Sperm flagellar protein 1

Overview
NameSperm flagellar protein 1
Smed IDSMED30018815
Uniprot Best hitSperm flagellar protein 1 OS=Homo sapiens OX=9606 GN=SPEF1 PE=1 SV=3 (E=1.65143e-51)
Length (bp)732
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sperm flagellar protein 1 (SMED30018815) t-SNE clustered cells

Violin plots show distribution of expression levels for Sperm flagellar protein 1 (SMED30018815) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sperm flagellar protein 1 (SMED30018815) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sperm flagellar protein 1 (SMED30018815) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018815

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018815SMESG000014677.1 SmedASXL_000726SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018815SMESG000014677.1 dd_Smed_v4_5648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018815SMESG000014677.1 dd_Smed_v4_5648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018815SMESG000014677.1 dd_Smed_v4_5648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018815SMESG000014677.1 dd_Smed_v6_5648_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018815SMESG000014677.1 dd_Smed_v4_5648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30018815SMESG000014677.1 dd_Smed_v4_5648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sperm flagellar protein 1 vs. Ensembl Human
Match: SPEF1 (sperm flagellar 1 [Source:HGNC Symbol;Acc:HGNC:15874])

HSP 1 Score: 170.629 bits (431), Expect = 3.439e-52
Identity = 99/229 (43.23%), Postives = 138/229 (60.26%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSAR---PTD------------EKSESFPD---SSSVSRDEP--------HRA--GPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            + +DEE L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K  K+LNF + DDV+  +     G +E VL+ +R +++     +K    S +   P D             + E  PD      +S D P        +RA  G P+ +   +QI E +QE LA  ET+++LQ K+R+LEHLL+LK++RIEDL +RL
Sbjct:    3 SSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDPSFV---LQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRL 228          
BLAST of Sperm flagellar protein 1 vs. Ensembl Human
Match: SPATA4 (spermatogenesis associated 4 [Source:HGNC Symbol;Acc:HGNC:17333])

HSP 1 Score: 55.4546 bits (132), Expect = 1.719e-8
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 3
Query:   81 WVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIE 338
            W+  + LS   +NI+RDFS+G L+AEI   Y+P  +E+ S+    SL  K  NW  L  K   +  F+L  ++I   I  KAG  E
Sbjct:   58 WLQGLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLE-KFLARKKFKLPKELIHGTIHCKAGVPE 142          
BLAST of Sperm flagellar protein 1 vs. Ensembl Fly
Match: CG12395 (gene:FBgn0030722 transcript:FBtr0074260)

HSP 1 Score: 66.2402 bits (160), Expect = 1.160e-12
Identity = 51/204 (25.00%), Postives = 104/204 (50.98%), Query Frame = 3
Query:   45 DIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRAG---PPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLG 647
            ++  E L+++  W+    +S  +  + R+FSD + +AEI K  +P+L+++ +YP  +S+  K  NW   N+K   KLN  L+ D +  + +  +G  E +L  V     R   A++ +  +A   ++  E   +  +V  ++    G    P  +      E+ +++  AKD  I+  Q ++  +E +++LK  RI++L  ++G
Sbjct:    8 NLSREELEEVNKWMQQNSISTQR--LRREFSDVLPLAEIFKRDYPRLVDLFNYPKKSSVQLKLANWETFNFKVLSKLNMTLTKDFMEQMANGVSGAAEVMLHEVIRLEKRQRLAEQRN--AALRQEQLWEENDEIKTVVVNKQIGDGIVQVPQKMILYSLYEKVERDSHAKDVIIDAYQQRLTHMESIIKLKTERIDELLMQMG 207          
BLAST of Sperm flagellar protein 1 vs. Ensembl Fly
Match: CG16719 (gene:FBgn0036029 transcript:FBtr0076394)

HSP 1 Score: 53.5286 bits (127), Expect = 3.413e-8
Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  126 RDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVL 347
            R FSD + +A+IVK   P+L+++H+Y   +S+  K ++W   N K  KKL   L+   +  L  A  G IE + 
Sbjct:   26 RSFSDVLPVAKIVKRSHPRLVDLHNYTPKSSVALKLQSWQTFNQKVLKKLGINLTRSELEQLASAAPGAIESLF 99          
BLAST of Sperm flagellar protein 1 vs. Ensembl Zebrafish
Match: zgc:66426 (zgc:66426 [Source:ZFIN;Acc:ZDB-GENE-040426-1639])

HSP 1 Score: 173.711 bits (439), Expect = 9.711e-54
Identity = 96/217 (44.24%), Postives = 133/217 (61.29%), Query Frame = 3
Query:   48 IDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNS--------------SARPTDEKSESFPDSSSVSRDEPHRA----GPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            +DEE LQDLYAW+D IPLSRPK+NI+RDFSDGV+ AE+VKH+FPKL+E+H+Y   +S  QK+ NW  LN K F KLNF + +D +  ++ +  G IE  L  +R K++     K+ D++              S         S  + ++V + E  RA    GP  + + R+ +EE +Q  LA  ET+ ILQ K+ +LEHL+ LKDLRIEDL K L
Sbjct:    7 LDEETLQDLYAWIDKIPLSRPKRNITRDFSDGVMAAEVVKHFFPKLVELHNYTPAHSTQQKQSNWITLNRKVFSKLNFHIPEDTVKKIVVSTPGYIEPALCSLREKIEEKKEGKQPDSAQDLEYYTTSDGQQGSGNHVMVIEPSHLNPATVKKTEKVRAAGTIGPNVDPAVRLLLEEKEQAILALQETVGILQIKVNRLEHLVHLKDLRIEDLTKHL 223          
BLAST of Sperm flagellar protein 1 vs. Ensembl Zebrafish
Match: zgc:66426 (zgc:66426 [Source:ZFIN;Acc:ZDB-GENE-040426-1639])

HSP 1 Score: 132.88 bits (333), Expect = 7.324e-38
Identity = 75/186 (40.32%), Postives = 108/186 (58.06%), Query Frame = 3
Query:   57 EVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNS--------------SARPTDEKSESFPDSSSVSRDEPHRA----GPPANISARIQIEEYKQECLAKDETI 560
            E LQDLYAW+D IPLSRPK+NI+RDFSDGV+ AE+VKH+FPKL+E+H+Y   +S  QK+ NW  LN K F KLNF + +D +  ++ +  G IE  L  +R K++     K+ D++              S         S  + ++V + E  RA    GP  + + R+ +EE +Q  LA  ET+
Sbjct:    1 ETLQDLYAWIDKIPLSRPKRNITRDFSDGVMAAEVVKHFFPKLVELHNYTPAHSTQQKQSNWITLNRKVFSKLNFHIPEDTVKKIVVSTPGYIEPALCSLREKIEEKKEGKQPDSAQDLEYYTTSDGQQGSGNHVMVIEPSHLNPATVKKTEKVRAAGTIGPNVDPAVRLLLEEKEQAILALQETV 186          
BLAST of Sperm flagellar protein 1 vs. Ensembl Zebrafish
Match: spata4 (spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-GENE-050417-153])

HSP 1 Score: 65.855 bits (159), Expect = 1.639e-12
Identity = 35/99 (35.35%), Postives = 55/99 (55.56%), Query Frame = 3
Query:   66 QDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRT 362
            +++  W+ ++ LS   KN+ RDFS+G L+AEI   YFP+  ++HS+    SL  K+ NW  +  K F K N  L  ++I   I  K G  E ++  + T
Sbjct:   14 REVLKWLQSLDLSFFPKNVRRDFSNGYLVAEIFSWYFPRDFQMHSFDNGTSLAAKQSNWSQIE-KFFVKQNISLVKEMIDGTIHCKPGAAELLVQEIYT 111          
BLAST of Sperm flagellar protein 1 vs. Ensembl Zebrafish
Match: spata4 (spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-GENE-050417-153])

HSP 1 Score: 65.855 bits (159), Expect = 1.639e-12
Identity = 35/99 (35.35%), Postives = 55/99 (55.56%), Query Frame = 3
Query:   66 QDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRT 362
            +++  W+ ++ LS   KN+ RDFS+G L+AEI   YFP+  ++HS+    SL  K+ NW  +  K F K N  L  ++I   I  K G  E ++  + T
Sbjct:   14 REVLKWLQSLDLSFFPKNVRRDFSNGYLVAEIFSWYFPRDFQMHSFDNGTSLAAKQSNWSQIE-KFFVKQNISLVKEMIDGTIHCKPGAAELLVQEIYT 111          
BLAST of Sperm flagellar protein 1 vs. Ensembl Zebrafish
Match: spata4 (spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-GENE-050417-153])

HSP 1 Score: 65.855 bits (159), Expect = 1.639e-12
Identity = 35/99 (35.35%), Postives = 55/99 (55.56%), Query Frame = 3
Query:   66 QDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRT 362
            +++  W+ ++ LS   KN+ RDFS+G L+AEI   YFP+  ++HS+    SL  K+ NW  +  K F K N  L  ++I   I  K G  E ++  + T
Sbjct:   14 REVLKWLQSLDLSFFPKNVRRDFSNGYLVAEIFSWYFPRDFQMHSFDNGTSLAAKQSNWSQIE-KFFVKQNISLVKEMIDGTIHCKPGAAELLVQEIYT 111          
BLAST of Sperm flagellar protein 1 vs. Ensembl Xenopus
Match: SPEF1 (sperm flagellar 1 [Source:NCBI gene;Acc:100492226])

HSP 1 Score: 172.94 bits (437), Expect = 9.726e-53
Identity = 91/228 (39.91%), Postives = 141/228 (61.84%), Query Frame = 3
Query:   45 DIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRA-------------------------GPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDL 653
            + DEE LQ+LY+WVD IPLSRPK+NI+RDFSDGVL AE+VK YFPK++E+H+Y   NS TQK  NW++LN K   KL+F + DDVI  ++    G +E VL  +R K++     ++ +  SA  + E++    +++++  D+ +++                            A+ + R Q+ E +Q  +   ETI+ILQAK+R++E LL+LK++RI+DL +RL +L
Sbjct:   48 EFDEETLQELYSWVDRIPLSRPKRNIARDFSDGVLTAELVKFYFPKIVEMHNYVPANSTTQKFSNWNILNRKVLSKLSFSVPDDVIRKIVQCSPGVVELVLNTLRQKIEE---KQRVNQISAEFSQEQAPQ--NTTNIHSDKAYKSNGTELSPRPGAKADPASKTHQGYAQAANADTALRFQLAEKEQALILSQETIQILQAKLRRMEQLLQLKNVRIDDLTRRLQEL 270          
BLAST of Sperm flagellar protein 1 vs. Ensembl Xenopus
Match: tbc1d19 (TBC1 domain family member 19 [Source:Xenbase;Acc:XB-GENE-5905231])

HSP 1 Score: 61.2326 bits (147), Expect = 1.616e-10
Identity = 34/96 (35.42%), Postives = 52/96 (54.17%), Query Frame = 3
Query:   60 VLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVL 347
            V +++  W+ ++ LS   KN  RDF++G L+AEI   YFP+ I++HSY    SL  +  NW  L  K F K N ++   +I   I  K    E ++
Sbjct:   38 VPREVLKWLQSLDLSFSPKNFRRDFANGYLIAEIFYWYFPEDIQLHSYENGTSLANRLSNWSQLE-KFFMKRNLKVPKALIDGTIHCKPEAAELII 132          
BLAST of Sperm flagellar protein 1 vs. Ensembl Mouse
Match: Spef1 (sperm flagellar 1 [Source:MGI Symbol;Acc:MGI:3513546])

HSP 1 Score: 168.703 bits (426), Expect = 1.218e-51
Identity = 93/224 (41.52%), Postives = 132/224 (58.93%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSAR---------------PTDEKSESFPDSSSVSRD-EPHRAGPP-------ANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            + +DEE L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K   KLNF + DDV+  +     G +E VL+ +R +++     +K    S +               P   + E  P      R+  P  + PP        + S  +QI E +QE LA  ET+++LQ K+++LEHLL+LK++RI+DL +RL
Sbjct:    3 SSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQELAPQDSSGYMDMGLPQKVRGEGAPALGEQLREGRPLASRPPGYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRL 226          
BLAST of Sperm flagellar protein 1 vs. Ensembl Mouse
Match: Spef1 (sperm flagellar 1 [Source:MGI Symbol;Acc:MGI:3513546])

HSP 1 Score: 168.703 bits (426), Expect = 1.218e-51
Identity = 93/224 (41.52%), Postives = 132/224 (58.93%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSAR---------------PTDEKSESFPDSSSVSRD-EPHRAGPP-------ANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            + +DEE L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K   KLNF + DDV+  +     G +E VL+ +R +++     +K    S +               P   + E  P      R+  P  + PP        + S  +QI E +QE LA  ET+++LQ K+++LEHLL+LK++RI+DL +RL
Sbjct:    3 SSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQELAPQDSSGYMDMGLPQKVRGEGAPALGEQLREGRPLASRPPGYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRL 226          
BLAST of Sperm flagellar protein 1 vs. Ensembl Mouse
Match: Spef1 (sperm flagellar 1 [Source:MGI Symbol;Acc:MGI:3513546])

HSP 1 Score: 122.479 bits (306), Expect = 2.111e-34
Identity = 55/98 (56.12%), Postives = 69/98 (70.41%), Query Frame = 3
Query:   57 EVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLL 350
            E L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K   KLNF + DDV+  +     G +E VL+
Sbjct:    2 EALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVPDDVMRKIAQCSPGVVELVLI 99          
BLAST of Sperm flagellar protein 1 vs. Ensembl Mouse
Match: Spef1l (sperm flagellar 1 like [Source:MGI Symbol;Acc:MGI:2685939])

HSP 1 Score: 118.242 bits (295), Expect = 2.109e-31
Identity = 88/273 (32.23%), Postives = 128/273 (46.89%), Query Frame = 3
Query:   63 LQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSY-PACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESF--------------------PDSSSVSRDEP-------------------------HRAG---PPANISARIQIEEYKQE----CLAKDETIE----------------------------ILQAKIRKLEHLLELKDLRIEDLQK 638
            + +L AW+D +PLSRPK++++RDFSDGVL+AEIVKH+ P+L+++HSY PAC S  QK  NW LLN K F+KL+  +SD+ I  ++  + G IE +L  +R KM+    A+     SA   D +  +                     PD  + S  EP                          +AG   PPA  S +I   +   E    C  + ++IE                            ILQ K+ +LEHL++LKD RI +L +
Sbjct:   19 IHNLCAWLDRLPLSRPKRHLARDFSDGVLVAEIVKHFRPRLVDLHSYVPAC-STDQKLSNWSLLNRKVFRKLHLCISDNDIQRVVSNRPGVIESILCALREKME----ARTVHVGSAGTADPRHSAVDAVRPWRDLTPNPHTSKMQDPDVDNSSLSEPLWDSGGEHHSVPESWVHDVELPNLQKKAGLQSPPAPSSTKILQNQRDLEKMGCCACRGDSIEGLWDHLVSIQQQLEDKEQALAILQETVKILQLKVMRLEHLVQLKDQRIWELMR 286          
BLAST of Sperm flagellar protein 1 vs. Ensembl Mouse
Match: Spef1l (sperm flagellar 1 like [Source:MGI Symbol;Acc:MGI:2685939])

HSP 1 Score: 114.775 bits (286), Expect = 8.464e-31
Identity = 54/104 (51.92%), Postives = 78/104 (75.00%), Query Frame = 3
Query:   63 LQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSY-PACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMD 371
            + +L AW+D +PLSRPK++++RDFSDGVL+AEIVKH+ P+L+++HSY PAC S  QK  NW LLN K F+KL+  +SD+ I  ++  + G IE +L  +R KM+
Sbjct:   19 IHNLCAWLDRLPLSRPKRHLARDFSDGVLVAEIVKHFRPRLVDLHSYVPAC-STDQKLSNWSLLNRKVFRKLHLCISDNDIQRVVSNRPGVIESILCALREKME 121          
BLAST of Sperm flagellar protein 1 vs. UniProt
Match: sp|Q9Y4P9|SPEF1_HUMAN (Sperm flagellar protein 1 OS=Homo sapiens OX=9606 GN=SPEF1 PE=1 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 1.651e-51
Identity = 99/229 (43.23%), Postives = 138/229 (60.26%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSAR---PTD------------EKSESFPD---SSSVSRDEP--------HRA--GPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            + +DEE L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K  K+LNF + DDV+  +     G +E VL+ +R +++     +K    S +   P D             + E  PD      +S D P        +RA  G P+ +   +QI E +QE LA  ET+++LQ K+R+LEHLL+LK++RIEDL +RL
Sbjct:    3 SSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDPSFV---LQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRL 228          
BLAST of Sperm flagellar protein 1 vs. UniProt
Match: sp|Q58DA1|SPEF1_BOVIN (Sperm flagellar protein 1 OS=Bos taurus OX=9913 GN=SPEF1 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.285e-51
Identity = 95/226 (42.04%), Postives = 131/226 (57.96%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSAR---PTD------------EKSESFPDSSSVSRDEPHR---AGPPANISAR-------IQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
              +DEE L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K   KLNF + +DV+  +     G +E VL+ +R +++     +K    S +   P D             + E  PD     +    R     PP +  A        +QI E +QE LA  ET+++LQ K+R+LEHLL+LK++RIEDL +RL
Sbjct:    3 GSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWSHLNRKVLNKLNFSVPEDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGIGSLQELAPQDGTDYMDVGLSQKARGEGVPDPQGRGQLREGRLPVPRPPGDSQALQSDPSFILQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRL 228          
BLAST of Sperm flagellar protein 1 vs. UniProt
Match: sp|Q99JL1|SPEF1_MOUSE (Sperm flagellar protein 1 OS=Mus musculus OX=10090 GN=Spef1 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.518e-51
Identity = 93/224 (41.52%), Postives = 132/224 (58.93%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSAR---------------PTDEKSESFPDSSSVSRD-EPHRAGPP-------ANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            + +DEE L  LY WVD IPLSRPK+N+SRDFSDGVL+AE++K YFPK++E+H+Y   NSL QK  NW  LN K   KLNF + DDV+  +     G +E VL+ +R +++     +K    S +               P   + E  P      R+  P  + PP        + S  +QI E +QE LA  ET+++LQ K+++LEHLL+LK++RI+DL +RL
Sbjct:    3 SSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAELIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLNKLNFSVPDDVMRKIAQCSPGVVELVLIPLRQRLEERQRRQKLGVGSLQELAPQDSSGYMDMGLPQKVRGEGAPALGEQLREGRPLASRPPGYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRL 226          
BLAST of Sperm flagellar protein 1 vs. UniProt
Match: sp|Q0IH24|SPEF1_XENLA (Sperm flagellar protein 1 OS=Xenopus laevis OX=8355 GN=spef1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.230e-48
Identity = 97/223 (43.50%), Postives = 134/223 (60.09%), Query Frame = 3
Query:   45 DIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMD--RMLFAKKYDNSSARPTDEKSESFPD------SSSVSRDEPHRAGPP------------ANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDL 653
            + DEE +Q+LY WVDTIPLSRPK+NI+RDFSDGVL AE+VK YFPKL+E+H+Y   NS TQK  NW +LN K   KL+F + DDVI  ++    G +E VL  +R K++  + L     D S  + T     +  D       + +S  +  R  P             A+ + R Q+ E +Q  +   ETI+ILQAK+R+LE LL LK++RI+DL +RL +L
Sbjct:    4 EFDEETMQELYTWVDTIPLSRPKRNIARDFSDGVLTAELVKFYFPKLVEMHNYVPANSTTQKLSNWTILNRKVLSKLSFSVPDDVIRKIVQCSPGVVELVLNTLRQKIEEKQRLHHISADLSQDQATQNNGNTHSDKGYKSNGTELSPRQGARVDPASKTHQGYAQAANADTTLRFQLAEKEQTLILSQETIQILQAKLRRLEQLLLLKNVRIDDLTRRLQEL 226          
BLAST of Sperm flagellar protein 1 vs. UniProt
Match: sp|Q6DMN8|SPAT4_PANTR (Spermatogenesis-associated protein 4 OS=Pan troglodytes OX=9598 GN=SPATA4 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 6.000e-8
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 3
Query:   81 WVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIE 338
            W+  + LS   +NI+RDFS+G L+AEI   Y+P  +E+ S+    SL  K  NW  L  K   +  F+L  ++I   I  KAG  E
Sbjct:   58 WLQGLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLGNWAQLE-KFLARKKFKLPKELIHGTIHCKAGVPE 142          
BLAST of Sperm flagellar protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18328542 (tr|A0A267DQ60|A0A267DQ60_9PLAT Calponin-homology (CH) domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003943g1 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.266e-89
Identity = 141/235 (60.00%), Postives = 173/235 (73.62%), Query Frame = 3
Query:   33 SAMNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHR----AG-------PPANIS------------ARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQ 668
            S M +ID+EVLQDLYAW+D IPLSRPKKNI+RDFSDGVLMAE+VKHYFP+L+++H++  CN+  QKKKNW LLNWK FKKLNFELS+DVI ++I+AKAGTIERVLLL+RTKMDR L+ +K  ++S  P  +++      + VS+  P R    AG       PP   S             R+  EE  QECLAKDET+EILQAKIR+LEHLL LKD+RI+DLQ RL +LRPTGQ
Sbjct:    3 SGMAEIDDEVLQDLYAWIDQIPLSRPKKNIARDFSDGVLMAEVVKHYFPRLVDLHNFNPCNNTEQKKKNWMLLNWKTFKKLNFELSNDVIDSIINAKAGTIERVLLLLRTKMDRSLYEEKAAHASDAPEADQASLRHGGAGVSKMSPSRSPKAAGYGRPTQQPPPRKSESLQNIGQSDYVTRLAYEEKVQECLAKDETVEILQAKIRRLEHLLHLKDVRIDDLQSRLEELRPTGQ 237          
BLAST of Sperm flagellar protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18203184 (tr|A0A267DKR7|A0A267DKR7_9PLAT Calponin-homology (CH) domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003943g2 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 2.464e-89
Identity = 140/234 (59.83%), Postives = 174/234 (74.36%), Query Frame = 3
Query:   33 SAMNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHR----AG-------PP-----------ANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQ 668
            S M +ID+EVLQDLYAW+D IPLSRPKKNI+RDFSDGVLMAE+VKHYFP+L+++H++  CN+  QKKKNW LLNWK FKKLNFELS+DVI ++I+AKAGTIERVLLL+RTKMDR L+ +K  ++S  P  +++      + VS+  P R    AG       PP           ++   R+  EE  QECLAKDET+EILQAKIR+LEHLL LKD+RI+DLQ RL +LRPTGQ
Sbjct:    3 SRMAEIDDEVLQDLYAWIDQIPLSRPKKNIARDFSDGVLMAEVVKHYFPRLVDLHNFNPCNNTEQKKKNWMLLNWKTFKKLNFELSNDVIDSIINAKAGTIERVLLLLRTKMDRSLYEEKAAHASDAPEADQASLRHGGAGVSKMSPSRSPKAAGYGRPTQQPPRKSESLQNIGQSDYVTRLAYEEKVQECLAKDETVEILQAKIRRLEHLLHLKDVRIDDLQSRLEELRPTGQ 236          
BLAST of Sperm flagellar protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18289284 (tr|A0A1I8FZU0|A0A1I8FZU0_9PLAT Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 7.255e-89
Identity = 140/233 (60.09%), Postives = 172/233 (73.82%), Query Frame = 3
Query:   39 MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHR----AG-------PPANIS------------ARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQ 668
            M +ID+EVLQDLYAW+D IPLSRPKKNI+RDFSDGVLMAE+VKHYFP+L+++H++  CN+  QKKKNW LLNWK FKKLNFELS+DVI ++I+AKAGTIERVLLL+RTKMDR L+ +K  ++S  P  +++      + VS+  P R    AG       PP   S             R+  EE  QECLAKDET+EILQAKIR+LEHLL LKD+RI+DLQ RL +LRPTGQ
Sbjct:    1 MAEIDDEVLQDLYAWIDQIPLSRPKKNIARDFSDGVLMAEVVKHYFPRLVDLHNFNPCNNTEQKKKNWMLLNWKTFKKLNFELSNDVIDSIINAKAGTIERVLLLLRTKMDRSLYEEKAAHASDAPEADQASLRHGGAGVSKMSPSRSPKAAGYGRPTQQPPPRKSESLQNIGQSDYVTRLAYEEKVQECLAKDETVEILQAKIRRLEHLLHLKDVRIDDLQSRLEELRPTGQ 233          
BLAST of Sperm flagellar protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18302769 (tr|A0A1I8GCD9|A0A1I8GCD9_9PLAT Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.021e-83
Identity = 139/235 (59.15%), Postives = 172/235 (73.19%), Query Frame = 3
Query:   33 SAMNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRA-----------GPPANIS------------ARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQ 668
            S M +ID+EVLQDLYAW+D IPLSRPKKNI+RDFSDGVLMAE+VKHYFP+L+++H++  CN+  QKKKNW LLNWK FKKLNFELS+DVI ++I+AKAGTIERVLLL+RTKMDR L+ +K  ++S  P  +++      + VS+  P R+            PP   S             R+  EE  QECLAKDET+EILQAKIR+LEHLL LKD+RI+DLQ RL +LRPTGQ
Sbjct:   63 SGMAEIDDEVLQDLYAWIDQIPLSRPKKNIARDFSDGVLMAEVVKHYFPRLVDLHNFNPCNNTEQKKKNWMLLNWKTFKKLNFELSNDVIDSIINAKAGTIERVLLLLRTKMDRSLYEEKAAHASDAPEADQASLRHGGAGVSKMSPSRSPKAAGYGRPTQQPPPRKSESLQNIGQSDYVTRLAYEEKVQECLAKDETVEILQAKIRRLEHLLHLKDVRIDDLQSRLEELRPTGQ 297          
BLAST of Sperm flagellar protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15779696 (tr|A0A1I8GVA3|A0A1I8GVA3_9PLAT Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008675g2 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 2.756e-77
Identity = 126/235 (53.62%), Postives = 164/235 (69.79%), Query Frame = 3
Query:   39 MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSS--------------VSRDEPHRAGPPANIS------------ARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTG 665
            M +ID++VLQDLY W+D IPLSRPK++I+RDFSDGVLMAE+VKHY PKL+++H++ ACN+  QKKKNW LLNWK FKKL+FELS DVI  L +AK GTIERVLLL+RTK+D+ LF ++   S+  P  ++ ++   +SS               +R +    G P   S             R++ EE  QE LAK ETI+IL+AKIR+LEHLL LKD+RI++LQ RLG+LRPTG
Sbjct:    1 MTEIDDDVLQDLYGWIDQIPLSRPKRSIARDFSDGVLMAEVVKHYCPKLVDLHNFSACNATDQKKKNWLLLNWKIFKKLSFELSPDVIDALANAKPGTIERVLLLLRTKLDKSLFQQQRPASNDAPEVDQDQAILGASSRRKSQQPQQKVSPRFARGKAAGHGRPVGRSDSLQRVGQTDFVTRLEYEEKVQESLAKSETIDILEAKIRRLEHLLHLKDVRIDELQTRLGELRPTG 235          
BLAST of Sperm flagellar protein 1 vs. Ensembl Cavefish
Match: zgc:66426 (sperm flagellar 1 [Source:NCBI gene;Acc:103038874])

HSP 1 Score: 177.178 bits (448), Expect = 5.738e-55
Identity = 96/227 (42.29%), Postives = 140/227 (61.67%), Query Frame = 3
Query:   30 LSAMN-DIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSA-----RPTDEKSESFPDSSSVSRDEPHR----------------AGPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            +S MN D+DE+ LQ+LYAW+D I LSRPK+NI+RDFSDGV++AE+VKH++PKL+++H+Y   +S  QK  NW+ LN K F KLNF + +D +  +  + AGTIE VL  +R +++     K  + +          +EK++S      V+ D  ++                AG   + + R+ +EE +Q  LA  ET+EILQ K+ +LEHL+ LKDLRIEDL K L
Sbjct:    1 MSTMNRDLDEDALQELYAWIDQINLSRPKRNIARDFSDGVMIAEVVKHFYPKLVDLHNYTPAHSTQQKLSNWNTLNRKVFSKLNFHIPEDTVKKITLSTAGTIEPVLCALRIRLEDKQTGKNLEGTQEPVEYYSTVNEKAQSGNRQVIVTTDISNKTTAPVKKTQKSSPLPVAGQDVDPAFRLLLEEKEQALLALQETVEILQIKVNRLEHLVHLKDLRIEDLTKHL 227          
BLAST of Sperm flagellar protein 1 vs. Ensembl Cavefish
Match: spata4 (spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-GENE-050417-153])

HSP 1 Score: 53.5286 bits (127), Expect = 3.137e-8
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  114 KNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKM 368
            K  S+DFS+G L+AEI   ++P+   +HSY    SL  K+ NW  +  K   KL   L  + +   I  K G  E ++  + T M
Sbjct:   16 KTPSQDFSNGFLVAEIFSRFYPEDFPMHSYGNGTSLPTKQSNWSQIE-KGLMKLQLSLVKEAVDGTIHCKPGAAEALVQEIYTLM 99          
BLAST of Sperm flagellar protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002908.1 (pep scaffold:Pmarinus_7.0:GL480168:4502:8326:-1 gene:ENSPMAG00000002664.1 transcript:ENSPMAT00000002908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 1.581e-36
Identity = 55/110 (50.00%), Postives = 79/110 (71.82%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKL-NFELSDDVITNLIDAKAGTIERVLLLVRTKM 368
              +DEE LQ+LYAW+DT+PLSRPK+NI+RDFSDGV++AE+VKH+FP+++E+H+Y   NS+ QK  NW+ LN K   KL    +  DV+ ++     G +E VL  +R K+
Sbjct:    3 GGLDEEALQELYAWIDTVPLSRPKRNIARDFSDGVMVAELVKHFFPRIVEMHNYIPANSVQQKLSNWNTLNRKVLSKLCGMHVPVDVVRSVTGCSPGVVELVLHSLRLKL 112          
BLAST of Sperm flagellar protein 1 vs. Ensembl Sea Lamprey
Match: spata4 (spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-GENE-050417-153])

HSP 1 Score: 59.6918 bits (143), Expect = 4.057e-11
Identity = 33/121 (27.27%), Postives = 65/121 (53.72%), Query Frame = 3
Query:   66 QDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEK 428
            ++++ W+ ++ L+   +N  RD S+G+++AEI   Y+P  + +HS+    SL  K  NW LL+ + F K     S ++    +  K G  E++L  V + +     A++ ++ + R TD +
Sbjct:    8 REVFRWLQSLDLTVQFRNARRDLSNGLVLAEIFSWYYPGDLLMHSFQPGESLASKLANWSLLH-RFFAKRGLAFSKELTDGTLHRKPGAAEQLLQRVYSTLTNRR-AQESNSEAPRFTDAR 126          
BLAST of Sperm flagellar protein 1 vs. Ensembl Nematostella
Match: EDO34469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPA4])

HSP 1 Score: 184.111 bits (466), Expect = 3.334e-58
Identity = 104/224 (46.43%), Postives = 144/224 (64.29%), Query Frame = 3
Query:   42 NDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKK-LNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLF----------AKKYDN-SSARPTDEKS-----ESFPDSSSVSRDEPHRAGPPANISA------RIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
             D+DE+ LQ+L+ W+D IPLSRPKK+I+RDFSDGVL+AEIVK++ PKL++IH+Y   NSLTQK  NW  LN K   K LN+ +SD+ I N+++ KAG IE VL ++R K+++ +            K YD+ S   P  + +     E +P+     +    RA    ++S       R+ +EE +Q  LA  ETI+ILQAK+R+LEHLL LKDLRI+DL KRL
Sbjct:   11 GDLDEDSLQELFTWIDEIPLSRPKKSITRDFSDGVLVAEIVKNFLPKLVDIHNYSPANSLTQKLTNWSTLNRKVLTKHLNYTVSDNTINNIVNCKAGAIEHVLFVLRGKIEKHIARREAQELRKQQKVYDDFSPEGPVKDHTGFNTEEYYPNGRQFGK--VARAQSYQDVSVDDQPNLRLILEEKEQALLASQETIQILQAKMRRLEHLLHLKDLRIDDLAKRL 232          
BLAST of Sperm flagellar protein 1 vs. Ensembl Nematostella
Match: EDO30183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1I3])

HSP 1 Score: 74.3294 bits (181), Expect = 2.555e-16
Identity = 40/114 (35.09%), Postives = 63/114 (55.26%), Query Frame = 3
Query:   39 MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGT----IERVLLLVRTKM 368
            M+ +  E+L+    W+ ++ LS P KN  RDFS+G L+AEI   Y+P+ I++HSY    SL  K  NW  L    F++  F +S +VI   I  K G     +E++  L+  ++
Sbjct:    1 MSGLPREILK----WIQSLDLSHPVKNTKRDFSNGCLVAEIFSWYYPQEIQMHSYDNGASLATKMGNWSQLQ-TFFQRQGFGISKEVIDGTIHCKPGAAALLVEKIYTLLTNRV 109          
BLAST of Sperm flagellar protein 1 vs. Ensembl Nematostella
Match: EDO40759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S652])

HSP 1 Score: 72.4034 bits (176), Expect = 3.097e-15
Identity = 39/114 (34.21%), Postives = 62/114 (54.39%), Query Frame = 3
Query:   39 MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGT----IERVLLLVRTKM 368
            M+ +  E+L+    W+ ++ LS P KN  RDFS+G L+AEI   Y+P+ I++HSY    SL  K  NW  L    F++  F +  +VI   I  K G     +E++  L+  ++
Sbjct:    1 MSGLPREILK----WIQSLDLSHPVKNTKRDFSNGCLVAEIFSWYYPQEIQMHSYDNGASLATKMGNWSQLQ-TFFQRQGFGIPKEVIDGTIHCKPGAAALLVEKIYTLLTNRV 109          
BLAST of Sperm flagellar protein 1 vs. Ensembl Medaka
Match: zgc:66426 (sperm flagellar protein 1 [Source:NCBI gene;Acc:101171604])

HSP 1 Score: 158.303 bits (399), Expect = 9.235e-48
Identity = 87/220 (39.55%), Postives = 134/220 (60.91%), Query Frame = 3
Query:   45 DIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKK--------YDNSS-ARPTDEKSESFPDSSSVSRDEPH-----------RAGPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRL 644
            ++++E  QDL+AW+D IPLSRPK+NISRDFSDGV+ AE+VKH+FPKL+++H+Y   NS  QK  NW++LN K F +L+F + ++ +  ++ + +G +   L  +R K+D+ L   K        YD     +P  E  +     + + +DE +           R     + S R+ ++E +Q  L+  ET+EILQ K+ KLEHL+ LKD+RIEDL + L
Sbjct:    4 ELNDEEQQDLFAWIDKIPLSRPKRNISRDFSDGVMAAEVVKHFFPKLVDLHNYIPANSTQQKLSNWNVLNRKVFCRLDFHVPEETLNKIVLSTSGAVVPALSALREKIDKKLENPKNNITNPDYYDTRDLKKPCAEIHQIHTQLTELRKDEKNMEKNMKVQHAVRFYSDMDPSLRLILQEKEQAVLSLQETVEILQIKVNKLEHLVHLKDMRIEDLTRHL 223          
BLAST of Sperm flagellar protein 1 vs. Planmine SMEST
Match: SMESG000014677.1 (SMESG000014677.1)

HSP 1 Score: 445.662 bits (1145), Expect = 2.380e-161
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 3
Query:   39 MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRAGPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQNKQIMKR 689
            MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRAGPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQNKQIMKR
Sbjct:    1 MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIERVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRAGPPANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQKRLGDLRPTGQNKQIMKR 217          
BLAST of Sperm flagellar protein 1 vs. Planmine SMEST
Match: SMESG000036289.1 (SMESG000036289.1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.536e-6
Identity = 26/89 (29.21%), Postives = 48/89 (53.93%), Query Frame = 3
Query:   66 QDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGT 332
            +++  W+ ++ LS+  +N   D S+GVL+ EI   Y+ K +++ S+    S+  K KNW+L+     KK    + +++I   I  K G 
Sbjct:    6 REVVKWLQSLDLSKKIQNPKWDISNGVLVGEIFNKYYIKELDLASFNNGQSIELKLKNWYLIQ-NFIKKYKLSIPENLIHGTIYMKEGA 93          
BLAST of Sperm flagellar protein 1 vs. Planmine SMEST
Match: SMESG000036289.1 (SMESG000036289.1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.705e-6
Identity = 26/89 (29.21%), Postives = 48/89 (53.93%), Query Frame = 3
Query:   66 QDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLIEIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGT 332
            +++  W+ ++ LS+  +N   D S+GVL+ EI   Y+ K +++ S+    S+  K KNW+L+     KK    + +++I   I  K G 
Sbjct:    6 REVVKWLQSLDLSKKIQNPKWDISNGVLVGEIFNKYYIKELDLASFNNGQSIELKLKNWYLIQ-NFIKKYKLSIPENLIHGTIYMKEGA 93          
The following BLAST results are available for this feature:
BLAST of Sperm flagellar protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SPEF13.439e-5243.23sperm flagellar 1 [Source:HGNC Symbol;Acc:HGNC:158... [more]
SPATA41.719e-838.37spermatogenesis associated 4 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG123951.160e-1225.00gene:FBgn0030722 transcript:FBtr0074260[more]
CG167193.413e-835.14gene:FBgn0036029 transcript:FBtr0076394[more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:664269.711e-5444.24zgc:66426 [Source:ZFIN;Acc:ZDB-GENE-040426-1639][more]
zgc:664267.324e-3840.32zgc:66426 [Source:ZFIN;Acc:ZDB-GENE-040426-1639][more]
spata41.639e-1235.35spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-... [more]
spata41.639e-1235.35spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-... [more]
spata41.639e-1235.35spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SPEF19.726e-5339.91sperm flagellar 1 [Source:NCBI gene;Acc:100492226][more]
tbc1d191.616e-1035.42TBC1 domain family member 19 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spef11.218e-5141.52sperm flagellar 1 [Source:MGI Symbol;Acc:MGI:35135... [more]
Spef11.218e-5141.52sperm flagellar 1 [Source:MGI Symbol;Acc:MGI:35135... [more]
Spef12.111e-3456.12sperm flagellar 1 [Source:MGI Symbol;Acc:MGI:35135... [more]
Spef1l2.109e-3132.23sperm flagellar 1 like [Source:MGI Symbol;Acc:MGI:... [more]
Spef1l8.464e-3151.92sperm flagellar 1 like [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y4P9|SPEF1_HUMAN1.651e-5143.23Sperm flagellar protein 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q58DA1|SPEF1_BOVIN2.285e-5142.04Sperm flagellar protein 1 OS=Bos taurus OX=9913 GN... [more]
sp|Q99JL1|SPEF1_MOUSE8.518e-5141.52Sperm flagellar protein 1 OS=Mus musculus OX=10090... [more]
sp|Q0IH24|SPEF1_XENLA7.230e-4843.50Sperm flagellar protein 1 OS=Xenopus laevis OX=835... [more]
sp|Q6DMN8|SPAT4_PANTR6.000e-838.37Spermatogenesis-associated protein 4 OS=Pan troglo... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183285421.266e-8960.00tr|A0A267DQ60|A0A267DQ60_9PLAT Calponin-homology (... [more]
gnl|BL_ORD_ID|182031842.464e-8959.83tr|A0A267DKR7|A0A267DKR7_9PLAT Calponin-homology (... [more]
gnl|BL_ORD_ID|182892847.255e-8960.09tr|A0A1I8FZU0|A0A1I8FZU0_9PLAT Calponin-homology (... [more]
gnl|BL_ORD_ID|183027692.021e-8359.15tr|A0A1I8GCD9|A0A1I8GCD9_9PLAT Calponin-homology (... [more]
gnl|BL_ORD_ID|157796962.756e-7753.62tr|A0A1I8GVA3|A0A1I8GVA3_9PLAT Calponin-homology (... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:664265.738e-5542.29sperm flagellar 1 [Source:NCBI gene;Acc:103038874][more]
spata43.137e-834.12spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002908.11.581e-3650.00pep scaffold:Pmarinus_7.0:GL480168:4502:8326:-1 ge... [more]
spata44.057e-1127.27spermatogenesis associated 4 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO344693.334e-5846.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301832.555e-1635.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407593.097e-1534.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:664269.235e-4839.55sperm flagellar protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Sperm flagellar protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014677.12.380e-161100.00SMESG000014677.1[more]
SMESG000036289.12.536e-629.21SMESG000036289.1[more]
SMESG000036289.12.705e-629.21SMESG000036289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018815 ID=SMED30018815|Name=Sperm flagellar protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=732bp
ATCTATATAAATCTTATATGCTAAATTGATTATCAGCAATGAATGACATT
GATGAAGAGGTTCTTCAAGATCTCTATGCTTGGGTCGATACGATTCCTCT
GAGTCGACCAAAGAAAAATATATCTCGCGATTTTTCCGACGGGGTGCTAA
TGGCGGAAATCGTGAAGCACTATTTCCCGAAGCTGATCGAAATCCACAGT
TATCCGGCATGCAATTCACTGACACAGAAAAAGAAAAACTGGCATTTGTT
GAATTGGAAAGCGTTTAAGAAGCTGAATTTTGAACTGTCAGATGACGTGA
TTACGAATCTGATTGACGCGAAAGCCGGCACAATTGAGCGCGTCCTGCTG
CTGGTGAGGACCAAAATGGACCGGATGCTCTTTGCTAAGAAATACGACAA
CTCGTCCGCCAGGCCAACAGACGAGAAATCGGAATCATTTCCCGACAGCA
GCAGCGTCAGTCGAGATGAGCCGCATCGGGCGGGACCACCAGCAAACATT
TCCGCACGAATCCAGATCGAGGAATATAAGCAGGAATGCCTAGCAAAAGA
TGAAACGATTGAAATTCTTCAGGCAAAAATCAGGAAGCTTGAGCATTTGC
TGGAATTGAAGGATTTGCGAATTGAGGACCTCCAGAAACGTTTAGGAGAT
TTGAGACCTACCGGACAGAACAAGCAAATTATGAAACGATAAAATACAAT
TTTGTCTTTTTCTATTTCGGAAATTATCATTC
back to top

protein sequence of SMED30018815-orf-1

>SMED30018815-orf-1 ID=SMED30018815-orf-1|Name=SMED30018815-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MNDIDEEVLQDLYAWVDTIPLSRPKKNISRDFSDGVLMAEIVKHYFPKLI
EIHSYPACNSLTQKKKNWHLLNWKAFKKLNFELSDDVITNLIDAKAGTIE
RVLLLVRTKMDRMLFAKKYDNSSARPTDEKSESFPDSSSVSRDEPHRAGP
PANISARIQIEEYKQECLAKDETIEILQAKIRKLEHLLELKDLRIEDLQK
RLGDLRPTGQNKQIMKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR010441CH_2
IPR001715CH-domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 160..201
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 121..154
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 121..143
NoneNo IPR availablePANTHERPTHR12509:SF9SPERM FLAGELLAR PROTEIN 1coord: 3..204
NoneNo IPR availablePANTHERPTHR12509SPERMATOGENESIS-ASSOCIATED 4-RELATEDcoord: 3..204
IPR010441CH-like domain in sperm proteinPFAMPF06294CH_2coord: 12..106
e-value: 3.1E-32
score: 110.5
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 5..114
e-value: 4.0E-38
score: 131.7
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 6..85
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 6..114
score: 12.841