BAH domain-containing protein

Overview
NameBAH domain-containing protein
Smed IDSMED30018797
Length (bp)3437
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BAH domain-containing protein (SMED30018797) t-SNE clustered cells

Violin plots show distribution of expression levels for BAH domain-containing protein (SMED30018797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BAH domain-containing protein (SMED30018797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BAH domain-containing protein (SMED30018797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30018797h1SMcG0014909 Contig46114newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018797h1SMcG0014909 Contig46114uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30018797h1SMcG0014909 dd_Smed_v4_10101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018797h1SMcG0014909 dd_Smed_v4_10101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BAH domain-containing protein vs. Ensembl Human
Match: BAHD1 (bromo adjacent homology domain containing 1 [Source:HGNC Symbol;Acc:HGNC:29153])

HSP 1 Score: 112.464 bits (280), Expect = 1.368e-24
Identity = 70/212 (33.02%), Postives = 100/212 (47.17%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W  VG    K++ +    E   +  Y A+   R    IR  D V+L+S   +   P++AKI   + + E+G+ MM+L WYYRPEH + G      E++V+ASRH D NSV CIE+K +VL    Y RF A  KR+G G  P     L+P S D                        Y+     + P +     VF+CR +YD    +I +N
Sbjct:  591 WVPVGAACEKAVYVLDEPEPAIRKSYQAVE--RHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHENEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGL-PSRKTALVPPSAD------------------------YSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKN 775          
BLAST of BAH domain-containing protein vs. Ensembl Human
Match: BAHD1 (bromo adjacent homology domain containing 1 [Source:HGNC Symbol;Acc:HGNC:29153])

HSP 1 Score: 108.227 bits (269), Expect = 3.572e-23
Identity = 69/215 (32.09%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL---LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W  VG    K++ +    E   +  Y A+   R    IR  D V+L+S   +   P++AKI   + + E+G+ MM+L WYYRPEH + G    +    +++V+ASRH D NSV CIE+K +VL    Y RF A  KR+G G  P     L+P S D                        Y+     + P +     VF+CR +YD    +I +N
Sbjct:  590 WVPVGAACEKAVYVLDEPEPAIRKSYQAVE--RHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGL-PSRKTALVPPSAD------------------------YSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKN 777          
BLAST of BAH domain-containing protein vs. Ensembl Human
Match: BAHD1 (bromo adjacent homology domain containing 1 [Source:HGNC Symbol;Acc:HGNC:29153])

HSP 1 Score: 108.227 bits (269), Expect = 3.673e-23
Identity = 69/215 (32.09%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL---LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W  VG    K++ +    E   +  Y A+   R    IR  D V+L+S   +   P++AKI   + + E+G+ MM+L WYYRPEH + G    +    +++V+ASRH D NSV CIE+K +VL    Y RF A  KR+G G  P     L+P S D                        Y+     + P +     VF+CR +YD    +I +N
Sbjct:  591 WVPVGAACEKAVYVLDEPEPAIRKSYQAVE--RHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGL-PSRKTALVPPSAD------------------------YSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKN 778          
BLAST of BAH domain-containing protein vs. Ensembl Fly
Match: Hers (gene:FBgn0052529 transcript:FBtr0306523)

HSP 1 Score: 128.257 bits (321), Expect = 1.496e-29
Identity = 67/170 (39.41%), Postives = 94/170 (55.29%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE-PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF-------------VAYQKRQGS-GTRPGLAARLIPVSNDDTVV 2714
            W W G+ F  ++ L     +V +TCY A+RH   D IIR  DCV+L+++ D E P++AK+   + + E G+ MM+L WYYRPEHT+QG        +VYASRH D NSV C+EDK +VL    Y R+             V+   R+ S  T PG   R +P   +  +V
Sbjct:  943 WMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEGD-IIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIVPRRPSIATAPGFPVRTVPEHTNPELV 1111          
BLAST of BAH domain-containing protein vs. Ensembl Fly
Match: Hers (gene:FBgn0052529 transcript:FBtr0074801)

HSP 1 Score: 128.257 bits (321), Expect = 1.533e-29
Identity = 67/170 (39.41%), Postives = 94/170 (55.29%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE-PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF-------------VAYQKRQGS-GTRPGLAARLIPVSNDDTVV 2714
            W W G+ F  ++ L     +V +TCY A+RH   D IIR  DCV+L+++ D E P++AK+   + + E G+ MM+L WYYRPEHT+QG        +VYASRH D NSV C+EDK +VL    Y R+             V+   R+ S  T PG   R +P   +  +V
Sbjct: 1084 WMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEGD-IIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIVPRRPSIATAPGFPVRTVPEHTNPELV 1252          
BLAST of BAH domain-containing protein vs. Ensembl Fly
Match: Hers (gene:FBgn0052529 transcript:FBtr0332993)

HSP 1 Score: 128.642 bits (322), Expect = 1.762e-29
Identity = 67/170 (39.41%), Postives = 94/170 (55.29%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE-PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF-------------VAYQKRQGS-GTRPGLAARLIPVSNDDTVV 2714
            W W G+ F  ++ L     +V +TCY A+RH   D IIR  DCV+L+++ D E P++AK+   + + E G+ MM+L WYYRPEHT+QG        +VYASRH D NSV C+EDK +VL    Y R+             V+   R+ S  T PG   R +P   +  +V
Sbjct: 2333 WMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEGD-IIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIVPRRPSIATAPGFPVRTVPEHTNPELV 2501          
BLAST of BAH domain-containing protein vs. Ensembl Fly
Match: Hers (gene:FBgn0052529 transcript:FBtr0074800)

HSP 1 Score: 128.642 bits (322), Expect = 1.762e-29
Identity = 67/170 (39.41%), Postives = 94/170 (55.29%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE-PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF-------------VAYQKRQGS-GTRPGLAARLIPVSNDDTVV 2714
            W W G+ F  ++ L     +V +TCY A+RH   D IIR  DCV+L+++ D E P++AK+   + + E G+ MM+L WYYRPEHT+QG        +VYASRH D NSV C+EDK +VL    Y R+             V+   R+ S  T PG   R +P   +  +V
Sbjct: 2333 WMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEGD-IIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIVPRRPSIATAPGFPVRTVPEHTNPELV 2501          
BLAST of BAH domain-containing protein vs. Ensembl Fly
Match: Hers (gene:FBgn0052529 transcript:FBtr0306520)

HSP 1 Score: 128.642 bits (322), Expect = 1.762e-29
Identity = 67/170 (39.41%), Postives = 94/170 (55.29%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE-PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF-------------VAYQKRQGS-GTRPGLAARLIPVSNDDTVV 2714
            W W G+ F  ++ L     +V +TCY A+RH   D IIR  DCV+L+++ D E P++AK+   + + E G+ MM+L WYYRPEHT+QG        +VYASRH D NSV C+EDK +VL    Y R+             V+   R+ S  T PG   R +P   +  +V
Sbjct: 2333 WMWAGKAFQGAVFLNSDDPLVLRTCYPAMRHVEGD-IIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDHNSVACVEDKCYVLTFSEYCRYRRRLRAAEEDVEDVSIVPRRPSIATAPGFPVRTVPEHTNPELV 2501          
BLAST of BAH domain-containing protein vs. Ensembl Zebrafish
Match: bahd1 (bromo adjacent homology domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-120411-42])

HSP 1 Score: 120.553 bits (301), Expect = 3.440e-27
Identity = 72/216 (33.33%), Postives = 107/216 (49.54%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLL-DWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAAR--LIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG    K + +        + CY  ++  RD  +IR  D V+LRS   ++  P++AK+  F+ D E+G+ MM+LFWYYRPEHT+ G +   H E++++ASRH D NSV CIEDK +VL +  Y RF A  K +      G   R  L+P S+                         Y +      P ++    VFVCR +YD    ++ +N+
Sbjct:  627 WLPVGVATEKEVFIVAEDSASLRRCYEGVQ--RDGEVIRVRDTVLLRSGPRKKSLPYVAKVSAFWDDPESGELMMSLFWYYRPEHTQGGRIPSMHCENEIFASRHQDENSVACIEDKCYVLTLAQYCRFCALVKCR----EEGFPKRSPLVPPSS-------------------------YVIPAHRCVPNDIDPDLVFVCRHVYDFRYGRLLKNL 811          
BLAST of BAH domain-containing protein vs. Ensembl Zebrafish
Match: bahd1 (bromo adjacent homology domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-120411-42])

HSP 1 Score: 120.553 bits (301), Expect = 3.440e-27
Identity = 72/216 (33.33%), Postives = 107/216 (49.54%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLL-DWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAAR--LIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG    K + +        + CY  ++  RD  +IR  D V+LRS   ++  P++AK+  F+ D E+G+ MM+LFWYYRPEHT+ G +   H E++++ASRH D NSV CIEDK +VL +  Y RF A  K +      G   R  L+P S+                         Y +      P ++    VFVCR +YD    ++ +N+
Sbjct:  627 WLPVGVATEKEVFIVAEDSASLRRCYEGVQ--RDGEVIRVRDTVLLRSGPRKKSLPYVAKVSAFWDDPESGELMMSLFWYYRPEHTQGGRIPSMHCENEIFASRHQDENSVACIEDKCYVLTLAQYCRFCALVKCR----EEGFPKRSPLVPPSS-------------------------YVIPAHRCVPNDIDPDLVFVCRHVYDFRYGRLLKNL 811          
BLAST of BAH domain-containing protein vs. Ensembl Zebrafish
Match: BX649281.1 (bromo adjacent homology domain containing 1 [Source:NCBI gene;Acc:564712])

HSP 1 Score: 118.627 bits (296), Expect = 1.030e-26
Identity = 68/194 (35.05%), Postives = 101/194 (52.06%), Query Frame = 3
Query: 2316 KTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLL-DWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAAR--LIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            + CY  ++  RD  +IR  D V+LRS   ++  P++AK+  F+ D E+G+ MM+LFWYYRPEHT+ G +   H E++++ASRH D NSV CIEDK +VL +  Y RF A  K +      G   R  L+P S+                         Y +      P ++    VFVCR +YD    ++ +N+
Sbjct:  596 RRCYEGVQ--RDGEVIRVRDTVLLRSGPRKKSLPYVAKVSAFWDDPESGELMMSLFWYYRPEHTQGGRIPSMHCENEIFASRHQDENSVACIEDKCYVLTLAQYCRFCALVKCR----EEGFPKRSPLVPPSS-------------------------YVIPAHRCVPNDIDPDLVFVCRHVYDFRYGRLLKNL 758          
BLAST of BAH domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01087948.1 (bromo adjacent homology domain-containing 1 protein-like [Source:NCBI gene;Acc:100331694])

HSP 1 Score: 117.087 bits (292), Expect = 4.558e-26
Identity = 66/214 (30.84%), Postives = 107/214 (50.00%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL-LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG    + + +    + V + CY++++  RD  +IR  D V+L+S   ++  P++AKI   + +  TG+ MM+LFWYYRPEHT+ G     H E +++ASRH D NSV CIE++ +VLP+  Y RF A  +R   G         +P+    +  + P+                       S P  +    V++CR +YD    +I +N+
Sbjct:  655 WRPVGASTQRELLMAGDEQTVLRQCYDSVQ--RDGELIRVRDTVLLKSGPRRKTLPYVAKISALWEEPRTGELMMSLFWYYRPEHTQGGRDPSMHCEKEIFASRHQDENSVACIEERCYVLPLAQYCRFCALVRRGVEGV-----CERVPLVPRCSAGSVPN---------------------HRSLPTGVDPQLVYLCRHVYDYRYGRILKNL 840          
BLAST of BAH domain-containing protein vs. Ensembl Zebrafish
Match: bahcc1a (BAH domain and coiled-coil containing 1a [Source:ZFIN;Acc:ZDB-GENE-170301-1])

HSP 1 Score: 55.4546 bits (132), Expect = 5.565e-7
Identity = 40/137 (29.20%), Postives = 59/137 (43.07%), Query Frame = 3
Query: 2247 FWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE-PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGS 2654
             W W G P  +     L G+   K  Y AI   +D  I+R  DC +  S+     P + +I  F+ +      ++ + W+Y PE T+ G      +  +Y S H D N V  I  K  V+  E Y R    +K  GS
Sbjct: 2613 LWRWSGNPTQRR---GLKGK-ARKLFYKAIVRGKD--IVRVGDCAVFLSTGHPPLPLIGRIESFW-ESWQNSMVVKVKWFYHPEETKLGKRHRDGKHALYQSCHEDENDVQTISHKCQVVTCEEYDRLTRNRKSDGS 2742          
BLAST of BAH domain-containing protein vs. Ensembl Xenopus
Match: ptpa (protein phosphatase 2 phosphatase activator [Source:Xenbase;Acc:XB-GENE-970102])

HSP 1 Score: 122.094 bits (305), Expect = 1.487e-27
Identity = 87/304 (28.62%), Postives = 137/304 (45.07%), Query Frame = 3
Query: 2019 VPNSQA--KKPKTFTVERIVRRKP-------------KSVDQCFDELSRLTAANKKSKKQQQLDEKQANEGXXXXXXXXXXXXXXXXXXXSFWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            VPN Q    +P+T  + +  R  P             ++   CF   S   + +    KQQ++  +++  G                     W  VG    K++ +    E   +  Y A+   R+  IIR  D V+L+S   ++  P++AKI   + + +TG+ MM+LFWYYRPEHT+ G      + +++ASRH D NS+ CIE+K +VL    Y RF A  KR+G G  P   A ++P S +    + P   +  + TD                 PE+    VF+CR +YD    +I +N
Sbjct:  505 VPNLQTPNSEPQTMAMLKTARECPQSSKPPSGSKSGVRNTSGCFHASSNKASKSHSHPKQQRIHRRRSTNG---------------------WMPVGAACEKAVYVVNEPEPALRRSYQAVE--RNGEIIRVRDTVLLKSGPRKKSMPYVAKISALWEEPKTGELMMSLFWYYRPEHTQGGRNPSMHQKEIFASRHQDENSIACIEEKCYVLTFAEYCRFCALVKRRGEGC-PNRKALIVPPSAE---YSTPSHRRVPDSTD-----------------PEL----VFLCRHVYDFRHGRILKN 760          
BLAST of BAH domain-containing protein vs. Ensembl Xenopus
Match: ptpa (protein phosphatase 2 phosphatase activator [Source:Xenbase;Acc:XB-GENE-970102])

HSP 1 Score: 121.709 bits (304), Expect = 1.737e-27
Identity = 87/304 (28.62%), Postives = 137/304 (45.07%), Query Frame = 3
Query: 2019 VPNSQA--KKPKTFTVERIVRRKP-------------KSVDQCFDELSRLTAANKKSKKQQQLDEKQANEGXXXXXXXXXXXXXXXXXXXSFWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            VPN Q    +P+T  + +  R  P             ++   CF   S   + +    KQQ++  +++  G                     W  VG    K++ +    E   +  Y A+   R+  IIR  D V+L+S   ++  P++AKI   + + +TG+ MM+LFWYYRPEHT+ G      + +++ASRH D NS+ CIE+K +VL    Y RF A  KR+G G  P   A ++P S +    + P   +  + TD                 PE+    VF+CR +YD    +I +N
Sbjct:  540 VPNLQTPNSEPQTMAMLKTARECPQSSKPPSGSKSGVRNTSGCFHASSNKASKSHSHPKQQRIHRRRSTNG---------------------WMPVGAACEKAVYVVNEPEPALRRSYQAVE--RNGEIIRVRDTVLLKSGPRKKSMPYVAKISALWEEPKTGELMMSLFWYYRPEHTQGGRNPSMHQKEIFASRHQDENSIACIEEKCYVLTFAEYCRFCALVKRRGEGC-PNRKALIVPPSAE---YSTPSHRRVPDSTD-----------------PEL----VFLCRHVYDFRHGRILKN 795          
BLAST of BAH domain-containing protein vs. Ensembl Xenopus
Match: mcat (malonyl-CoA-acyl carrier protein transacylase [Source:Xenbase;Acc:XB-GENE-494521])

HSP 1 Score: 51.9878 bits (123), Expect = 7.244e-6
Identity = 45/163 (27.61%), Postives = 66/163 (40.49%), Query Frame = 3
Query: 2247 FWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDC-VMLRSSADQEPFLAKIIVFYLDEETGKKMMT-LFWYYRPEHTEQG--LLD---W--------------------HTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGS 2654
             W+W G+P  +     + G+   K  Y AI   R   IIR  DC V L +     P++ +I   +  E  G  M+  + W+Y PE T  G  L D   W                      E  +Y S H+D N V  +  K  V+ +E Y + +  +K Q S
Sbjct:  941 LWKWFGKPTQRR---GMKGK-ARKLFYKAI--VRGKEIIRIGDCAVFLSAGRPNLPYIGRIQSMW--ESWGNNMVVRVKWFYHPEETNPGKKLNDTKSWDQKSGKSSLSGLQMSSLRKDFMERALYQSSHVDENDVQTVSHKCLVVALEQYEQMLKTKKYQDS 1095          
BLAST of BAH domain-containing protein vs. Ensembl Xenopus
Match: mcat (malonyl-CoA-acyl carrier protein transacylase [Source:Xenbase;Acc:XB-GENE-494521])

HSP 1 Score: 51.9878 bits (123), Expect = 8.751e-6
Identity = 48/178 (26.97%), Postives = 70/178 (39.33%), Query Frame = 3
Query: 2247 FWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDC-VMLRSSADQEPFLAKIIVFYLDEETGKKMMT-LFWYYRPEHTEQG--LLD---W--------------------HTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSN 2699
             W+W G+P  +     + G+   K  Y AI   R   IIR  DC V L +     P++ +I   +  E  G  M+  + W+Y PE T  G  L D   W                      E  +Y S H+D N V  +  K  V+ +E Y + +  +K Q S     LA    P + 
Sbjct: 2277 LWKWFGKPTQRR---GMKGK-ARKLFYKAI--VRGKEIIRIGDCAVFLSAGRPNLPYIGRIQSMW--ESWGNNMVVRVKWFYHPEETNPGKKLNDTKSWDQKSGKSSLSGLQMSSLRKDFMERALYQSSHVDENDVQTVSHKCLVVALEQYEQMLKTKKYQDSEDLYYLAGTYEPTTG 2446          
BLAST of BAH domain-containing protein vs. Ensembl Mouse
Match: Bahd1 (bromo adjacent homology domain containing 1 [Source:MGI Symbol;Acc:MGI:2139371])

HSP 1 Score: 108.612 bits (270), Expect = 1.493e-23
Identity = 69/215 (32.09%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL---LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W  VG    K++ +    E   +  Y A+   R    IR  D V+L+S   +   P++AKI   + + E+G+ MM+L WYYRPEH + G    +    +++V+ASRH D NSV CIE+K +VL    Y RF A  KR+G G  P     L+P S D                        Y+     + P +     VF+CR +YD    +I +N
Sbjct:  583 WVPVGAACEKAVYVLDEPEPAIRKSYQAVE--RHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGL-PSRKTALVPPSAD------------------------YSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKN 770          
BLAST of BAH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q497V6|BAHD1_MOUSE (Bromo adjacent homology domain-containing 1 protein OS=Mus musculus OX=10090 GN=Bahd1 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 9.021e-23
Identity = 69/215 (32.09%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL---LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W  VG    K++ +    E   +  Y A+   R    IR  D V+L+S   +   P++AKI   + + E+G+ MM+L WYYRPEH + G    +    +++V+ASRH D NSV CIE+K +VL    Y RF A  KR+G G  P     L+P S D                        Y+     + P +     VF+CR +YD    +I +N
Sbjct:  583 WVPVGAACEKAVYVLDEPEPAIRKSYQAVE--RHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGL-PSRKTALVPPSAD------------------------YSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKN 770          
BLAST of BAH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TBE0|BAHD1_HUMAN (Bromo adjacent homology domain-containing 1 protein OS=Homo sapiens OX=9606 GN=BAHD1 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 1.764e-22
Identity = 69/215 (32.09%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL---LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W  VG    K++ +    E   +  Y A+   R    IR  D V+L+S   +   P++AKI   + + E+G+ MM+L WYYRPEH + G    +    +++V+ASRH D NSV CIE+K +VL    Y RF A  KR+G G  P     L+P S D                        Y+     + P +     VF+CR +YD    +I +N
Sbjct:  591 WVPVGAACEKAVYVLDEPEPAIRKSYQAVE--RHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGELMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGL-PSRKTALVPPSAD------------------------YSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKN 778          
BLAST of BAH domain-containing protein vs. UniProt/SwissProt
Match: sp|F4JL28|EBS_ARATH (Chromatin remodeling protein EBS OS=Arabidopsis thaliana OX=3702 GN=EBS PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.297e-6
Identity = 29/91 (31.87%), Postives = 47/91 (51.65%), Query Frame = 3
Query: 2358 IIRSLDCVMLR-SSADQEPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF 2627
            ++R+ DCV++R S A + P++A++     D     K+    WYYRPE +  G   +H   +++ S H D  S   IE K  V   + Y+R 
Sbjct:   30 VVRAGDCVLMRPSDAGKPPYVARVEKIEADARNNVKVHCR-WYYRPEESLGGRRQFHGAKELFLSDHFDVQSAHTIEGKCIVHTFKNYTRL 119          
BLAST of BAH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9FEN9|SHL_ARATH (Chromatin remodeling protein SHL OS=Arabidopsis thaliana OX=3702 GN=SHL PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.025e-6
Identity = 28/90 (31.11%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 2361 IRSLDCVMLRSSADQEP-FLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRF 2627
            I+  D V++RSS   +P ++A++     D       + + WYYRPE +  G   +H   +V+ S H D  S D IE K  V     Y++ 
Sbjct:   23 IQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVRVRWYYRPEESIGGRRQFHGAKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKL 112          
BLAST of BAH domain-containing protein vs. TrEMBL
Match: A0A183AW97 (BAH domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11232 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.242e-33
Identity = 87/219 (39.73%), Postives = 119/219 (54.34%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGK-KMMTLFWYYRPEHT--EQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQK-RQGSGTRPGLAARLIPVS--NDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W+W G  F K++  +  G  V +TCY AIRH RD ++IR  DCV+L S  D+   P +AKI   + D    + KMM+L WYYRPEH     G L     +++YASRH D+N V+CIEDKA+VL    +SR++A  K RQ +  RP L  R++P+       V TE          D    S      F    P  +  SNVF+CRG+YD    ++ RN+
Sbjct:  106 WQWEGSSFTKAVFCRSDGPPVVRTCYRAIRHRRDGMVIREKDCVLLCSGPDRSNPPHVAKITALFADSVNPETKMMSLLWYYRPEHVGCPPGNL---VPNELYASRHCDTNPVECIEDKAYVLTASAFSRYMARLKYRQTAYPRPPL-HRVVPICPLKSSAVTTEETLESQTPQEDSTGQSV-----FSEDVPESVNPSNVFLCRGVYDYRLKRVCRNV 315          
BLAST of BAH domain-containing protein vs. TrEMBL
Match: A0A074Z8C8 (BAH domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08633 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.675e-32
Identity = 77/214 (35.98%), Postives = 112/214 (52.34%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQ--EPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQK-RQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            WEW G P+ K +  +         CY AIRH RD ++IR  D V+L S  D+   P +A+I   + D +TG KMM L WYYRPEH      +    +++YASRH D+N VDCIEDKA+VL    +SR++A  K RQ +  RP L+  +  +++       P D   +    +               P  ++ SNVF+CR +YD    ++ RN+
Sbjct:  729 WEWDGVPYRKRVFRRSDCSPTWHRCYRAIRHVRDGILIRERDSVLLCSGPDRCSPPHVARITALFPDPKTGIKMMALLWYYRPEHVSGTAPNHPVSNELYASRHCDTNPVDCIEDKAYVLTASAFSRYMARAKYRQSAHPRPPLSQVVPKLTHSVNQTAGPSDDAIEQAASI-----------DEHIPDSVSPSNVFLCRSVYDYRLRRVCRNL 931          
BLAST of BAH domain-containing protein vs. TrEMBL
Match: A0A293MBS7 (Bromo adjacent homology (BAH) domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.819e-32
Identity = 80/212 (37.74%), Postives = 109/212 (51.42%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            W W GEPF K + +       ++TC+ A+RHT  DVI R  DCV+LRS   +   PF+AK+   + +++ G+ MM+L WYYRPEHT+QG    H E +++AS+H D NSV CIEDK +VL    Y R+ A  K    G RP  A           VV  PD  +  +  D                P  M    VF CR +YD  Q ++ +N
Sbjct:  152 WSWDGEPFSKIVVVNNEDTPHERTCFPAMRHTEGDVI-RVRDCVLLRSGTRKVDLPFVAKVAALWENDDDGEMMMSLLWYYRPEHTDQGRKPHHMEDEIFASKHRDCNSVACIEDKCYVLTFAEYCRYRARTKLLEEGRRPRTA-----------VV--PDLEEGYSRRDRLP-------------PGRMDPQLVFFCRRVYDFRQRRLLKN 336          
BLAST of BAH domain-containing protein vs. TrEMBL
Match: A0A1S8X3V4 (BAH domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_02962 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.872e-32
Identity = 77/214 (35.98%), Postives = 112/214 (52.34%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQ--EPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQK-RQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            WEW G P+ K +  +         CY AIRH RD ++IR  D V+L S  D+   P +A+I   + D +TG KMM L WYYRPEH      +    +++YASRH D+N VDCIEDKA+VL    +SR++A  K RQ +  RP L+  +  +++       P D   +    +               P  ++ SNVF+CR +YD    ++ RN+
Sbjct:  760 WEWDGVPYRKRVFRRSDCSPTWHRCYRAIRHVRDGILIRERDSVLLCSGPDRCSPPHVARITALFPDPKTGIKMMALLWYYRPEHVSGTAPNHPVSNELYASRHCDTNPVDCIEDKAYVLTASAFSRYMARAKYRQSAHPRPPLSQVVPKLTHSVNQTAGPSDDAIEQAASI-----------DEHIPDSVSPSNVFLCRSVYDYRLRRVCRNL 962          
BLAST of BAH domain-containing protein vs. TrEMBL
Match: A0A4S2KZ72 (BAH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010348 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.351e-32
Identity = 77/214 (35.98%), Postives = 111/214 (51.87%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQ--EPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQK-RQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            WEW G P+ K +  +         CY AIRH RD ++IR  D V+L S  D+   P +A+I   + D +TG KMM L WYYRPEH      +    +++YASRH D+N VDCIEDKA+VL    +SR++A  K RQ +  RP L+  +  +++       P D   +                    P  ++ SNVF+CR +YD    ++ RN+
Sbjct:  806 WEWDGVPYRKRVLRRSDCSPTWHRCYRAIRHIRDGILIRERDSVLLCSGPDRCSPPHVARITALFPDPKTGIKMMALLWYYRPEHVSGTAPNHPVPNELYASRHCDTNPVDCIEDKAYVLTASAFSRYMARTKYRQSAHPRPPLSQIVPQLTHSANQTPGPSDDAIEQ-----------AAALDEHIPDSVSPSNVFLCRSVYDYRLRRVCRNL 1008          
BLAST of BAH domain-containing protein vs. Ensembl Cavefish
Match: bahd1 (bromo adjacent homology domain containing 1 [Source:NCBI gene;Acc:107197451])

HSP 1 Score: 127.487 bits (319), Expect = 2.289e-29
Identity = 73/214 (34.11%), Postives = 108/214 (50.47%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLL-DWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG    K + +        + CY  ++  RD+ +IR  D V+LRS   ++  P++AK+  F+ D E+G+ MM+LFWYYRPEHT+ G +   H E++++ASRH D NSV CIEDK +VL +  Y RF A  KR+      GL     PV                        +  YT+      P ++    VFVCR +YD    ++ +N+
Sbjct:  667 WLPVGSAAEKEVFILGEEAPALRRCYEGVQ--RDEEVIRVRDTVLLRSGPRKKSLPYVAKVSAFWEDPESGELMMSLFWYYRPEHTQGGRVPSMHCENEIFASRHQDENSVACIEDKCYVLTLAQYCRFCALVKRREE----GLPKSAPPVP----------------------PALSYTIPAHRRVPADVDPDLVFVCRHVYDFRYGRLLKNL 852          
BLAST of BAH domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000006296.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:46170528:46176590:1 gene:ENSAMXG00000006137.2 transcript:ENSAMXT00000006296.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.716 bits (317), Expect = 3.632e-29
Identity = 72/196 (36.73%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 2304 EIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL-LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            E   + CY  +   RD  +IR  D V+LRS   ++  P++AKI   + D +TG+ MM+LFWYYRPEHT+ G     H E++++ASRH D NSV CIED+ +VLP+  Y RF A  KR+  G           V +   VV  P DS   ++  V            +   PE+    V++CR +YD    +I +N+
Sbjct:  643 ETALRQCYEGVE--RDGEVIRIRDTVLLRSGPRKKSLPYVAKISALWDDPKTGELMMSLFWYYRPEHTQGGRDPSMHCENEIFASRHQDENSVACIEDRCYVLPLAQYCRFCALVKRRSEG-----------VPDSTPVVPRPSDSAIPSHRLV-----------PDDVDPEL----VYLCRHVYDFRYGRILKNL 810          
BLAST of BAH domain-containing protein vs. Ensembl Cavefish
Match: bahcc1a (BAH domain and coiled-coil containing 1a [Source:ZFIN;Acc:ZDB-GENE-170301-1])

HSP 1 Score: 51.6026 bits (122), Expect = 5.918e-6
Identity = 41/137 (29.93%), Postives = 63/137 (45.99%), Query Frame = 3
Query: 2247 FWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDC-VMLRSSADQEPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGS 2654
             W W G P  +     L G+   K  Y A+   RD  ++R  DC V L +   Q P++ +I  F+    +   ++ + W+Y PE T+ G      +  +Y S H D N V  I  K  V+  E Y R V+  ++ GS
Sbjct: 1952 LWRWSGSPTQRR---GLKGK-ARKLFYKAVVRGRD--MVRVGDCAVFLSTGRPQLPYVGRIESFWESWSS-SMVVKVKWFYHPEETKLGKSHRDGKHALYQSCHEDENDVQTISHKCQVVSREEYER-VSRNRKPGS 2080          
BLAST of BAH domain-containing protein vs. Ensembl Nematostella
Match: EDO43560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY11])

HSP 1 Score: 61.6178 bits (148), Expect = 2.338e-11
Identity = 46/140 (32.86%), Postives = 58/140 (41.43%), Query Frame = 3
Query: 2463 MMTLFWYYRPEHTEQGL-LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN 2879
            MM++ WYYRPE TE G     H E +V ASRH D NSV CI DK + L    Y R+ A    Q    +   A    PV    +  T P    A                      P+   S VF CR +YD    ++ +N
Sbjct:    2 MMSVLWYYRPEQTEVGRDPSIHGEMEVMASRHKDDNSVACIVDKCYALSYPEYCRYRA----QNKLCQESRATPFSPVPPGQS--TRPGSVPA----------------------PDTDPSLVFFCRQVYDHRMGRVIKN 113          
BLAST of BAH domain-containing protein vs. Ensembl Nematostella
Match: EDO47932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKM4])

HSP 1 Score: 51.2174 bits (121), Expect = 2.271e-7
Identity = 39/134 (29.10%), Postives = 62/134 (46.27%), Query Frame = 3
Query: 2247 FWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE---PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQ 2639
             W+W G    KS Q +  G+   K+ Y +I   R D  I   +C +  S+  +    P++ KI   + +   G  ++ + WYY PE T+QG      ++ +Y S H+D N +  I  K  V+  E Y   V  Q
Sbjct:    2 LWQWSG----KSTQNKRKGK-GRKSFYKSI--ARGDETISVGECAVFTSNPSKSHNLPYVGKIESMW-EGWNGCMVVKVRWYYHPEETKQGRRPGDVQNSLYRSTHVDENEIQTISHKCEVVSPEDYKERVTSQ 127          
BLAST of BAH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046482.1 (bromo adjacent homology domain-containing 1 protein [Source:NCBI gene;Acc:101171458])

HSP 1 Score: 135.191 bits (339), Expect = 9.213e-32
Identity = 75/214 (35.05%), Postives = 108/214 (50.47%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL-LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG P  K + +    E   + CY  +   RD  +IR  D V+LRS   ++  P++AKI   + D +TG+ MM+LFWYYRPEHT+ G     H E++++ASRH D NSV CIED+ +VLP+  Y RF A  KR+  G  PG A           V + PD                +        P ++    V++CR +YD    +I +N+
Sbjct:  705 WRPVGAPTEKEVFIAGEDETCLRRCYEGVE--RDGEVIRLRDTVLLRSGPRKKSPPYVAKISALWEDPKTGELMMSLFWYYRPEHTQGGRDPRAHCENEIFASRHQDENSVACIEDRCYVLPLAQYCRFCALVKRRAEGGPPGGAC---------PVPSRPD----------------FAPPSHRCVPTDVDPELVYLCRHVYDFRYGRILKNL 891          
BLAST of BAH domain-containing protein vs. Ensembl Medaka
Match: bahd1 (bromo adjacent homology domain containing 1 [Source:NCBI gene;Acc:105356924])

HSP 1 Score: 124.02 bits (310), Expect = 2.391e-28
Identity = 71/217 (32.72%), Postives = 107/217 (49.31%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL-LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTE---PDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG PF K +   +    V + C+  IR   D  +IR  D V+L+S   ++  P++AK+   + + E+G+ MM+LFWYYRPEHT+ G     H E++++ASRH D NSV CIEDK +VL +  Y RF A  KR+  G      + ++P    + + T    PDD   D                            V+ CR +YD    ++ +N+
Sbjct:  611 WRSVGVPFEKEVFTVVKESPVLRKCFEGIRRKGD--LIRVRDTVLLKSGPRKKSLPYVAKVSALWEEPESGELMMSLFWYYRPEHTQGGRNPRIHCENEIFASRHQDVNSVACIEDKCYVLTLAQYCRFCALVKRRREGVGESATSLMVPPVVGNAIATHHCVPDDVDPDL---------------------------VYFCRHVYDFRYGRLLKNL 798          
BLAST of BAH domain-containing protein vs. Ensembl Medaka
Match: bahd1 (bromo adjacent homology domain containing 1 [Source:NCBI gene;Acc:105356924])

HSP 1 Score: 122.479 bits (306), Expect = 7.636e-28
Identity = 71/217 (32.72%), Postives = 106/217 (48.85%), Query Frame = 3
Query: 2250 WEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQE--PFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGL-LDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTE---PDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNI 2882
            W  VG PF K +        V + C+  IR   D  +IR  D V+L+S   ++  P++AK+   + + E+G+ MM+LFWYYRPEHT+ G     H E++++ASRH D NSV CIEDK +VL +  Y RF A  KR+  G      + ++P    + + T    PDD   D                            V+ CR +YD    ++ +N+
Sbjct:  630 WRSVGVPFEKEVFTVGEESPVLRKCFEGIRRKGD--LIRVRDTVLLKSGPRKKSLPYVAKVSALWEEPESGELMMSLFWYYRPEHTQGGRNPRIHCENEIFASRHQDVNSVACIEDKCYVLTLAQYCRFCALVKRRREGVGESATSLMVPPVVGNAIATHHCVPDDVDPDL---------------------------VYFCRHVYDFRYGRLLKNL 817          
BLAST of BAH domain-containing protein vs. Planmine SMEST
Match: SMESG000012095.1 (SMESG000012095.1)

HSP 1 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 1044/1052 (99.24%), Postives = 1047/1052 (99.52%), Query Frame = 3
Query:  120 RKETTKDVSYRDQHNIGRRKSTSSVVTYSLDSRLFFDVYAKFNNENLPKKRNVYNGICNNSSPSNANIVKKTSDIKTKPLTILASKRHLNSENYSDKDSQDDDSEVSSKRKIIKVSYEAKPLNSDEACIPSPKIPSDLPITNDKLNKAYHSNENRIISTRKSQPNTVINENSTKSEIPLKTTTKNETFQKLLENRTVFKKHLSKNLLDKVKSNRKLTKPAITXXXXXXXXXXXXXXXXXXADSIYQSSDGNIISPVKSKKLKRSESTNPTNDLKLDLSPPKRGKRIASLNAAAIINCVQNLFNESPKHSPIRQNRRRISKSDNIHESTQTKENEIESLNRNKPHSKINCNKIPLNSTVDKEXXXXXXXXXXXXXXXXXXXXXXXXXXXTLDEKELKKSEKNIVNNKTXXXXXXXXXXXXXXXXXXXDHCKQPKKSIESDEKQKKSTEDVXXXXXXXXXXXXXXXXXENGKKIKQSIENKNQKRSIXXXXXXXXXXXXXXXTVTPVENVKSIITTMKEESIENADXXXXXXXXXXXXXXXXDKRPEEIPSSNTDEKSNKKFDEPQKPTDKDKPIKNHVDSTKSQEIDGKTNSTISQNSKNPKRNTSNSKNNNLSRFFDITKRSHSNKRHVDSASVPNSQAKKPKTFTVERIVRRKPKSVDQCFDELSRLTAANKKSKKQQQLDEKQANEGXXXXXXXXXXXXXXXXXXXSFWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQEPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNILQNIQSPKLELTDPCESVDSAMSISSCESEHKHQQQDXXXXXLTVVIPTNEIETPLSDIPIPPCKTEEVATKCLPPISSFHSRLPLLQLDTTXXXXXXXXXXXXXXXXXXXXXNSTNGDVRDCPKQPNGHP 3275
            RKETTKD+SYRDQHNIGRRKSTSSVVTYSLDSRLFFDVYAKFNNENLPKKRNVYNGICNNSSPSNANIVKKTSDIKTKPLTILASKRHLNSENYSDKDSQDDDSEVSSKRKIIKVSYEAKPLNSDEACIPSPKIPSDLPITNDKLNKAYHSNENRIISTRKSQPNTVINENSTKSEIPLKTTTKNETFQKLLENRTVFKKHLSKNLLDKVKSNRKLTKPAITSSNDSRRLSSRLNKSLNDADSIYQSSDGNIISPVKSKKLKRSESTNPTNDLKLDLSPPKRGKRIASLNAAAIINCVQNLFNESPKHSPIRQNRRRISKSDNIHESTQTKENEIESLNRNKPHSKINCNKIPLNSTVDKETSDTNVSSTTNSRKSPSPPKSREKIPKTLDEKELKKSEKNIVNNKTQEKSIQKEEKSNKIKEN KDHCKQPKKSIESD+KQKKSTEDVKKPKKSINDSKKPKKSIENGKKIK SIENKNQKRSIENENKSKNPNE+KNKTV PVENVKSIITTMKEESIENADEKSNSIIEENSQSNKIDKRPEEIPSSNTDEKSNKK DEPQKPTDKDKPIKNHVDSTKSQEIDGKTNSTISQNSKNPKRNTSNSKNNNLSRFFDITKRSHSNKRHVDSASVPNSQAKKPKTFTVERIVRRKPKSVDQCFDELSRLTAANKKSKKQQQLDEKQANEGNDKNDENSAEDNDDDDNGESFWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQEPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNILQNIQSPKLELTDPCESVDSAMSISSCESEHKHQQQD AAAALTVVIPTNEIETPLSDIPIPPCKTEEVATKCLPPISSFHSRLPLLQLDTTVPVAKSCPPPPASKPIQPPLPNSTNGDVRDCPKQPNGHP
Sbjct:   31 RKETTKDISYRDQHNIGRRKSTSSVVTYSLDSRLFFDVYAKFNNENLPKKRNVYNGICNNSSPSNANIVKKTSDIKTKPLTILASKRHLNSENYSDKDSQDDDSEVSSKRKIIKVSYEAKPLNSDEACIPSPKIPSDLPITNDKLNKAYHSNENRIISTRKSQPNTVINENSTKSEIPLKTTTKNETFQKLLENRTVFKKHLSKNLLDKVKSNRKLTKPAITSSNDSRRLSSRLNKSLNDADSIYQSSDGNIISPVKSKKLKRSESTNPTNDLKLDLSPPKRGKRIASLNAAAIINCVQNLFNESPKHSPIRQNRRRISKSDNIHESTQTKENEIESLNRNKPHSKINCNKIPLNSTVDKETSDTNVSSTTNSRKSPSPPKSREKIPKTLDEKELKKSEKNIVNNKTQEKSIQKEEKSNKIKENFKDHCKQPKKSIESDKKQKKSTEDVKKPKKSINDSKKPKKSIENGKKIKLSIENKNQKRSIENENKSKNPNEEKNKTVKPVENVKSIITTMKEESIENADEKSNSIIEENSQSNKIDKRPEEIPSSNTDEKSNKKLDEPQKPTDKDKPIKNHVDSTKSQEIDGKTNSTISQNSKNPKRNTSNSKNNNLSRFFDITKRSHSNKRHVDSASVPNSQAKKPKTFTVERIVRRKPKSVDQCFDELSRLTAANKKSKKQQQLDEKQANEGNDKNDENSAEDNDDDDNGESFWEWVGEPFHKSIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQEPFLAKIIVFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDCIEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDDSKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRNILQNIQSPKLELTDPCESVDSAMSISSCESEHKHQQQD-AAAALTVVIPTNEIETPLSDIPIPPCKTEEVATKCLPPISSFHSRLPLLQLDTTVPVAKSCPPPPASKPIQPPLPNSTNGDVRDCPKQPNGHP 1081          
The following BLAST results are available for this feature:
BLAST of BAH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BAHD11.368e-2433.02bromo adjacent homology domain containing 1 [Sourc... [more]
BAHD13.572e-2332.09bromo adjacent homology domain containing 1 [Sourc... [more]
BAHD13.673e-2332.09bromo adjacent homology domain containing 1 [Sourc... [more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hers1.496e-2939.41gene:FBgn0052529 transcript:FBtr0306523[more]
Hers1.533e-2939.41gene:FBgn0052529 transcript:FBtr0074801[more]
Hers1.762e-2939.41gene:FBgn0052529 transcript:FBtr0332993[more]
Hers1.762e-2939.41gene:FBgn0052529 transcript:FBtr0074800[more]
Hers1.762e-2939.41gene:FBgn0052529 transcript:FBtr0306520[more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bahd13.440e-2733.33bromo adjacent homology domain containing 1 [Sourc... [more]
bahd13.440e-2733.33bromo adjacent homology domain containing 1 [Sourc... [more]
BX649281.11.030e-2635.05bromo adjacent homology domain containing 1 [Sourc... [more]
CABZ01087948.14.558e-2630.84bromo adjacent homology domain-containing 1 protei... [more]
bahcc1a5.565e-729.20BAH domain and coiled-coil containing 1a [Source:Z... [more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ptpa1.487e-2728.62protein phosphatase 2 phosphatase activator [Sourc... [more]
ptpa1.737e-2728.62protein phosphatase 2 phosphatase activator [Sourc... [more]
mcat7.244e-627.61malonyl-CoA-acyl carrier protein transacylase [Sou... [more]
mcat8.751e-626.97malonyl-CoA-acyl carrier protein transacylase [Sou... [more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Bahd11.493e-2332.09bromo adjacent homology domain containing 1 [Sourc... [more]
back to top
BLAST of BAH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q497V6|BAHD1_MOUSE9.021e-2332.09Bromo adjacent homology domain-containing 1 protei... [more]
sp|Q8TBE0|BAHD1_HUMAN1.764e-2232.09Bromo adjacent homology domain-containing 1 protei... [more]
sp|F4JL28|EBS_ARATH1.297e-631.87Chromatin remodeling protein EBS OS=Arabidopsis th... [more]
sp|Q9FEN9|SHL_ARATH2.025e-631.11Chromatin remodeling protein SHL OS=Arabidopsis th... [more]
back to top
BLAST of BAH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AW972.242e-3339.73BAH domain-containing protein OS=Echinostoma capro... [more]
A0A074Z8C81.675e-3235.98BAH domain-containing protein OS=Opisthorchis vive... [more]
A0A293MBS71.819e-3237.74Bromo adjacent homology (BAH) domain-containing pr... [more]
A0A1S8X3V41.872e-3235.98BAH domain protein (Fragment) OS=Opisthorchis vive... [more]
A0A4S2KZ723.351e-3235.98BAH domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bahd12.289e-2934.11bromo adjacent homology domain containing 1 [Sourc... [more]
ENSAMXT00000006296.23.632e-2936.73pep primary_assembly:Astyanax_mexicanus-2.0:3:4617... [more]
bahcc1a5.918e-629.93BAH domain and coiled-coil containing 1a [Source:Z... [more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO435602.338e-1132.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479322.271e-729.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BAH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000046482.19.213e-3235.05bromo adjacent homology domain-containing 1 protei... [more]
bahd12.391e-2832.72bromo adjacent homology domain containing 1 [Sourc... [more]
bahd17.636e-2832.72bromo adjacent homology domain containing 1 [Sourc... [more]
back to top
BLAST of BAH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000012095.10.000e+099.24SMESG000012095.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018797 ID=SMED30018797|Name=BAH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3437bp
CTATATAAATCTTATATGATAGACACAAAATGAAAACCCGAAATAAATCA
CTTTTATCATCGAAAGTTAACAATAAAAATAAATCATTATCTAAATTAAA
GGATTCTAAACTTATAAACAGAAAAGAAACTACTAAAGATGTATCATATC
GAGATCAGCATAATATAGGTAGACGAAAGTCCACATCATCTGTCGTTACA
TATAGCTTAGATAGTCGTCTATTTTTTGATGTTTATGCGAAATTTAATAA
TGAAAATCTTCCTAAAAAAAGAAATGTATACAATGGAATTTGTAATAATT
CATCTCCATCAAACGCAAACATTGTTAAAAAAACTTCTGATATCAAAACA
AAGCCATTAACCATCTTAGCTTCAAAAAGACATTTGAATTCAGAAAATTA
TTCCGACAAAGATTCGCAAGATGATGACAGCGAAGTATCGAGTAAACGAA
AAATTATTAAGGTTTCTTATGAGGCAAAACCGCTCAATAGTGATGAAGCC
TGCATTCCATCACCAAAAATCCCATCCGATTTACCTATTACAAATGATAA
ATTGAATAAAGCTTATCATTCCAATGAAAATAGAATCATTTCTACTCGAA
AGTCACAACCAAACACAGTTATAAATGAAAACTCCACCAAATCTGAAATT
CCATTGAAAACCACGACGAAAAACGAAACATTCCAAAAATTATTAGAAAA
TAGAACTGTTTTTAAAAAACATTTGTCCAAGAATTTGCTTGATAAAGTCA
AATCGAACCGAAAATTAACGAAACCGGCAATAACATCGTCTAACGATTCG
AGAAGATTGTCTAGTCGATTGAATAAATCTCTCAATGATGCTGATTCAAT
TTATCAATCAAGCGACGGAAATATCATATCACCTGTCAAATCGAAGAAAT
TGAAACGATCAGAGTCTACCAATCCTACAAATGATCTCAAATTGGATTTA
TCTCCTCCAAAACGTGGCAAACGCATAGCGAGTCTCAATGCTGCTGCCAT
TATCAATTGTGTTCAAAATCTCTTCAATGAATCACCAAAGCACTCTCCAA
TCCGCCAAAATCGCCGTCGAATATCTAAATCCGATAATATTCACGAATCA
ACCCAAACCAAAGAAAACGAAATTGAATCGCTAAACCGCAATAAACCTCA
TTCCAAAATAAATTGCAATAAAATTCCTTTAAATTCAACCGTAGATAAAG
AAACGTCTGATACAAATGTCTCATCAACCACAAACAGCAGAAAATCACCA
AGTCCACCGAAATCCCGGGAGAAAATTCCGAAAACACTGGATGAAAAAGA
GTTGAAAAAATCAGAAAAAAATATTGTCAATAATAAAACCCAAGAAAAAT
CAATTCAAAAAGAAGAAAAATCTAATAAAATCAAGGAAAATATCAAAGAT
CATTGTAAACAACCAAAAAAATCTATTGAAAGTGATGAAAAACAAAAAAA
GTCGACTGAGGACGTCAAAAAACCAAAAAAATCGATTAATGATAGCAAAA
AACCAAAAAAATCAATTGAAAATGGTAAAAAAATTAAACAATCGATTGAA
AACAAAAATCAAAAAAGATCGATTGAAAACGAAAACAAATCCAAAAATCC
AAATGAAAAAAAAAACAAAACAGTAACACCGGTAGAAAATGTAAAATCAA
TAATAACAACGATGAAAGAAGAGTCCATAGAAAATGCAGATGAAAAATCT
AATAGCATAATCGAAGAAAATAGCCAATCTAATAAAATCGATAAAAGACC
TGAAGAAATCCCTTCATCAAATACCGATGAAAAGTCGAATAAAAAATTCG
ATGAGCCGCAAAAACCAACGGATAAAGATAAGCCAATCAAAAATCATGTC
GATTCTACCAAGTCACAGGAAATCGATGGGAAAACCAATTCGACAATTTC
TCAGAATAGTAAAAATCCAAAACGAAACACCAGTAACAGCAAGAACAATA
ATCTCTCTCGATTTTTCGATATTACCAAGCGCAGCCATTCCAACAAACGG
CACGTGGATTCTGCGTCGGTTCCAAACAGTCAGGCAAAGAAACCGAAAAC
GTTTACAGTGGAACGAATTGTCAGACGGAAACCGAAAAGTGTTGATCAGT
GTTTCGATGAGCTATCGAGATTAACTGCAGCAAATAAGAAGAGTAAAAAA
CAGCAGCAGTTAGACGAGAAACAAGCCAATGAAGGAAATGACAAAAACGA
CGAGAATAGCGCCGAGGATAATGACGATGACGATAATGGGGAATCTTTCT
GGGAATGGGTCGGTGAACCGTTTCATAAATCCATCCAGTTGCAGCTAGCA
GGAGAAATTGTAGATAAAACTTGTTACAATGCAATCAGACACACTCGAGA
TGACGTCATTATTCGCAGCCTTGATTGCGTCATGCTACGCAGCAGTGCTG
ATCAAGAGCCGTTTCTAGCCAAGATCATTGTATTTTATCTAGACGAGGAA
ACTGGAAAGAAAATGATGACTCTGTTTTGGTATTACAGACCAGAACATAC
GGAACAAGGTCTTTTAGATTGGCATACGGAGTCTGATGTGTATGCGTCAC
GTCACTTAGATAGCAATTCGGTCGACTGCATTGAAGATAAAGCTTTCGTG
TTGCCCGTGGAAATATATTCTCGATTTGTGGCATACCAAAAGCGCCAGGG
CTCTGGAACGCGGCCAGGTTTGGCAGCAAGACTAATACCAGTCAGCAATG
ATGATACAGTCGTTACGGAGCCAGATGACAGTAAAGCTGATAACTACACA
GACGTGTTTATTAGTAGCTGGTATTACACTCTCAATTTCCAAAACTCATT
TCCGCCTGAAATGACTAATTCGAATGTATTCGTTTGTCGAGGTCTTTACG
ACATCAATCAGCACAAGATTACTCGCAATATTCTCCAAAATATACAATCA
CCGAAACTTGAACTCACTGATCCGTGTGAATCAGTTGACAGTGCAATGTC
GATTTCATCATGTGAATCGGAACACAAACATCAACAACAAGATGCCGCCG
CCGCCGCTCTGACCGTCGTCATTCCAACCAATGAAATTGAAACTCCATTA
TCAGACATACCGATCCCCCCTTGTAAAACCGAGGAAGTAGCAACGAAGTG
CCTCCCACCTATAAGTTCGTTTCACAGCCGTTTACCGCTGCTACAATTAG
ATACCACAGTGCCAGTTGCTAAATCTTGTCCCCCGCCTCCTGCTTCCAAG
CCAATACAGCCTCCTCTACCGAATTCGACCAATGGTGATGTTAGAGATTG
TCCTAAACAGCCAAATGGGCATCCGTGATCCCCAGATTATCTGATGTGTA
CAAATTTATCATATGATCTTAATTATACTTTTATCGTATATTATTAATGT
TAAATTTTGTGTCATTTGTCCACTTTACTATTTTATATTATTATTATTAT
TATTACATTTCAGATCTCTCAAGATCTAGATGAATGT
back to top

protein sequence of SMED30018797-orf-1

>SMED30018797-orf-1 ID=SMED30018797-orf-1|Name=SMED30018797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1083bp
MKTRNKSLLSSKVNNKNKSLSKLKDSKLINRKETTKDVSYRDQHNIGRRK
STSSVVTYSLDSRLFFDVYAKFNNENLPKKRNVYNGICNNSSPSNANIVK
KTSDIKTKPLTILASKRHLNSENYSDKDSQDDDSEVSSKRKIIKVSYEAK
PLNSDEACIPSPKIPSDLPITNDKLNKAYHSNENRIISTRKSQPNTVINE
NSTKSEIPLKTTTKNETFQKLLENRTVFKKHLSKNLLDKVKSNRKLTKPA
ITSSNDSRRLSSRLNKSLNDADSIYQSSDGNIISPVKSKKLKRSESTNPT
NDLKLDLSPPKRGKRIASLNAAAIINCVQNLFNESPKHSPIRQNRRRISK
SDNIHESTQTKENEIESLNRNKPHSKINCNKIPLNSTVDKETSDTNVSST
TNSRKSPSPPKSREKIPKTLDEKELKKSEKNIVNNKTQEKSIQKEEKSNK
IKENIKDHCKQPKKSIESDEKQKKSTEDVKKPKKSINDSKKPKKSIENGK
KIKQSIENKNQKRSIENENKSKNPNEKKNKTVTPVENVKSIITTMKEESI
ENADEKSNSIIEENSQSNKIDKRPEEIPSSNTDEKSNKKFDEPQKPTDKD
KPIKNHVDSTKSQEIDGKTNSTISQNSKNPKRNTSNSKNNNLSRFFDITK
RSHSNKRHVDSASVPNSQAKKPKTFTVERIVRRKPKSVDQCFDELSRLTA
ANKKSKKQQQLDEKQANEGNDKNDENSAEDNDDDDNGESFWEWVGEPFHK
SIQLQLAGEIVDKTCYNAIRHTRDDVIIRSLDCVMLRSSADQEPFLAKII
VFYLDEETGKKMMTLFWYYRPEHTEQGLLDWHTESDVYASRHLDSNSVDC
IEDKAFVLPVEIYSRFVAYQKRQGSGTRPGLAARLIPVSNDDTVVTEPDD
SKADNYTDVFISSWYYTLNFQNSFPPEMTNSNVFVCRGLYDINQHKITRN
ILQNIQSPKLELTDPCESVDSAMSISSCESEHKHQQQDAAAAALTVVIPT
NEIETPLSDIPIPPCKTEEVATKCLPPISSFHSRLPLLQLDTTVPVAKSC
PPPPASKPIQPPLPNSTNGDVRDCPKQPNGHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001025BAH_dom
IPR023795Serpin_CS
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 570..617
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1051..1085
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..739
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 618..652
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 289..313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 663..677
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..538
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 376..411
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 340..685
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 343..375
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 710..728
NoneNo IPR availablePANTHERPTHR46576FAMILY NOT NAMEDcoord: 513..952
IPR001025Bromo adjacent homology (BAH) domainPROSITEPS51038BAHcoord: 780..902
score: 11.115