECVQMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLSYRKLDSELPNSSFNV----AVLNVGAPAAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKR-LAKIAEQMRIHNINALLVIGGFEAYVGLLELSSARDEYPEFCVPMVMVPATVSNNIPGSDLSIGSDTALNAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADTVYIYEEAFDIRDLQANVEHLTQKMKTTIQRGLVLRNENCNENFTTDFIYQLYSEEGRGVFDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAMQWITRALKESYKGGKVFTNAEDTACLLGMRRRAMVFQPVAQLR-EETDFEHRIPKDQWWLKLRPLMKILAKYKTSYD 801          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Medaka
Match: ENSORLT00000036388.1 (phosphofructokinase, platelet [Source:NCBI gene;Acc:101163356])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 458/796 (57.54%), Postives = 575/796 (72.24%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKL--------------------------------KINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            K+++    +GK IAVLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQG+ DGG NI EATW  VS ++Q+GGTVIGSARC +F+T EG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL ELLEQ  I +  +   S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPEMPP   WE  +CQKL                                K NR + +R+NII+V+EGAID +   IT D IK+L+   L  DTRVT+LGHVQRGG PSAFDRILG RMG EAVLAL++A  + ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EAV+LRGRSF NNL TY  LS  +    L N    +    A+ NVGAPA G+NA +RS VR+ IT+G+++  V+ GF+G      +++ W  V GW G GGS+LGT+R LP++     +A+  R   ++ +LVIGGFEAF S+ EL E R  + EF IP+ ++PATISNN+PGTD SLGADTSLN I    D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GAD  YI+EE F I DL+ +V+H+  K++  +QRGL+L NE  N N++TDF+Y+LYSEEG+G+FD R NI GH+QQGG P+PFDRN GTK+ AKA  W++  ++ S     V TN+ DT CLLG+ +R M F PV++L   ETDF+HRIP +QWWL LRPLM+I+AK+++ Y+
Sbjct:   14 KFVENLSGEGKCIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLNELLEQGLINEEAVSSNSVLHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEMPPDDGWEDNMCQKLSESRSRGSRLNIIIVAEGATDRQGQHITSSFVKDNRADKKRLNIIIVAEGAIDSHNKAITPDCIKDLVVRCLGFDTRVTILGHVQRGGTPSAFDRILGSRMGVEAVLALLEA--STDTPACVVSLVGNQAVRLPLMECVQMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLSYRKLDSELPNSSFNV----AVLNVGAPAAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKR-LAKIAEQMRIHNINALLVIGGFEAFESLLELYEARAHHEEFCIPMCILPATISNNVPGTDHSLGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADTVYIYEEAFDIRDLQANVEHLTQKMKTTIQRGLVLRNENCNENFTTDFIYQLYSEEGRGVFDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAMQWITRALKESYKGGKVFTNAEDTACLLGMRRRAMVFQPVAQLR-EETDFEHRIPKDQWWLKLRPLMKILAKYKTSYD 801          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Medaka
Match: ENSORLT00000036480.1 (phosphofructokinase, platelet [Source:NCBI gene;Acc:101163356])

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 456/815 (55.95%), Postives = 577/815 (70.80%), Query Frame = 2
Query:  164 KYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPIL---------------------------------------------------VIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            K+++    +GK IAVLTSGGD+QGMN+AVRAVVRMGIY G+ V+FI EGYQG+ DGG NI EATW  VS ++Q+GGTVIGSARC +F+T EG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LL ELLEQ  I +  +   S L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WVFIPEMPP   WE  +CQKL  NR + +R+NII+V+EGAID +   IT D IK+L+   L  DTRVT+LGHVQRGG PSAFDRILG RMG EAVLAL++A  + ++ ACV+S+ GNQ VR+PL+ CV+ T+ V +AM+ K F+EAV+LRGRSF NNL TY  LS  +    L N        +A+ NVGAPA G+NA +RS VR+ IT+G+++  V+ GF+G      +++ W  V GW G GGS+LGT+R LP++     +A+  R   ++ +LVIGGFEA++ + EL+  R EYPEF +P++                                                   ++PATISNN+PGTD SLGADTSLN I    D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GAD  YI+EE F I DL+ +V+H+  K++  +QRGL+L NE  N N++TDF+Y+LYSEEG+G+FD R NI GH+QQGG P+PFDRN GTK+ AKA  W++  ++ S     V TN+ DT CLLG+ +R M F PV++L   ETDF+HRIP +QWWL LRPLM+I+AK+++ Y+
Sbjct:   14 KFVENLSGEGKCIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLNELLEQGLINEEAVSSNSVLHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEMPPDDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDSHNKAITPDCIKDLVVRCLGFDTRVTILGHVQRGGTPSAFDRILGSRMGVEAVLALLEA--STDTPACVVSLVGNQAVRLPLMECVQMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLSYRKLDSELPNSSFN----VAVLNVGAPAAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKR-LAKIAEQMRIHNINALLVIGGFEAYVGLLELSSARDEYPEFCVPMVMVPATVSNNIPGSDLSIGSDTALNAITDAFESLLELYEARAHHEEFCIPMCILPATISNNVPGTDHSLGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADTVYIYEEAFDIRDLQANVEHLTQKMKTTIQRGLVLRNENCNENFTTDFIYQLYSEEGRGVFDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAMQWITRALKESYKGGKVFTNAEDTACLLGMRRRAMVFQPVAQLR-EETDFEHRIPKDQWWLKLRPLMKILAKYKTSYD 820          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Medaka
Match: pfkpa (ATP-dependent 6-phosphofructokinase, platelet type [Source:NCBI gene;Acc:101155970])

HSP 1 Score: 903.279 bits (2333), Expect = 0.000e+0
Identity = 455/771 (59.01%), Postives = 577/771 (74.84%), Query Frame = 2
Query:  143 AQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYE 2455
            AQP  +  + +     GK+IAVLTSGGD+QGMN+AVRAVVRMG+Y G+ V+FI EGYQG+ DGG NI EA+W  VS ++Q+GGTVIGSARC +F++ EG L AA NL+ R I NL VIGGDGSLTGAN FR EW+ LLKEL+E+  I    +E+ + L+IVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI +TAQSHQR F++EVMGRHCGYLALV+ALA  A+WV IPEMPP   WE K+CQKL  NR   +R+NII+V+EGAID N   IT++ IKNL+   L  DTRVT+LGHVQRGG PSAFDRIL  RMG EAVLAL+  E   ++ ACV+S+ GNQ+VR+PL+ CV+ T+ V +AM+ K FEEAVKLRGRSF NNL TY  L+  +P   L   P   +  +A+ NVGAPA G+NA +RS VR+ I++G+++  V+ GF+G      +++ W+ V GW G GGS+LGT+R LP++   D +A+  R+  ++ +LVIGGFEA  S+ +L E R  Y EF IP+ ++PATISNN+PGT  S+GADT+LN I    D+IKQSA GTKRRVF+IET GGYCGYLAT+ GLA GADAAYI+EE F I DL+ +V+H+  K++ ++QRGL+L NE +N NY+TDF+Y+LYSEEGKG+FD R N+ GH+QQGG P+PFDRN GTKM AKA  WLS+++  +     V  NS D+ CLLG+  R + F PV  L    TDF HRIP  QWWL LRPLM+I+AK+++ Y+
Sbjct:    2 AQPDSKKIFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGLYVGAKVYFIHEGYQGMVDGGDNIEEASWESVSSMLQVGGTVIGSARCKEFRSHEGRLQAAHNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLKELVEKGLIEADAVERYAALHIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWEEKMCQKLSANRAGMKRLNIIIVAEGAIDRNNKAITTEYIKNLVVKHLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALL--ETTADTPACVVSLCGNQSVRLPLMECVQMTQEVQKAMDQKRFEEAVKLRGRSFENNLRTYKLLAHRKPESEL---PVS-NFNVAVLNVGAPAAGMNAAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEVKWSDVGGWTGQGGSLLGTKRTLPAKHA-DKIAEQMRKYNINALLVIGGFEALESLLQLYEVRTTYEEFCIPMCMLPATISNNVPGTALSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNDNYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKMSAKAMQWLSKKLLETYRRGRVFANSEDSCCLLGMLGRTLVFQPVVTL-KDHTDFIHRIPKEQWWLKLRPLMKILAKYKTSYD 764          
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Medaka
Match: pfkmb (ATP-dependent 6-phosphofructokinase, muscle type [Source:NCBI gene;Acc:101174339])

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 435/752 (57.85%), Postives = 561/752 (74.60%), Query Frame = 2
Query:  188 KGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQ 2443
            +G++IAVLTSGGD+QGMN+AVRA VR+G+Y G+ V+F+ EGYQGL DGG +I  ATW  VS ++QLGGTVIGSARC DF+++EG   AA NL+   I NL VIGGDGSLTGAN FR EW  LL +L++  +IT  + +  SHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIE  DAI++TAQSHQR FI+EVMGRHCGYLALV ALA  A+WVFIPEMPP   WE  LC++L   R  G R+NII+V+EGAID +  PIT D +K L++ +L  DTR T+LGHVQRGG PSAFDRIL  RMG EAV+AL++A    ++ ACV+S+ GN  VR+PL+ CV+ T+ V  AM    F+EAV LRG+SF NN  TY  L+ + PP+T  N        IAI NVGAP  G+NA +R+ VR+ + +G++++ VH  F GL     E +TW+ V GW G GGS+LGT+R LP E   + ++    +  + G+++IGGFEAF+   E+ + R++Y E  IP++V+PAT+SNN+PGTDFS+GADT+LN IT   D+IKQSA GTKRRVF++ET GG+CGYLATM+GLA GADAAYI+EE F I  L  +V+H+  K++  V+RGLIL NEK N NY+TDF++ LYSEEGKGIFD R N+ GH+QQGG P+PFDRN GTKMG K+  WL+++++       +  NS D+ C+LG+ KR + F P++EL   ETDF+HRIP  QWWL LRP+++I+AK++
Sbjct:   14 EGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGLVDGGDHIRPATWESVSMMLQLGGTVIGSARCQDFRSKEGRTKAAYNLVKLGITNLCVIGGDGSLTGANQFRTEWKDLLADLIKAGKITANEAKNSSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPEEGWEDHLCRRLTEQRGRGSRLNIIIVAEGAIDRHGKPITCDLVKQLVSKKLGFDTRTTILGHVQRGGTPSAFDRILASRMGVEAVMALLEA--TPDTPACVVSLSGNMAVRLPLMECVQVTKDVMTAMAEGRFDEAVNLRGKSFENNWNTYKMLAHVHPPETKSN------INIAILNVGAPCAGMNAAVRAAVRIGLLQGHQMLAVHDSFDGLAHGMIEPITWSGVAGWTGKGGSILGTKRSLPHEF-MEEISLSITKFNIHGLVIIGGFEAFLGGLEMVQAREKYEELCIPLVVVPATVSNNVPGTDFSIGADTALNTITMTCDRIKQSAAGTKRRVFIVETMGGFCGYLATMAGLASGADAAYIYEESFNIHHLEMNVEHLVEKMKTTVKRGLILRNEKCNANYTTDFIFNLYSEEGKGIFDCRKNVLGHMQQGGTPSPFDRNFGTKMGIKSVLWLTDKLKECYRHGRIFANSQDSACVLGMRKRALVFQPLAEL-KDETDFEHRIPKKQWWLKLRPILKILAKYK 755          
BLAST of ATP-dependent 6-phosphofructokinase vs. Planmine SMEST
Match: SMESG000029088.1 (SMESG000029088.1)

HSP 1 Score: 1623.99 bits (4204), Expect = 0.000e+0
Identity = 796/801 (99.38%), Postives = 797/801 (99.50%), Query Frame = 2
Query:   86 MDLSEKLDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEKN 2488
            MDLSEKLDR+LLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYLALVAALASEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLN    IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEKN
Sbjct:    1 MDLSEKLDRRLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYLALVAALASEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLN----IHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEKN 797          
BLAST of ATP-dependent 6-phosphofructokinase vs. Planmine SMEST
Match: SMESG000028432.1 (SMESG000028432.1)

HSP 1 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 523/791 (66.12%), Postives = 626/791 (79.14%), Query Frame = 2
Query:  113 KLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFTPVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK 2485
            +L  +  +++ QPGMEG YI KDCF+GK IAVLTSGGDSQGMNS +RAVVRMGIYCG SV+ IKEG+QGL  G   IVEATWA VS I+QLGGT+IGS  C +F TR+G   +AKNLI   I NLV+IGGDGSLTGAN F+ EW+ L++EL++  +I+  +      LN+VG+V S+DND CGTDMTIGTDSALHRIIEACDAI+STA SHQRCFI+E+MGR CGYLALV ALASEAEWVFIPE PP   WE KLC+KL  N+ NGQRVNII++SEGAID++  PITS  ++ +ITS+LN D+RVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMD + N   E+C+IS+ GNQ VRVPL  CVEKT+A+ EA+  +NF+ AV LRGRSF NNL  Y  LSK  PPK+L     +  K+IAI NVGAPACG NA +RSF R MI+KG+++IGVH GF+G +  D E L WN+V+GW G+GGS+LG RR  P  VG  +++K    +++SG+L+IGGFEA+ S+ ++ + R  YP   +P+L +PATISNN+PGTDFSLGADTSLNEIT IVDKIKQSAVGTKRRVF++ET GG+CGYLATMSG+AGGADAAYIHEEEFGID+LR DV H++AKI D VQRGLILINEKAN NYST FV+RL+ EEGKGIFD R N+PGH+QQGG P+PFDRNMG KMG+KASDW ++Q E    E     NS    CLLG+ + +  FTPV EL    +DFKHR+P  QWWLNLRPL+RIMAKH+SLY SESIM GL K
Sbjct:    6 QLRMQHLSVSIQPGMEGMYIHKDCFQGKKIAVLTSGGDSQGMNSVLRAVVRMGIYCGCSVYLIKEGFQGLVAGKDYIVEATWASVSNILQLGGTIIGSTECEEFMTRDGRKLSAKNLIIAGITNLVIIGGDGSLTGANLFKTEWSELIEELVKDGQISTSEYLSSVSLNVVGVVASVDNDVCGTDMTIGTDSALHRIIEACDAITSTAHSHQRCFILEIMGRQCGYLALVTALASEAEWVFIPESPPDEGWEEKLCEKLDRNKHNGQRVNIIVISEGAIDLHGKPITSSMVQQIITSKLNFDSRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDGDKNPELESCIISLHGNQIVRVPLKTCVEKTKAIEEALRIQNFQRAVNLRGRSFVNNLNAYKNLSKSSPPKSL----EKNSKKIAILNVGAPACGTNAVVRSFTRFMISKGFDVIGVHEGFQGFVKGDYETLDWNKVKGWVGIGGSILGIRRETPENVGMKLISKIIDRVQISGMLIIGGFEAYTSLLQMYKARNTYPNLNMPMLCVPATISNNVPGTDFSLGADTSLNEITEIVDKIKQSAVGTKRRVFIVETHGGHCGYLATMSGIAGGADAAYIHEEEFGIDELRADVTHLKAKIADKVQRGLILINEKANKNYSTQFVHRLFEEEGKGIFDARMNVPGHLQQGGNPSPFDRNMGFKMGSKASDWFTQQFE----EPEKHPNS----CLLGIQRWEHKFTPVWELE-PISDFKHRLPCEQWWLNLRPLLRIMAKHESLYTSESIMTGLTK 783          
BLAST of ATP-dependent 6-phosphofructokinase vs. Planmine SMEST
Match: SMESG000074512.1 (SMESG000074512.1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 374/702 (53.28%), Postives = 512/702 (72.93%), Query Frame = 2
Query:  158 EGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPP-KTLLNEPTQIHK---RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIEN 2251
            EGK+I    F+G SIAVLTSGGDSQGMN+AV++VVRMG+YCG++V+F+ EG QGL DGG NI EA W+DVSG++ LGGTVIGSARC+DFKTR G L AAKNLIDR I+NLV+IGGDGSLTGAN F+ EW S + EL+E+  I   + + C +LNIVG+VGSIDNDFCGTDMTIG +SAL RI+EA DA+ +TA SHQRCF++EVMGRHCGYLAL+ A++SEA++VFIPE PP+ +WE  LC+KL+  + + +RVN++++SEGAID++  PIT+  IK++I  ++ IDTR+TVLGHVQRGGNP++FDRIL +R GAEA+ AL+DA  N +  ACVI I  N+ VR PL+ CV KT  +   M    F + V +RG SF  N + Y  L+ L P  + ++ E  +I K   RI I   G  ACG+NA +RS VR+ I      IG+  GF GL       L WN VRG   +GGS++GT R LPS++GF++VA    E +LS +++IGGFEAF+S  EL + + +Y  F+IP+++IPATI+NNIPG  F++G+DT++N I   +D +K  ++GT+ R+++ ET G  CGYL TM  LAGGAD +YI EE   ++ L +DV+ ++AK+ D ++ GL+L N  ++  Y + ++++L+ +EGKGIFD R+N  GH+  GG+ + FDRN+GT+ G +A  W+ + +EN
Sbjct:  143 EGKFIPAGGFQGHSIAVLTSGGDSQGMNAAVKSVVRMGLYCGATVYFVLEGLQGLIDGGLNIREAYWSDVSGMVNLGGTVIGSARCLDFKTRSGRLKAAKNLIDRQISNLVIIGGDGSLTGANIFKQEWTSYIDELIERKVIDSIKKKYCKNLNIVGLVGSIDNDFCGTDMTIGVNSALTRIMEATDALITTAHSHQRCFVIEVMGRHCGYLALITAISSEAQFVFIPEKPPNDNWEDDLCKKLEEAKSSNRRVNLVIISEGAIDMHNQPITAQYIKDIIIDRVKIDTRITVLGHVQRGGNPTSFDRILALREGAEAIHALIDAAQNPSIPACVICIVKNEIVRKPLMDCVSKTLDIQNLMRNGIFVDLVMMRGPSFYRNYKIYEALNVLMPKHRKMVGEGARISKTDTRIGIMCSGTVACGMNAIIRSVVRMAIANDLYPIGIKYGFDGLNKKTITPLLWNDVRGIISMGGSIIGTTRVLPSQIGFEVVASRLLEFKLSALIIIGGFEAFLSGQELWKNKDKYDIFRIPVVIIPATIANNIPGITFAVGSDTTVNVIVNTLDNLKLGSIGTQYRIYITETLGTNCGYLNTMGALAGGADMSYIDEEVLNLESLNQDVNILKAKLFDEIKYGLVLRNNVSHHPYDSHYIFKLFKQEGKGIFDCRHNSIGHVSLGGLTSSFDRNLGTRCGLEAIIWVKDMLEN 844          
BLAST of ATP-dependent 6-phosphofructokinase vs. Planmine SMEST
Match: SMESG000074512.1 (SMESG000074512.1)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 374/702 (53.28%), Postives = 512/702 (72.93%), Query Frame = 2
Query:  158 EGKYIDKDCFKGKSIAVLTSGGDSQGMNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQIKNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEHNLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRSFTNNLETYIKLSKLQPP-KTLLNEPTQIHK---RIAIFNVGAPACGINATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQRGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPFDRNMGTKMGAKASDWLSEQIEN 2251
            EGK+I    F+G SIAVLTSGGDSQGMN+AV++VVRMG+YCG++V+F+ EG QGL DGG NI EA W+DVSG++ LGGTVIGSARC+DFKTR G L AAKNLIDR I+NLV+IGGDGSLTGAN F+ EW S + EL+E+  I   + + C +LNIVG+VGSIDNDFCGTDMTIG +SAL RI+EA DA+ +TA SHQRCF++EVMGRHCGYLAL+ A++SEA++VFIPE PP+ +WE  LC+KL+  + + +RVN++++SEGAID++  PIT+  IK++I  ++ IDTR+TVLGHVQRGGNP++FDRIL +R GAEA+ AL+DA  N +  ACVI I  N+ VR PL+ CV KT  +   M    F + V +RG SF  N + Y  L+ L P  + ++ E  +I K   RI I   G  ACG+NA +RS VR+ I      IG+  GF GL       L WN VRG   +GGS++GT R LPS++GF++VA    E +LS +++IGGFEAF+S  EL + + +Y  F+IP+++IPATI+NNIPG  F++G+DT++N I   +D +K  ++GT+ R+++ ET G  CGYL TM  LAGGAD +YI EE   ++ L +DV+ ++AK+ D ++ GL+L N  ++  Y + ++++L+ +EGKGIFD R+N  GH+  GG+ + FDRN+GT+ G +A  W+ + +EN
Sbjct:   99 EGKFIPAGGFQGHSIAVLTSGGDSQGMNAAVKSVVRMGLYCGATVYFVLEGLQGLIDGGLNIREAYWSDVSGMVNLGGTVIGSARCLDFKTRSGRLKAAKNLIDRQISNLVIIGGDGSLTGANIFKQEWTSYIDELIERKVIDSIKKKYCKNLNIVGLVGSIDNDFCGTDMTIGVNSALTRIMEATDALITTAHSHQRCFVIEVMGRHCGYLALITAISSEAQFVFIPEKPPNDNWEDDLCKKLEEAKSSNRRVNLVIISEGAIDMHNQPITAQYIKDIIIDRVKIDTRITVLGHVQRGGNPTSFDRILALREGAEAIHALIDAAQNPSIPACVICIVKNEIVRKPLMDCVSKTLDIQNLMRNGIFVDLVMMRGPSFYRNYKIYEALNVLMPKHRKMVGEGARISKTDTRIGIMCSGTVACGMNAIIRSVVRMAIANDLYPIGIKYGFDGLNKKTITPLLWNDVRGIISMGGSIIGTTRVLPSQIGFEVVASRLLEFKLSALIIIGGFEAFLSGQELWKNKDKYDIFRIPVVIIPATIANNIPGITFAVGSDTTVNVIVNTLDNLKLGSIGTQYRIYITETLGTNCGYLNTMGALAGGADMSYIDEEVLNLESLNQDVNILKAKLFDEIKYGLVLRNNVSHHPYDSHYIFKLFKQEGKGIFDCRHNSIGHVSLGGLTSSFDRNLGTRCGLEAIIWVKDMLEN 800          
BLAST of ATP-dependent 6-phosphofructokinase vs. Planmine SMEST
Match: SMESG000074570.1 (SMESG000074570.1)

HSP 1 Score: 200.29 bits (508), Expect = 9.783e-59
Identity = 94/203 (46.31%), Postives = 139/203 (68.47%), Query Frame = 2
Query: 1412 INATMRSFVRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRHLPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIPILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIETQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKI 2020
            +NA +RS VR+ I      IG+  GF GL       L WN VRG   +GGS++GT R LPS++GF++VA    E +LS +++IGGFEAF+S  EL + + +Y  F+IP+++IPATI+NNIPG  F++G+DT++N I   +D +K  ++GT+ R+++ ET G  CGYL TM  LAGGAD +YI EE   ++ L +DV+ ++AK+
Sbjct:    1 MNAIIRSVVRMAIANDLYPIGIKYGFDGLNKKTITPLLWNDVRGIISMGGSIIGTTRVLPSQIGFEVVASRLLEFKLSALIIIGGFEAFLSGQELWKNKDKYDIFRIPVVIIPATIANNIPGITFAVGSDTTVNVIVNTLDNLKLGSIGTQYRIYITETLGTNCGYLNTMGALAGGADMSYIDEEVLNLESLNQDVNILKAKL 203          

HSP 2 Score: 72.4034 bits (176), Expect = 4.079e-14
Identity = 60/205 (29.27%), Postives = 102/205 (49.76%), Query Frame = 2
Query:  236 MNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQLGGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGG-DGSLTGANYFRLEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEACDAIS-STAQSHQRCFIMEVMGRHCGYXXXXXXXXSEAEWVFIPE 844
            MN+ +R+VVRM I        IK G+ GL    K I    W DV GI+ +GG++IG+ R +   ++ G    A  L++  ++ L++IGG +  L+G       W +  K+  +  RI            +V +  +I N+  G    +G+D+ ++ I+   D +   +  +  R +I E +G +CGYL  + ALA  A+  +I E
Sbjct:    1 MNAIIRSVVRMAIANDLYPIGIKYGFDGLNK--KTITPLLWNDVRGIISMGGSIIGTTRVL--PSQIGFEVVASRLLEFKLSALIIIGGFEAFLSGQEL----WKN--KDKYDIFRIP-----------VVIIPATIANNIPGITFAVGSDTTVNVIVNTLDNLKLGSIGTQYRIYITETLGTNCGYLNTMGALAGGADMSYIDE 184          
The following BLAST results are available for this feature:
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PFKM3.160e-2759.65phosphofructokinase, muscle [Source:HGNC Symbol;Ac... [more]
PFKM2.787e-2759.65phosphofructokinase, muscle [Source:HGNC Symbol;Ac... [more]
PFKM2.787e-2759.65phosphofructokinase, muscle [Source:HGNC Symbol;Ac... [more]
PFKM2.787e-2759.65phosphofructokinase, muscle [Source:HGNC Symbol;Ac... [more]
PFKM2.787e-2759.65phosphofructokinase, muscle [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pfk-1.10.000e+054.81ATP-dependent 6-phosphofructokinase 1 [Source:Uni... [more]
pfk-1.20.000e+041.36ATP-dependent 6-phosphofructokinase 2 [Source:Uni... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pfk4.132e-2960.88gene:FBgn0003071 transcript:FBtr0088422[more]
Pfk4.079e-2961.56gene:FBgn0003071 transcript:FBtr0088420[more]
Pfk4.009e-2961.17gene:FBgn0003071 transcript:FBtr0304925[more]
Pfk3.564e-2960.49gene:FBgn0003071 transcript:FBtr0088421[more]
Pfk2.871e-2960.68gene:FBgn0003071 transcript:FBtr0333067[more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkpa3.224e-3059.74phosphofructokinase, platelet a [Source:ZFIN;Acc:Z... [more]
pfkma1.241e-2859.15phosphofructokinase, muscle a [Source:ZFIN;Acc:ZDB... [more]
pfkpa2.824e-2960.00phosphofructokinase, platelet a [Source:ZFIN;Acc:Z... [more]
pfkpa3.274e-2959.60phosphofructokinase, platelet a [Source:ZFIN;Acc:Z... [more]
pfkpb0.000e+058.90phosphofructokinase, platelet b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkp0.000e+057.98phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
pfkp0.000e+057.90phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
pfkp0.000e+057.11phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
pfkp0.000e+058.21phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
ENSXETT00000054028.10.000e+059.63phosphofructokinase, muscle [Source:NCBI gene;Acc:... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pfkm4.890e-2759.52phosphofructokinase, muscle [Source:MGI Symbol;Acc... [more]
Pfkm4.890e-2759.52phosphofructokinase, muscle [Source:MGI Symbol;Acc... [more]
Pfkm4.890e-2759.52phosphofructokinase, muscle [Source:MGI Symbol;Acc... [more]
Pfkp0.000e+057.33phosphofructokinase, platelet [Source:MGI Symbol;A... [more]
Pfkp0.000e+057.46phosphofructokinase, platelet [Source:MGI Symbol;A... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27778|PFKA_SCHMA0.000e+065.47ATP-dependent 6-phosphofructokinase OS=Schistosoma... [more]
sp|P52034|PFKA_DROME4.142e-2860.88ATP-dependent 6-phosphofructokinase OS=Drosophila ... [more]
sp|Q0IIG5|PFKAM_BOVIN6.838e-2760.19ATP-dependent 6-phosphofructokinase, muscle type O... [more]
sp|P52784|PFKAM_CANLF9.099e-2759.52ATP-dependent 6-phosphofructokinase, muscle type O... [more]
sp|P08237|PFKAM_HUMAN1.339e-2659.65ATP-dependent 6-phosphofructokinase, muscle type O... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KSW10.000e+067.81ATP-dependent 6-phosphofructokinase OS=Clonorchis ... [more]
A0A3R7FKN40.000e+067.93ATP-dependent 6-phosphofructokinase (Fragment) OS=... [more]
A0A074ZTV80.000e+067.72ATP-dependent 6-phosphofructokinase OS=Opisthorchi... [more]
A0A4S2L9W30.000e+066.67ATP-dependent 6-phosphofructokinase OS=Opisthorchi... [more]
A0A4S2L9610.000e+067.13ATP-dependent 6-phosphofructokinase OS=Opisthorchi... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkma1.472e-2858.84ATP-dependent 6-phosphofructokinase, muscle type-l... [more]
pfkpb0.000e+057.85ATP-dependent 6-phosphofructokinase, platelet type... [more]
pfkmb4.133e-3158.72phosphofructokinase, muscle b [Source:ZFIN;Acc:ZDB... [more]
pfklb0.000e+056.29ATP-dependent 6-phosphofructokinase, liver type [S... [more]
pfkla0.000e+056.69ATP-dependent 6-phosphofructokinase, liver type-li... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007452.10.000e+057.40pep scaffold:Pmarinus_7.0:GL477249:14695:58282:1 g... [more]
ENSPMAT00000005911.11.490e-3152.11pep scaffold:Pmarinus_7.0:GL478489:7235:45113:1 ge... [more]
ENSPMAT00000008968.15.216e-2859.77pep scaffold:Pmarinus_7.0:GL478229:3907:42159:-1 g... [more]
ENSPMAT00000008974.11.038e-1859.29pep scaffold:Pmarinus_7.0:GL478229:3949:42166:-1 g... [more]
ENSPMAT00000007362.11.399e-8966.51pep scaffold:Pmarinus_7.0:GL493177:1250:4583:-1 ge... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PFK20.000e+041.55Beta subunit of heterooctameric phosphofructokinas... [more]
PFK16.364e-2640.77Alpha subunit of heterooctameric phosphofructokina... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040840.10.000e+057.04phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
ENSORLT00000036388.10.000e+057.54phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
ENSORLT00000036480.10.000e+055.95phosphofructokinase, platelet [Source:NCBI gene;Ac... [more]
pfkpa0.000e+059.01ATP-dependent 6-phosphofructokinase, platelet type... [more]
pfkmb0.000e+057.85ATP-dependent 6-phosphofructokinase, muscle type [... [more]
back to top
BLAST of ATP-dependent 6-phosphofructokinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029088.10.000e+099.38SMESG000029088.1[more]
SMESG000028432.10.000e+066.12SMESG000028432.1[more]
SMESG000074512.10.000e+053.28SMESG000074512.1[more]
SMESG000074512.10.000e+053.28SMESG000074512.1[more]
SMESG000074570.19.783e-5946.31SMESG000074570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018823 ID=SMED30018823|Name=ATP-dependent 6-phosphofructokinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2788bp
GACTTATGTACTTATAAATAAATAACTATCTAATAAATAATTTATTTTAG
AGAACTTAATTTTATTAGCGTTTAATTATTTTAACATGGATCTTTCAGAA
AAACTTGATCGAAAATTATTAACTAGAAGACAAACACTAACGGCTCAACC
GGGTATGGAAGGAAAATATATAGATAAAGATTGCTTCAAAGGTAAAAGTA
TAGCAGTTTTAACCAGCGGTGGTGATTCCCAAGGTATGAATTCTGCTGTT
AGAGCTGTTGTTCGAATGGGGATTTATTGCGGGTCTTCTGTTTTCTTTAT
TAAAGAAGGATATCAAGGATTATGTGATGGGGGTAAGAATATTGTAGAAG
CTACATGGGCAGACGTTTCTGGAATTATGCAATTGGGTGGTACTGTTATT
GGATCGGCGCGATGCATGGATTTTAAGACAAGAGAAGGATTATTAAACGC
TGCAAAAAATTTGATTGATAGAAACATTAACAATCTTGTTGTTATTGGAG
GCGATGGTTCTTTGACTGGTGCAAATTATTTTCGTTTAGAATGGAATTCT
CTTTTAAAGGAATTATTAGAACAAAATCGAATTACTCAAGGACAAATCGA
AAAATGTAGTCATTTAAATATTGTAGGAATGGTTGGAAGTATTGACAATG
ATTTTTGTGGAACTGATATGACAATCGGAACGGACAGTGCATTGCATAGA
ATTATTGAAGCTTGTGACGCTATTTCATCAACAGCTCAAAGTCATCAAAG
ATGTTTTATCATGGAAGTGATGGGACGTCATTGTGGCTATCTGGCATTAG
TCGCAGCTTTAGCAAGTGAAGCAGAATGGGTATTTATTCCTGAAATGCCG
CCATCGCTTGATTGGGAAGCTAAATTATGCCAGAAATTAAAAATAAATCG
AGATAATGGCCAACGGGTTAATATCATTTTAGTATCGGAAGGTGCAATCG
ACATCAATTGCAATCCAATTACATCTGATCAAATAAAAAATCTGATTACG
TCTCAATTGAATATCGATACCAGAGTAACGGTTCTCGGTCATGTCCAACG
CGGAGGTAATCCGTCGGCATTCGATAGAATTCTCGGAATTAGGATGGGAG
CCGAAGCTGTTCTTGCTCTCATGGACGCTGAACATAATTTAAACTCAGAA
GCGTGTGTAATTTCAATTGATGGCAACCAAACCGTTCGTGTGCCGTTGTT
ACGGTGCGTGGAAAAGACTAGAGCAGTTGGAGAAGCTATGAATGCGAAAA
ATTTTGAAGAAGCCGTCAAATTGAGAGGAAGGAGTTTTACAAACAATTTG
GAGACATACATTAAACTATCGAAACTCCAACCTCCCAAAACTCTGCTGAA
TGAACCAACACAGATTCATAAAAGAATTGCAATTTTTAATGTCGGTGCCC
CTGCTTGTGGTATCAATGCGACAATGAGAAGTTTTGTCAGGCTTATGATT
ACCAAAGGATATGAGATTATTGGAGTTCATGGGGGATTCAAAGGTCTCAT
TGATGACGACAAAGAAGATTTAACATGGAATCGGGTCCGAGGTTGGGCCG
GACTTGGCGGATCGATGCTTGGCACTAGAAGACATTTACCATCAGAAGTC
GGTTTCGACATTGTTGCCAAATATTTCCGGGAACTCCGGTTAAGTGGCAT
TCTTGTGATTGGTGGTTTTGAAGCTTTCATTAGCGTATGTGAATTAAATG
AAAAGCGACAGGAATATCCAGAATTTCAAATTCCTATATTGGTAATACCG
GCTACAATTAGTAATAATATTCCCGGTACGGATTTCTCTCTGGGGGCTGA
CACTTCGTTGAATGAGATAACTCGGATTGTCGATAAAATAAAACAAAGTG
CTGTTGGAACTAAACGTCGTGTATTTGTTATCGAAACACAAGGAGGTTAT
TGTGGGTATTTAGCAACTATGAGCGGTTTGGCTGGAGGAGCTGACGCTGC
ATACATCCACGAGGAAGAATTTGGTATAGATGATTTACGGAAAGATGTTG
ACCACATGCGAGCAAAAATCGAAGACAACGTTCAAAGAGGCCTTATATTA
ATTAACGAAAAAGCCAACGTAAATTATTCAACAGATTTTGTCTATCGTTT
ATATAGCGAAGAAGGAAAAGGAATTTTCGATACAAGATATAATATTCCTG
GTCATATTCAACAGGGAGGTGTACCGACCCCTTTTGATAGAAACATGGGC
ACTAAAATGGGAGCGAAAGCCAGTGATTGGTTGTCAGAGCAAATTGAAAA
CTCTGCAAATGAATCTGGTGTCAAAACCAACTCCAATGACACCATTTGTC
TGCTTGGATTGACAAAACGACAAATGACATTCACTCCCGTTTCGGAATTA
TTTATTCGAGAAACGGATTTCAAACATCGTATTCCAATAAATCAGTGGTG
GTTAAATCTACGTCCACTGATGCGTATCATGGCCAAACATCAAAGTTTAT
ACGAATCAGAAAGTATTATGTGTGGTTTAGAGAAGAACTAGATATATCTT
TCTTTAAATTGGCACAGTTATAATATTTATCTTTATTAATTTGACAGAGC
TAGCTACTTTGTTTATTTTGTCCTATTTCCCACGATTCTAGCTGATGACT
ATTTTAAAATTTTTGAGATGTTATCAAAGAACATTATCTTTATTGGTTCA
TTATTTTAACCTTAGGATTTTTATTACTTTGTACCTCAATACAAGTTAAA
TCAAATGTTTTTATTTCAATTTTGAATGTCTATCAACATTTTTCAATATA
TTATCTGGCTTTAGTTTATATATATATATATATATATA
back to top

protein sequence of SMED30018823-orf-1

>SMED30018823-orf-1 ID=SMED30018823-orf-1|Name=SMED30018823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=802bp
MDLSEKLDRKLLTRRQTLTAQPGMEGKYIDKDCFKGKSIAVLTSGGDSQG
MNSAVRAVVRMGIYCGSSVFFIKEGYQGLCDGGKNIVEATWADVSGIMQL
GGTVIGSARCMDFKTREGLLNAAKNLIDRNINNLVVIGGDGSLTGANYFR
LEWNSLLKELLEQNRITQGQIEKCSHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIIEACDAISSTAQSHQRCFIMEVMGRHCGYLALVAALASEAEWVF
IPEMPPSLDWEAKLCQKLKINRDNGQRVNIILVSEGAIDINCNPITSDQI
KNLITSQLNIDTRVTVLGHVQRGGNPSAFDRILGIRMGAEAVLALMDAEH
NLNSEACVISIDGNQTVRVPLLRCVEKTRAVGEAMNAKNFEEAVKLRGRS
FTNNLETYIKLSKLQPPKTLLNEPTQIHKRIAIFNVGAPACGINATMRSF
VRLMITKGYEIIGVHGGFKGLIDDDKEDLTWNRVRGWAGLGGSMLGTRRH
LPSEVGFDIVAKYFRELRLSGILVIGGFEAFISVCELNEKRQEYPEFQIP
ILVIPATISNNIPGTDFSLGADTSLNEITRIVDKIKQSAVGTKRRVFVIE
TQGGYCGYLATMSGLAGGADAAYIHEEEFGIDDLRKDVDHMRAKIEDNVQ
RGLILINEKANVNYSTDFVYRLYSEEGKGIFDTRYNIPGHIQQGGVPTPF
DRNMGTKMGAKASDWLSEQIENSANESGVKTNSNDTICLLGLTKRQMTFT
PVSELFIRETDFKHRIPINQWWLNLRPLMRIMAKHQSLYESESIMCGLEK
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR035966PKF_sf
IPR022953ATP_PFK
IPR000023Phosphofructokinase_dom
IPR0091616-Pfructokinase_euk
IPR015912Phosphofructokinase_CS
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
GO:0006002fructose 6-phosphate metabolic process
GO:0008152metabolic process
GO:0016310phosphorylation
GO:0061615glycolytic process through fructose-6-phosphate
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:00038726-phosphofructokinase activity
GO:0000166nucleotide binding
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 631..651
NoneNo IPR availableGENE3DG3DSA:3.40.50.450coord: 431..762
e-value: 1.6E-147
score: 492.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.460coord: 202..408
e-value: 9.0E-177
score: 589.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.450coord: 37..384
e-value: 9.0E-177
score: 589.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.460coord: 573..779
e-value: 1.6E-147
score: 492.8
NoneNo IPR availablePANTHERPTHR13697PHOSPHOFRUCTOKINASEcoord: 33..789
IPR022953ATP-dependent 6-phosphofructokinasePRINTSPR00476PHFRCTKINASEcoord: 41..60
score: 77.69
coord: 236..253
score: 54.84
coord: 275..287
score: 51.28
coord: 309..331
score: 72.35
coord: 66..79
score: 53.48
coord: 130..146
score: 68.78
coord: 180..197
score: 70.8
coord: 198..216
score: 52.5
coord: 218..234
score: 69.83
IPR009161ATP-dependent 6-phosphofructokinase, eukaryotic-typeTIGRFAMTIGR02478TIGR02478coord: 37..786
e-value: 0.0
score: 1101.4
IPR009161ATP-dependent 6-phosphofructokinase, eukaryotic-typePIRSFPIRSF000533ATP_PFK_eukcoord: 4..793
e-value: 0.0
score: 1102.3
IPR000023Phosphofructokinase domainPFAMPF00365PFKcoord: 430..716
e-value: 2.7E-87
score: 292.7
coord: 39..344
e-value: 1.6E-109
score: 365.7
IPR015912Phosphofructokinase, conserved sitePROSITEPS00433PHOSPHOFRUCTOKINASEcoord: 684..702
IPR015912Phosphofructokinase, conserved sitePROSITEPS00433PHOSPHOFRUCTOKINASEcoord: 313..331
IPR035966Phosphofructokinase superfamilySUPERFAMILYSSF53784Phosphofructokinasecoord: 35..406
IPR035966Phosphofructokinase superfamilySUPERFAMILYSSF53784Phosphofructokinasecoord: 362..791