Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30018781
Length (bp)627
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30018781) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30018781) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30018781) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30018781) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018781

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30018781SMESG000055797.1 dd_Smed_v4_433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30018781SMESG000055797.1 dd_Smed_v4_433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018781SMESG000055797.1 dd_Smed_v4_433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018781SMESG000067481.1 SMESG000055797.1 SMESG000055793.1 Contig19985uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018781SMESG000067481.1 SMESG000055797.1 SMESG000055793.1 Contig19985newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30018781SMESG000055797.1 OX_Smed_1.0.02046ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30018781SMESG000055797.1 dd_Smed_v6_433_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 117.857 bits (294), Expect = 1.460e-30
Identity = 65/182 (35.71%), Postives = 98/182 (53.85%), Query Frame = 3
Query:   36 VALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT--GGNIAKGVQLWFNEVSGYTFSDNSCSE-NTCGHYTQIVWAKSKELGCGLAKCK----YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            VA     G L+DEE+  ++E+HN +R  V+       P A++M  M W EE A+ A+A A +C + H+    R+       G+N+   T  G ++   ++ W +E   Y  S  +CS    CGHYTQ+VWAK++ +GCG   C+      +  +  LVCNY P GN   + PY+ G PCS+C
Sbjct:   19 VATTGPVGALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQC 186          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 117.857 bits (294), Expect = 1.460e-30
Identity = 65/182 (35.71%), Postives = 98/182 (53.85%), Query Frame = 3
Query:   36 VALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT--GGNIAKGVQLWFNEVSGYTFSDNSCSE-NTCGHYTQIVWAKSKELGCGLAKCK----YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            VA     G L+DEE+  ++E+HN +R  V+       P A++M  M W EE A+ A+A A +C + H+    R+       G+N+   T  G ++   ++ W +E   Y  S  +CS    CGHYTQ+VWAK++ +GCG   C+      +  +  LVCNY P GN   + PY+ G PCS+C
Sbjct:   19 VATTGPVGALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQC 186          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 117.857 bits (294), Expect = 1.460e-30
Identity = 65/182 (35.71%), Postives = 98/182 (53.85%), Query Frame = 3
Query:   36 VALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT--GGNIAKGVQLWFNEVSGYTFSDNSCSE-NTCGHYTQIVWAKSKELGCGLAKCK----YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            VA     G L+DEE+  ++E+HN +R  V+       P A++M  M W EE A+ A+A A +C + H+    R+       G+N+   T  G ++   ++ W +E   Y  S  +CS    CGHYTQ+VWAK++ +GCG   C+      +  +  LVCNY P GN   + PY+ G PCS+C
Sbjct:   19 VATTGPVGALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQC 186          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 112.464 bits (280), Expect = 5.361e-30
Identity = 66/165 (40.00%), Postives = 87/165 (52.73%), Query Frame = 3
Query:   90 LEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNY---EWVGQNIAMFTGG----NIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +E HN++R  V        P AA+M+ M+W +  A  A+A A++C F H+   D+ Y  Y   E+VG+NI  + GG         +  W+NE   Y F   SCS   CGHYTQ+VWA S  +GC +A C           VCNYGP GNF +  PY  GE CS C
Sbjct:   38 IEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENI--WLGGIKSFTPRHAITAWYNETQFYDFDSLSCSR-VCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLC 192          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 112.079 bits (279), Expect = 5.614e-30
Identity = 66/165 (40.00%), Postives = 87/165 (52.73%), Query Frame = 3
Query:   90 LEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNY---EWVGQNIAMFTGG----NIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +E HN++R  V        P AA+M+ M+W +  A  A+A A++C F H+   D+ Y  Y   E+VG+NI  + GG         +  W+NE   Y F   SCS   CGHYTQ+VWA S  +GC +A C           VCNYGP GNF +  PY  GE CS C
Sbjct:   38 IEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENI--WLGGIKSFTPRHAITAWYNETQFYDFDSLSCSR-VCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLC 192          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.003e-22
Identity = 55/167 (32.93%), Postives = 81/167 (48.50%), Query Frame = 3
Query:   87 ILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDT--INDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-----YSKYKMNFLVCNYGPGGNFNSELPYETGE--PCSKC 560
            I   HN++R+ V          A++M  + WS+E A+ AQ  AD C F H    IN         VG+NI      N +  + +WFNEV       N   ++ CGHY Q+VWAK+  +GCG ++C+     + +   N  VC+Y P GN      + +G+   CS C
Sbjct:   84 ITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRIN---------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNTMPAFTWASGDNGKCSNC 232          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 91.2781 bits (225), Expect = 7.231e-22
Identity = 56/166 (33.73%), Postives = 80/166 (48.19%), Query Frame = 3
Query:   54 SGDLSDEE------RNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDT--INDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-----YSKYKMNFLVCNYGPGGN 512
            SG LS  E      +  I   HN++R+ V          A++M  + WS+E A+ AQ  AD C F H    IN         VG+NI      N +  + +WFNEV       N   ++ CGHY Q+VWAK+  +GCG ++C+     + +   N  VC+Y P GN
Sbjct:   67 SGLLSRSEHPNEYLKKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRIN---------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGN 214          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5478005:1 gene:WBGene00003055.1 transcript:F48E8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 91.2781 bits (225), Expect = 7.231e-22
Identity = 56/166 (33.73%), Postives = 80/166 (48.19%), Query Frame = 3
Query:   54 SGDLSDEE------RNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDT--INDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-----YSKYKMNFLVCNYGPGGN 512
            SG LS  E      +  I   HN++R+ V          A++M  + WS+E A+ AQ  AD C F H    IN         VG+NI      N +  + +WFNEV       N   ++ CGHY Q+VWAK+  +GCG ++C+     + +   N  VC+Y P GN
Sbjct:   67 SGLLSRSEHPNEYLKKWITHEHNRYRRMV---------PASDMNMLYWSDELAASAQRHADTCDFRHSRGRIN---------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGN 214          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.349e-21
Identity = 50/148 (33.78%), Postives = 73/148 (49.32%), Query Frame = 3
Query:   87 ILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDT--INDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-----YSKYKMNFLVCNYGPGG 509
            I   HN++R+ V          A++M  + WS+E A+ AQ  AD C F H    IN         VG+NI      N +  + +WFNEV       N   ++ CGHY Q+VWAK+  +GCG ++C+     + +   N  VC+Y P G
Sbjct:   84 ITHEHNRYRRMVP---------ASDMNMLYWSDELAASAQRHADTCDFRHSRGRIN---------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQG 213          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: vap-2 (Venom-Allergen-like Protein [Source:UniProtKB/TrEMBL;Acc:A0A0K3AST9])

HSP 1 Score: 89.3521 bits (220), Expect = 6.564e-21
Identity = 64/183 (34.97%), Postives = 91/183 (49.73%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVA-----NGEV-SNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGN------IAKGVQLWFNEVSGY-TFSDNSCSE-------NTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPC 551
            +SD  RN  LE HN +R  +A     NGE  ++QPKA+ M +M +       AQ  A+ C F H    +R        GQN+ M +  N      I   V+ W+ E+  + T  DN  +           GHYTQ+ W ++  LGCG+A C     KM+++VC+YGP GN  +   YE G+PC
Sbjct:  181 VSDVTRNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPN-----QGQNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCP----KMSYVVCHYGPAGNRKNNKIYEIGDPC 354          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 130.954 bits (328), Expect = 4.696e-36
Identity = 75/176 (42.61%), Postives = 101/176 (57.39%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHD---TINDRKYGNYEWVGQNIAMF--------TGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEP-CS 554
            ++ EER+ IL+ HN+ R+ VA G    QP A NM+++VW +E A+RAQ  AD C F HD   TIN         +GQN+A+           G+    +Q WFNEV  Y+F D + S  T GHY+Q+VW ++  +GCG A+ K +       VCNYGPGGN     PYE G+P CS
Sbjct:   32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFT------MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD-AWSPKT-GHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 69.3218 bits (168), Expect = 4.696e-14
Identity = 52/183 (28.42%), Postives = 78/183 (42.62%), Query Frame = 3
Query:   51 CSGDLS--DEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQL------WFNEVSGYTFSDNSCSE----NTCGHYTQIVWAKSKELGCGLAK-CKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            CSG+    D     IL++HN+ R  +A G VS  P A  M  M W    A  A   A +C   HD    R    Y + GQN+++    ++   V L      WF+E    T  D    +       GH+T +V  ++  +GC +A+    +  +   L CNY      N+ + Y  G   S+C
Sbjct:   50 CSGEFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC--RNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVNNPV-YRAGTAASEC 229          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 64.6994 bits (156), Expect = 2.902e-12
Identity = 53/184 (28.80%), Postives = 80/184 (43.48%), Query Frame = 3
Query:   60 DLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKG--------VQLWFNEV--SGYTFSDNSCSE---NTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----FLVCNYGPGGNFNSELPYETGEPCSKC 560
            ++S+  R  +L++HN  R  +A+G +     AA+M  + W  E    A   A +C F HD    R    +++ GQNI  F  G   K         V  WF E   +  +F D           GH+T +V  +   +GC  A  ++ + K N     L CNY     FN  + Y++G   SKC
Sbjct:   90 EMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC--RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGC--AGVRFLEPKSNRFQFMLTCNYDYNNIFNEPI-YQSGPAGSKC 268          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 62.003 bits (149), Expect = 2.152e-11
Identity = 47/183 (25.68%), Postives = 77/183 (42.08%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGN-------IAKGVQLWFNE--------VSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYS--KYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            LS  E++ ++   N++R  +A G  +N   A  M  + W++E A  A      C   HD  ++     ++W GQN+A     N       +  GV +W++E        +  Y  + N       GH+T +V  ++ E+GC  A    S   YK   L CNY        ++     +  SKC
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNG---PAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKC 231          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 62.003 bits (149), Expect = 2.152e-11
Identity = 47/183 (25.68%), Postives = 77/183 (42.08%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGN-------IAKGVQLWFNE--------VSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYS--KYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            LS  E++ ++   N++R  +A G  +N   A  M  + W++E A  A      C   HD  ++     ++W GQN+A     N       +  GV +W++E        +  Y  + N       GH+T +V  ++ E+GC  A    S   YK   L CNY        ++     +  SKC
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNG---PAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKC 231          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 108.612 bits (270), Expect = 2.904e-27
Identity = 65/183 (35.52%), Postives = 94/183 (51.37%), Query Frame = 3
Query:   75 ERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            +R +IL++HNK R     GEV   P A+NM+ M+W +E    A + A++C + H   +         +GQN+A+  G   + A  VQ W++EV  YT+             CS   C HYTQ+VWA +  +GC +  C     +MN          +LVCNY P GN+  E PY+ G PCS+C
Sbjct:   64 DREEILKLHNKLR-----GEV--YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLLMS-----IGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCP----RMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQC 230          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 104.76 bits (260), Expect = 3.125e-27
Identity = 60/174 (34.48%), Postives = 93/174 (53.45%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTG--GNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKY-----SKYKM-NFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +S ++   +L+ HN+ R  V        P AANM+ MVW E  A  A+  A +C + H   +  ++     +GQN+++ +G   +I   V+ W++E   +++    CS + C HYTQ+VWA S ++GC + KC       S +K    LVCNY   GN+  E PY+ G PCS C
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH-----IGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSR-CSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSAC 221          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 104.76 bits (260), Expect = 3.125e-27
Identity = 60/174 (34.48%), Postives = 93/174 (53.45%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTG--GNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKY-----SKYKM-NFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +S ++   +L+ HN+ R  V        P AANM+ MVW E  A  A+  A +C + H   +  ++     +GQN+++ +G   +I   V+ W++E   +++    CS + C HYTQ+VWA S ++GC + KC       S +K    LVCNY   GN+  E PY+ G PCS C
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH-----IGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSR-CSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSAC 221          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: CABZ01068499.1 (cysteine-rich venom protein natrin-1-like [Source:NCBI gene;Acc:100536500])

HSP 1 Score: 102.834 bits (255), Expect = 6.590e-27
Identity = 58/162 (35.80%), Postives = 87/162 (53.70%), Query Frame = 3
Query:   78 RNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTG-GNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            + +I+++HN FR++V       QP A+NM +M WS+  A  A+   +KC+  H   + R    YE +G+N+   TG  +    V  W +EV+ Y +   S +    GHYTQ+VW  S E+GC + +C  S Y   F  C+Y   GNF +  PY  G PC+ C
Sbjct:    9 QQEIVDVHNAFRRAV-------QPSASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYE-MGENLFKATGISSWTSVVDAWHSEVNNYKYPIGSINGQATGHYTQVVWYSSYEVGCAVTQCG-SNY---FYGCHYYRAGNFRTVPPYSLGSPCASC 158          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 103.605 bits (257), Expect = 1.180e-26
Identity = 63/183 (34.43%), Postives = 88/183 (48.09%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKC------KYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +S  +   IL+ HNK R +V        P AANM+ M+W +  A  A+A A  C + H      +Y     +GQN+++ TG   +I + V+ W++EV  Y F             C    C HYTQ+VWA S  +GC +  C           +  +LVCNY P GN+  E PY  G PCS C
Sbjct:   61 ISQSDMIAILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSAC 231          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 104.76 bits (260), Expect = 4.179e-27
Identity = 60/183 (32.79%), Postives = 94/183 (51.37%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCK------YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +S  + + +L+ HN+ R  V        P AANM+ MVW E  A  A++ A++C ++H      +Y     +GQN+++ +G   +I   V+ W++E   Y+F           N C+   C HYTQ+VWA S  +GC +  C        +  + ++LVCNY   GN+  E PY+ G PCS C
Sbjct:   58 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSAC 228          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 104.76 bits (260), Expect = 4.794e-27
Identity = 60/183 (32.79%), Postives = 94/183 (51.37%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCK------YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +S  + + +L+ HN+ R  V        P AANM+ MVW E  A  A++ A++C ++H      +Y     +GQN+++ +G   +I   V+ W++E   Y+F           N C+   C HYTQ+VWA S  +GC +  C        +  + ++LVCNY   GN+  E PY+ G PCS C
Sbjct:   53 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSAC 223          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 107.842 bits (268), Expect = 7.967e-27
Identity = 64/183 (34.97%), Postives = 92/183 (50.27%), Query Frame = 3
Query:   75 ERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            ++ +I+++HNK R  V        P A+NM+ M W +E    A+A A++C + H             +GQN+A+  G     A  VQ W++EV  YT+             CS   C HYTQIVWA + ++GC +  CK    +MN          +LVCNY P GN+  E PY+ G PCS+C
Sbjct:   56 DKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCK----RMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSEC 222          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 107.842 bits (268), Expect = 8.397e-27
Identity = 64/183 (34.97%), Postives = 92/183 (50.27%), Query Frame = 3
Query:   75 ERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            ++ +I+++HNK R  V        P A+NM+ M W +E    A+A A++C + H             +GQN+A+  G     A  VQ W++EV  YT+             CS   C HYTQIVWA + ++GC +  CK    +MN          +LVCNY P GN+  E PY+ G PCS+C
Sbjct:   56 DKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCK----RMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSEC 222          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 107.457 bits (267), Expect = 1.024e-26
Identity = 64/183 (34.97%), Postives = 92/183 (50.27%), Query Frame = 3
Query:   75 ERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            ++ +I+++HNK R  V        P A+NM+ M W +E    A+A A++C + H             +GQN+A+  G     A  VQ W++EV  YT+             CS   C HYTQIVWA + ++GC +  CK    +MN          +LVCNY P GN+  E PY+ G PCS+C
Sbjct:   56 DKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCK----RMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSEC 222          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr1l3 (GLI pathogenesis-related 1 like 3 [Source:MGI Symbol;Acc:MGI:3620621])

HSP 1 Score: 121.324 bits (303), Expect = 1.156e-33
Identity = 68/204 (33.33%), Postives = 106/204 (51.96%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEER----------NQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYG---NYEWVGQNIAMFTGGNIAKG----VQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCK-YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +NF+  +   L+A        +D  R          +  L IHN+ R+ V       QP AA+M Q++W ++ A  A+A   +C   H+    ++YG   +Y+++G+NI +   G I       V  W+NE + Y F DN+CS+  C +YTQ+ WAK+ ++GC ++ C   ++Y     VCNY P GNF    PY  G+PCS C
Sbjct:    7 LNFLWTLALYLIATRLPKAFGNDLPRVPSILDPKFIDAFLNIHNELRRKV-------QPPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYDFIGENIYL---GEIETQPEDVVNNWYNENTDYNFVDNTCSK-ICRNYTQVFWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGNFLDFRPYRKGDPCSMC 199          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 114.775 bits (286), Expect = 3.065e-31
Identity = 66/201 (32.84%), Postives = 101/201 (50.25%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEER----------NQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYG---NYEWVGQNIAMFTGGNIAKGVQL-WFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSK-YKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            +NF+  +   L+A         D  R          +  L IHN+ R+ V       QP AA+M Q+ W ++ A  A+A   +C   H+    ++Y    +Y+++G+NI +       + V + W+NE   + F  N+CSE  CGHYTQ+VWAK+ ++GC ++ C   K +     VCNY P GNF    PY  G+ CS C
Sbjct:    7 LNFLWTLVLYLIASRLPKAFGKDLPRVPTITDPKFIDAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFDFNTCSE-MCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMC 199          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 114.005 bits (284), Expect = 6.265e-31
Identity = 61/173 (35.26%), Postives = 96/173 (55.49%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT--GGNIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCK----YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            L+++E+  ++++HN++R  V+       P A++M QM W +E A+ A+A A KC + H+    R+       G+N+   T  G ++   V  W  E   Y FS  +C  N  CGHYTQ+VW+K++ +GCG   C+      +  ++ LVCNY P GN     PY+ G PCS+C
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQC 188          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 114.39 bits (285), Expect = 1.058e-30
Identity = 61/173 (35.26%), Postives = 96/173 (55.49%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT--GGNIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCK----YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            L+++E+  ++++HN++R  V+       P A++M QM W +E A+ A+A A KC + H+    R+       G+N+   T  G ++   V  W  E   Y FS  +C  N  CGHYTQ+VW+K++ +GCG   C+      +  ++ LVCNY P GN     PY+ G PCS+C
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQC 188          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 114.39 bits (285), Expect = 1.058e-30
Identity = 61/173 (35.26%), Postives = 96/173 (55.49%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT--GGNIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCK----YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            L+++E+  ++++HN++R  V+       P A++M QM W +E A+ A+A A KC + H+    R+       G+N+   T  G ++   V  W  E   Y FS  +C  N  CGHYTQ+VW+K++ +GCG   C+      +  ++ LVCNY P GN     PY+ G PCS+C
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQC 188          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.803e-36
Identity = 75/203 (36.95%), Postives = 110/203 (54.19%), Query Frame = 3
Query:    3 MNFIIKIT-FVLVAL---------DFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG---NIAKGVQLWFNEVSGYT---FSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MN ++  T FVL+           D     L    +  IL++HNK R+ VANG+ S QP AANM+++ W++E A+ AQ +A+ C F H   + RK   Y ++G+NI  + G     I + V  W++EV   T       S      GHYTQ+VWA ++ LGCGL     +  + ++L C YGPGGN+ S+  Y+ G P S C+
Sbjct:    1 MNILLSSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENI--YKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGLVT---ASDRNSYLFCQYGPGGNYRSQPIYKQGPPASDCK 198          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 4.512e-35
Identity = 74/203 (36.45%), Postives = 109/203 (53.69%), Query Frame = 3
Query:    3 MNFIIKIT-FVLVAL---------DFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG---NIAKGVQLWFNEVSGYT---FSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MN ++  T FVL+           D     L    +  IL++HNK R+ VANG+ S QP AANM+++ W++E A+ AQ +A+ C F H   + RK   Y ++G+NI  + G     I + V  W++EV   T       S      GHYTQ+VWA ++ L CGL     +  + ++L C YGPGGN+ S+  Y+ G P S C+
Sbjct:    1 MNILLPSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENI--YKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALDCGLVT---ASDRNSYLFCQYGPGGNYRSQPIYKQGPPASDCK 198          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPU0|VA552_SCODE (Scoloptoxin SSD552 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.607e-34
Identity = 75/206 (36.41%), Postives = 109/206 (52.91%), Query Frame = 3
Query:    3 MNFIIKIT-FVLVAL---------DFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG---NIAKGVQLWFNEVSGYT------FSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MN ++  T FVL+           D     L    +  IL++HNK R+ VANG+ S QP AANM+++ W +E  + AQ +A+ C F H   + RK   Y ++G+N+  + GG    I + V  W++EV   T      FSD+       GHYTQ+VWA ++ LGCGL          ++L C YGPGGN+  +  Y+ G P S C+
Sbjct:    1 MNILLSSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPLAANMKELHWDDEIEAIAQRSAETCVFKHTAKSLRKSSKYSYLGENV--YKGGYPDPIPRSVNKWYDEVKDVTPAVVKSFSDDG---PMIGHYTQMVWANTEALGCGLVTASDG---TSYLFCQYGPGGNYPGQQIYKQGPPGSGCK 198          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q2L6Z1|VAL5_VESMC (Venom allergen 5 OS=Vespula maculifrons OX=7453 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.226e-33
Identity = 75/174 (43.10%), Postives = 105/174 (60.34%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSN-----QPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKG------VQLWFNEVSGYT----FSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYET 539
            L+ +E+  IL+ HN FR+ VA G  +      QP A NM+ +VW++E A  AQ  A++C + HDT  D     Y+ VGQN+A+ TG   AK       V++W NEV  Y     FS+N+  +   GHYTQ+VWA +KE+GCG  K   +K+  ++LVCNYGP GNF +E  Y+T
Sbjct:   59 LTKQEKQDILKEHNDFRQKVARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRD--VAKYQ-VGQNVAL-TGSTAAKYENPVNLVKMWENEVKDYNPKKKFSENNFIK--IGHYTQMVWANTKEIGCGSMKYTENKWHYHYLVCNYGPSGNFGNEELYQT 226          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P35785|VA5_VESPE (Venom allergen 5 OS=Vespula pensylvanica OX=30213 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.754e-33
Identity = 75/175 (42.86%), Postives = 104/175 (59.43%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANG-----EVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTIND-RKYGNYEWVGQNIAMFTGG------NIAKGVQLWFNEVSGYT----FSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYET 539
            L+ EE+  IL+ HN FR+ +A G         QP A NM+ +VW++E A  AQ  A++C + HDT  D  KY     VGQN+A+ TG       N  K V++W +EV  Y     FS+N+   N  GHYTQ+VWA +KE+GCG  K   +++  ++LVCNYGP GNF +E  Y+T
Sbjct:   36 LTKEEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYP----VGQNVAL-TGSTADKYDNPVKLVKMWEDEVKDYNPKKKFSENNF--NKIGHYTQMVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNFGNEELYQT 203          
BLAST of Venom allergen 5 vs. TrEMBL
Match: I1ZI85 (GLI pathogenesis related-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.225e-59
Identity = 83/128 (64.84%), Postives = 107/128 (83.59%), Query Frame = 3
Query:   27 FVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQI 410
            FVLV LDFCSGDLS++E+  +L +HN FR ++A GEVS QP A NMQQMVW+ E+AS+AQ TADKC F HDTI+DRKYG++EWVGQN+A F G +I++GV LW+N+VSG+TF +++CS  TCGHYTQ+
Sbjct:    3 FVLVVLDFCSGDLSEKEKKLLLALHNGFRSNLAQGEVSGQPPATNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDISRGVTLWYNQVSGFTFENSACSLKTCGHYTQV 130          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A564YFQ7 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.526e-46
Identity = 73/159 (45.91%), Postives = 110/159 (69.18%), Query Frame = 3
Query:   57 GDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPY 533
            G LS +++ ++L++ N++R+ VA G V NQP ++ ++ + W+ E  + AQ  AD+C F HD+ +DRK   + WVGQNIA     +IA+ V++WF E   Y +S N CS   CGHYTQ+VWA + ++GCG++KC +S +   F+VCNYGPGGNFN++ PY
Sbjct:   47 GRLS-KDKQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAY--SSSIAQNVKMWFEEHKDYNYSHNYCS-GVCGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPGGNFNNQKPY 201          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A1C9ZZV5 (SCP domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.854e-45
Identity = 84/193 (43.52%), Postives = 114/193 (59.07%), Query Frame = 3
Query:    3 MNFII--KITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNF-----LVCNYGPGGNFNSELPYETGEPCSKC 560
            M F++   I+F+ +AL FC+     E ++ +L+ HN  R+ +A G+  NQP AANM +MVW +  A +A+  A KC   HDT +DR+   + +VGQN  MF G N  + VQ W++E   YT+    CS   CGHYTQ+ W+KS  +GC    CK  K   +F      +CNYGP GNFN E PYE G  CSKC
Sbjct:    7 MQFLLCGIISFISIALIFCT---PPEYKDFLLKAHNDLRRDIALGKTPNQPAAANMIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQN--MFAGSNYKEVVQGWYDEYKDYTYEGKGCSA-VCGHYTQVAWSKSYAVGCAAVNCK-EKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKC 192          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A5K3ENG8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.285e-44
Identity = 66/153 (43.14%), Postives = 102/153 (66.67%), Query Frame = 3
Query:   75 ERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPY 533
            E++++L +HNK+R+ V++G++  QP ++ +  + WS E  + AQ  AD C F HD+ + R+   ++WVGQNIA     +IAK V++WF+E   Y +  N CS   CGHYTQ+VWA +  +GCG++KC +  +   ++VCNYGPGGN+N   PY
Sbjct:   56 EKSELLNLHNKYRRLVSDGQIREQPSSSKIHDLKWSTELEASAQRHADTCRFAHDSADARRTPQWDWVGQNIAY--SSSIAKNVEMWFDEYKEYNYQSNYCS-GVCGHYTQLVWANTTHVGCGVSKCNFRGFNAVYVVCNYGPGGNYNGRRPY 205          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A4E0RMR8 (Peptidase inhibitor 16 OS=Fasciola hepatica OX=6192 GN=D915_001060 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.485e-43
Identity = 73/179 (40.78%), Postives = 109/179 (60.89%), Query Frame = 3
Query:    6 NFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSE-NTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNF-LVCNYGPGGNFNSELPYE 536
            ++I+++   L+ L   S   +  ER + ++ HNK+R  +  G+VS QP+A++M+ + W EE A +AQ  A+KC   HDT+ +R+   + WVGQN A     N++  V+LWF E   Y+F  NSC     CGHYTQ+VWA ++++GCG  KC    +   + +VCNYGPGGNF    PY 
Sbjct:    7 SYILRVV-TLLTLYHISMSTTRVERRRFVDEHNKYRTMLMAGKVSGQPRASSMKMLTWDEELARKAQFLANKCQVGHDTLMERQTKEFHWVGQNWA--GTFNVSDTVRLWFEEHRHYSFEKNSCKPGRMCGHYTQVVWASTRKVGCGYRKCPGRAFPYGYSVVCNYGPGGNFLGAKPYR 182          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 119.013 bits (297), Expect = 8.571e-33
Identity = 67/174 (38.51%), Postives = 98/174 (56.32%), Query Frame = 3
Query:   57 GDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG-NIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCKYSKY----KMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            G    E++ +I+ +HN  R +V       +P AA+M  M WS E A  A+  A KC + H+  +         +G+N+ + TG  +I K +  WF E   Y++ +N+C+EN  CGHYTQ+VWAK+KE+GCG   C+  +         LVCNY P GN+  + PY+ GE CSKC
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKC 183          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 119.013 bits (297), Expect = 8.696e-33
Identity = 67/174 (38.51%), Postives = 98/174 (56.32%), Query Frame = 3
Query:   57 GDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG-NIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCKYSKY----KMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            G    E++ +I+ +HN  R +V       +P AA+M  M WS E A  A+  A KC + H+  +         +G+N+ + TG  +I K +  WF E   Y++ +N+C+EN  CGHYTQ+VWAK+KE+GCG   C+  +         LVCNY P GN+  + PY+ GE CSKC
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKC 183          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 119.013 bits (297), Expect = 1.661e-32
Identity = 67/174 (38.51%), Postives = 98/174 (56.32%), Query Frame = 3
Query:   57 GDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG-NIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCKYSKY----KMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            G    E++ +I+ +HN  R +V       +P AA+M  M WS E A  A+  A KC + H+  +         +G+N+ + TG  +I K +  WF E   Y++ +N+C+EN  CGHYTQ+VWAK+KE+GCG   C+  +         LVCNY P GN+  + PY+ GE CSKC
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKC 183          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 110.538 bits (275), Expect = 1.951e-29
Identity = 67/188 (35.64%), Postives = 94/188 (50.00%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            +S E+   IL+ HNK R  V        P A+NM+ MVW +  A RA+  A  C + H   N  ++     +GQN+++ TG   +I + V+ W++EV  Y+F             C    C HYTQ+VWA S ++GC +  C    Y MN          +LVCNY P GN+  E PY+ G PCS C 
Sbjct:   63 ISQEDMLAILQYHNKVRGKVF-------PPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTC----YNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCP 234          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 110.538 bits (275), Expect = 2.171e-29
Identity = 67/188 (35.64%), Postives = 94/188 (50.00%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            +S E+   IL+ HNK R  V        P A+NM+ MVW +  A RA+  A  C + H   N  ++     +GQN+++ TG   +I + V+ W++EV  Y+F             C    C HYTQ+VWA S ++GC +  C    Y MN          +LVCNY P GN+  E PY+ G PCS C 
Sbjct:   70 ISQEDMLAILQYHNKVRGKVF-------PPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTC----YNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCP 241          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 1.047e-31
Identity = 64/184 (34.78%), Postives = 96/184 (52.17%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGN--IAKGVQLWFNEVSGYTFSD---------NSCSENTCGHYTQIVWAKSKELGCGLAKC-------KYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            ++D+ER  + E HN+ R SV        P+AA+M+ M W  E A  A+A A +C + H   +       + +GQN+A++ G    +A  VQ WF+E   Y + +         ++C    C HYTQ+VWA+S+ +GC +  C           Y + +LVCNY P GN+  E PY  G PCS+C
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSD-----QLDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYAL-YLVCNYSPKGNWIGEAPYRQGTPCSRC 171          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 92.8189 bits (229), Expect = 1.787e-23
Identity = 56/164 (34.15%), Postives = 85/164 (51.83%), Query Frame = 3
Query:   87 ILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG-NIAKGVQLWFNEV--SGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFL-VCNYGPGGNFNSEL--PYETGEPCSKC 560
            I+++HN  R++V        P A NM QM+W +EA   A + A+ C+F H     RK   +   G+NI M +        ++ W+NEV   G+ +   S +    GHYTQ+VW  S +LGC +  C  +     +L VC+Y P GN N+ +  PY+ G  C+ C
Sbjct:   47 IVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWT-CGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASC 202          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.004e-17
Identity = 52/176 (29.55%), Postives = 73/176 (41.48%), Query Frame = 3
Query:   93 EIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKC-SFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNS---------CSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            E+HNK R     GEV   P ++NM+ M W ++    A     +C             G   W+      F        VQ W++E   Y +             C+   C HYTQ+VWA +  +GC +  C    Y MN          +LVCNY P GN+    PY++G  CS+C
Sbjct:    1 ELHNKLR-----GEV--HPPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHFLGQPHWLSHRPPSFH-------VQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTC----YNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSEC 158          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 67.3958 bits (163), Expect = 1.228e-14
Identity = 39/100 (39.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  279 GQNIAMFTGG-NIAKGVQLWFNE--VSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSEL--PYETGEPCSKCQ 563
            G+NI + T   +    V  W+NE  V G+ F     +    GHYTQ+VW  S +LGC +  C  + YK  + VC+Y P GN N+ L  PY  G PC  C 
Sbjct:    2 GENIFLATAPLSWQDAVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAIYKYVY-VCHYCPAGNLNTRLSRPYNEGSPCRSCP 100          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 59.3066 bits (142), Expect = 8.087e-11
Identity = 48/185 (25.95%), Postives = 71/185 (38.38%), Query Frame = 3
Query:   33 LVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTIN------DRKYG-------------NYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSEL 527
            L+  D  +     +E   +  +HNK R +V       QP AANM++M W +  A  A   A     N             K G                 V  + A     + A  +  WF+E   Y ++   C+ N TC HYTQ+VWA +  +GC    C+    ++    C Y PG +    L
Sbjct:   35 LIETDPDAAGSVSKEAFALESLHNKLRATV-------QPSAANMEKMEWDDSLAQVAHEWAAVACENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLHRAPHGATSFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYLPGNDVRLSL 212          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 70.4774 bits (171), Expect = 3.634e-15
Identity = 42/122 (34.43%), Postives = 67/122 (54.92%), Query Frame = 3
Query:  159 NMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSE 524
            +   + WS+  AS AQ  AD    N+D      +    + G+N+A+   G  A  V  W+NE+S Y FS+   S NT GH+TQ+VW  + ++GCG+  C  +    ++++C+Y P GN+  E
Sbjct:  179 DTPALSWSDTLASYAQDYAD----NYDCSGTLTHSGGPY-GENLALGYDGPAA--VDAWYNEISNYDFSNPGFSSNT-GHFTQVVWKSTTQVGCGIKTCGGA--WGDYVICSYDPAGNYEGE 290          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 71.633 bits (174), Expect = 3.990e-15
Identity = 52/156 (33.33%), Postives = 78/156 (50.00%), Query Frame = 3
Query:   81 NQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEP 548
            + +L  HNKFR       V   P       + WS+  A+ AQ  AD+  ++   +     G Y   G+N+A+  G      V  W+ E+S Y +S+   SE+T GH+TQ+VW  + E+GCG   C  +    N++VC+Y P GN+  E   E  EP
Sbjct:   27 SDVLNEHNKFRAL----HVDTAP-------LTWSDTLATYAQNYADQ--YDCSGVLTHSDGPY---GENLAL--GYTDTGAVDAWYGEISKYNYSNPGFSEST-GHFTQVVWKSTAEIGCGYKYCGTTWN--NYIVCSYNPPGNYLGEFAEEV-EP 160          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 62.003 bits (149), Expect = 4.152e-12
Identity = 41/140 (29.29%), Postives = 70/140 (50.00%), Query Frame = 3
Query:  108 FRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSEL 527
            F  S+ N   + +    +   + WS+  A+ AQ  AD    + + ++    G Y   G+N+A+  G      V  W+NE++ Y +S+   SE+  GH+TQ+VW  + E+GCGL  C       ++++C+Y   GN   E 
Sbjct:  192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG--GPY---GENLAL--GYGTTGSVDAWYNEITSYDYSNPGFSES-AGHFTQVVWKGTSEVGCGLKSC--GGEWGDYIICSYKAAGNVIGEF 321          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 74.3294 bits (181), Expect = 6.767e-16
Identity = 55/176 (31.25%), Postives = 80/176 (45.45%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEE-RNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCS----FNHDTINDRKYGNYEWVGQNI-AMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGN 512
            M  I+ +  V + +        DE+ R++IL+IHN +R               N   + WS   A  AQA A K +      H +  DR Y      G+NI  M    +I   +Q+W+NE   Y + DN     T GH+TQIVW  ++E+G G AK      ++ + V  Y P GN
Sbjct:  188 MKAIVGMGPVRMDIKTLGALPVDEDTRSRILDIHNNYRA------------MHNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYK-----GENICRMSHHFDIGDALQIWYNESESYQY-DNPGFALTTGHFTQIVWRGTREVGVGFAKSPDG--RLTYAVARYNPPGN 343          

HSP 2 Score: 65.855 bits (159), Expect = 7.195e-13
Identity = 45/145 (31.03%), Postives = 63/145 (43.45%), Query Frame = 3
Query:   90 LEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNI----AKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGN 512
            L+ HN++R               N+  + WS   A  AQ  A+K +     I+D+        G+N+ M +G N         + W+ EV  Y F        T GH+TQ+VW  S+ELG   AK K       F+V  Y PGGN
Sbjct:    9 LDAHNRYRA------------MHNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSGQ---GENVFMSSGANFDDAGEAACESWYQEVERYNFQRGGHQSGT-GHFTQVVWKSSEELGVARAKSKKGAV---FVVARYSPGGN 134          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 69.3218 bits (168), Expect = 5.915e-15
Identity = 52/155 (33.55%), Postives = 74/155 (47.74%), Query Frame = 3
Query:   84 QILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKC----SFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQ---LWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSEL 527
            Q L+ HN FR                ++ + WS + A  AQA A+K     +  H T   R+ G     G+N+AMFTG   + G +   +W+ E + Y F+      NT GH+TQ+VW  +KELG G AK      ++ F+V  Y P GN   E 
Sbjct:   44 QALDAHNYFRAFHG------------VKNLKWSHDLARGAQAWAEKLARERTLKHST---RERGE---DGENLAMFTGKYESAGEEATNMWYEESAYYNFNRPGYQSNT-GHFTQVVWKGTKELGLGRAKTPDG--RLTFVVGRYRPSGNMLREF 177          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 67.3958 bits (163), Expect = 1.810e-14
Identity = 49/151 (32.45%), Postives = 75/151 (49.67%), Query Frame = 3
Query:   78 RNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTG-----GNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNF 515
            +NQ ++ HNK+R       + + P       + WS+E A  AQ  A+K +      +  K    +  G+N+AMF+G     G++A   ++W+ E   Y+F        T GH+TQ+VW  SKELG G AK   S  +  ++V  Y P GN 
Sbjct:    4 KNQCVDNHNKYR------AMHSAPP------LKWSDELAREAQYYAEKLAQQRSMQHSSKCSRND-AGENLAMFSGRYDTAGDMA--CEMWYEESKKYSFVRGGSQMGT-GHFTQMVWKGSKELGMGRAKT--SDGRCTYVVARYQPAGNI 136          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 67.0106 bits (162), Expect = 2.327e-14
Identity = 48/157 (30.57%), Postives = 74/157 (47.13%), Query Frame = 3
Query:   90 LEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCS----FNHD--TINDRKYGNYEWVGQNIAMFTGGN-----IAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSEL 527
            LE HN++RK                ++M WS   A+ AQ  ADK S    F HD  +IN +        G+N+A FT        I      W++E S Y +++   S+ T GH+TQ+VW  ++++G G AK   +K    ++V  + P GN   + 
Sbjct:    6 LEAHNEYRKRHG------------AKEMTWSASLAADAQKWADKLSQTDAFKHDYASINSKS------QGENLAYFTPQKPNNTAIMDAFDAWYDESSKYDYANAKFSKET-GHFTQLVWKATQKMGIGTAKN--AKGDKEYVVARFSPAGNIKGQF 141          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 65.855 bits (159), Expect = 5.709e-14
Identity = 47/155 (30.32%), Postives = 72/155 (46.45%), Query Frame = 3
Query:   72 EERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIA--KGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELP 530
            E +N IL+ HN +R       +    + A+        EA S A+  A + +  H +   R+YG      ++IA  +G  +   K   +W+ EV  Y F +N     + GH+TQ+VWA S E+G G A    S    +F+V  Y P GN   + P
Sbjct:    1 EFKNDILKTHNDYRAQHGTKALKWNARLAS--------EAQSWAENLAQRNAIQHSS--SREYG------ESIAYMSGAVLTGRKATDMWYGEVDKYRF-ENPGFSTSSGHFTQVVWAGSTEMGAGKAT---SSSGAHFVVARYTPPGNVMGQFP 135          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 110.923 bits (276), Expect = 7.715e-30
Identity = 63/177 (35.59%), Postives = 93/177 (52.54%), Query Frame = 3
Query:   36 VALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGV-QLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            V  D C  D + +   +I+++HN FR++V       +P AA+M  M +SEE A  AQA  DKC  +H   + R    YE +G+N+   T   + K +   W+ EVS + F + S +    GHYTQ+VW  S ++GCG+  C  + Y      C+Y   GNF    PY+ G PC+ C 
Sbjct:   19 VLADICPEDTAVQA--EIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSNNIYLYG---CHYYRAGNFKRWPPYKVGTPCASCP 182          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 110.153 bits (274), Expect = 1.141e-29
Identity = 62/174 (35.63%), Postives = 92/174 (52.87%), Query Frame = 3
Query:   45 DFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGV-QLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            D C  D + +   +I+++HN FR++V       +P AA+M  M +SEE A  AQA  DKC  +H   + R    YE +G+N+   T   + K +   W+ EVS + F + S +    GHYTQ+VW  S ++GCG+  C  + Y      C+Y   GNF    PY+ G PC+ C 
Sbjct:    7 DICPEDTAVQA--EIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSNNIY---LYGCHYYRAGNFKRWPPYKVGTPCASCP 167          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 110.153 bits (274), Expect = 8.375e-28
Identity = 69/186 (37.10%), Postives = 92/186 (49.46%), Query Frame = 3
Query:   75 ERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNH---DTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFSDNS---------CSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            +R +IL +HNK R SV        P AANM+ MVW +E    A   A++C + H   D +          +GQN+A+  G   + A  VQ W++EV  YT+   S         CS   C HYTQ+VWA +  +GC +  C     KMN          +LVCNY P GN+  E PY  G PCS+C
Sbjct:   75 DREEILLLHNKLRSSV-------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQDLLMS--------IGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCP----KMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQC 241          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 106.686 bits (265), Expect = 3.922e-27
Identity = 61/172 (35.47%), Postives = 96/172 (55.81%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG-NIAKGVQLWFNEVSGYTFSDNSCSEN-TCGHYTQIVWAKSKELGCGLAKCKYSKY----KMNFLVCNYGPGGNFNSELPYETGEPCSKC 560
            L+D++   ++E+HN +R     G+VS  P AA M  + W       A+  A KC + H+T         E  G+N+   TG  ++++ V+ WF E   Y++ +NSC E+  CGHYTQ+VWA +  +GC +  C   +      +++LVCNY P GN++ E PY  G+ CS+C
Sbjct:   57 LTDQQEEMLVELHNHYR-----GQVS--PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRC 214          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 104.375 bits (259), Expect = 4.364e-27
Identity = 65/187 (34.76%), Postives = 92/187 (49.20%), Query Frame = 3
Query:   63 LSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGG--NIAKGVQLWFNEVSGYTFS---------DNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMN----------FLVCNYGPGGNFNSELPYETGEPCSKC 560
            +S  +   IL+ HNK R  V        P A+NM+ MVW E  A  A+  A  C + H   +  ++     +GQN+++ TG   +I + V+ W++EV  Y+F             C    C HYTQ+VWA S ++GC +  C    Y MN          +LVCNY P GN+  E PY+ G PCS C
Sbjct:   61 ISQNDMLAILDYHNKVRGKVF-------PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTC----YNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSAC 231          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.766e-140
Identity = 186/187 (99.47%), Postives = 187/187 (100.00%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MNFIIKITFVLVALDFCSGDLS+EERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ
Sbjct:    1 MNFIIKITFVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 187          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.872e-140
Identity = 186/187 (99.47%), Postives = 187/187 (100.00%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MNFIIKITFVLVALDFCSGDLS+EERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ
Sbjct:    6 MNFIIKITFVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 192          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000016022.1 (SMESG000016022.1)

HSP 1 Score: 271.937 bits (694), Expect = 1.888e-93
Identity = 124/187 (66.31%), Postives = 152/187 (81.28%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MNF+IKI FVLV LDFCSGDLS++E+N +L++HNK+R +VA G VS QP A NMQQMVW+ E+AS+AQ +ADKC F H T +DRKYG++E VGQN+AMF+G NI +GV+LW+NE  G+TFS+N+CS  TCGHYTQ+VWA S ELGCGLAKC  SK  +N L CNYGPGGN+N   PYE GE CS+CQ
Sbjct:    1 MNFLIKIAFVLVVLDFCSGDLSEKEKNLLLDVHNKYRGNVAQGVVSGQPPATNMQQMVWNAESASKAQISADKCIFAHGTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSELGCGLAKCVISKENVNLLFCNYGPGGNYNGVPPYEPGETCSECQ 187          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000000510.1 (SMESG000000510.1)

HSP 1 Score: 268.855 bits (686), Expect = 3.032e-92
Identity = 118/187 (63.10%), Postives = 151/187 (80.75%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MNF+IK+ FVLV LDFC GDL+ +++N +L IHN +R + A GEV +QP A+NMQQMVW+EE+AS+AQ TADKC F HDTI+DRKYG +EWVGQN+  F G ++ +GV LW+N+VSG+TFS+NSCS  TCGHYTQ+VWA S E+GCGLA+C      +N LVCNYGPGGN+  E PY++GEPCS+C+
Sbjct:    1 MNFLIKVAFVLVFLDFCYGDLTIKQKNLLLRIHNAYRGNTAQGEVEDQPLASNMQQMVWNEESASKAQITADKCIFAHDTIDDRKYGGFEWVGQNVVKFAGIDVGRGVFLWYNQVSGFTFSNNSCSLKTCGHYTQLVWANSTEVGCGLAECVIDGIDLNLLVCNYGPGGNYVGEKPYKSGEPCSECK 187          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017377.1 (SMESG000017377.1)

HSP 1 Score: 267.7 bits (683), Expect = 6.960e-92
Identity = 117/187 (62.57%), Postives = 150/187 (80.21%), Query Frame = 3
Query:    3 MNFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAKCKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQ 563
            MNF+I++ FVLV LDFCSGDLS++E+N +L +HN FR  +A GEVS QP A NMQ++VW+ E+AS+AQ TADKC F HDTI+DRKYG++EWVGQN+A F G +IA+GV LW  +V G+TF+DNSCS  TCGHYTQ+VWA S E+GCGL+KC      ++ LVCNYGPGGN+ SE PY+ G+ CS+C+
Sbjct:    1 MNFLIEVAFVLVVLDFCSGDLSEKEKNLLLSLHNGFRSDIAQGEVSGQPPATNMQRLVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDIARGVDLWSIQVFGFTFADNSCSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVSEKPYKLGKSCSECK 187          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI161.460e-3035.71peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.460e-3035.71peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.460e-3035.71peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
GLIPR1L15.361e-3040.00GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L15.614e-3040.00GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lon-11.003e-2232.93pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
lon-17.231e-2233.73pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
lon-17.231e-2233.73pep chromosome:WBcel235:III:5474478:5478005:1 gene... [more]
lon-12.349e-2133.78pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
vap-26.564e-2134.97Venom-Allergen-like Protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84834.696e-3642.61gene:FBgn0038126 transcript:FBtr0082782[more]
CG326794.696e-1428.42gene:FBgn0052679 transcript:FBtr0071469[more]
CG94002.902e-1228.80gene:FBgn0030562 transcript:FBtr0073920[more]
Ag5r2.152e-1125.68gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r2.152e-1125.68gene:FBgn0015010 transcript:FBtr0073937[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld22.904e-2735.52cysteine-rich secretory protein LCCL domain contai... [more]
r3hdml3.125e-2734.48R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml3.125e-2734.48R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
CABZ01068499.16.590e-2735.80cysteine-rich venom protein natrin-1-like [Source:... [more]
pi15b1.180e-2634.43peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R3HDML4.179e-2732.79R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML4.794e-2732.79R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
crispld27.967e-2734.97cysteine-rich secretory protein LCCL domain contai... [more]
crispld28.397e-2734.97cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.024e-2634.97cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr1l31.156e-3333.33GLI pathogenesis-related 1 like 3 [Source:MGI Symb... [more]
Glipr1l13.065e-3132.84GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Pi166.265e-3135.26peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.058e-3035.26peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.058e-3035.26peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPU1|VA576_SCODE4.803e-3636.95Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPV2|VA558_SCODE4.512e-3536.45Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU0|VA552_SCODE1.607e-3436.41Scoloptoxin SSD552 OS=Scolopendra dehaani OX=26097... [more]
sp|Q2L6Z1|VAL5_VESMC1.226e-3343.10Venom allergen 5 OS=Vespula maculifrons OX=7453 PE... [more]
sp|P35785|VA5_VESPE1.754e-3342.86Venom allergen 5 OS=Vespula pensylvanica OX=30213 ... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI852.225e-5964.84GLI pathogenesis related-1 (Fragment) OS=Schmidtea... [more]
A0A564YFQ72.526e-4645.91SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A1C9ZZV51.854e-4543.52SCP domain-containing protein (Fragment) OS=Dugesi... [more]
A0A5K3ENG82.285e-4443.14Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4E0RMR81.485e-4340.78Peptidase inhibitor 16 OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036030.18.571e-3338.51peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.18.696e-3338.51peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.11.661e-3238.51peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
pi15a1.951e-2935.64peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
pi15a2.171e-2935.64peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.11.047e-3134.78pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.787e-2334.15cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.11.004e-1729.55pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP21.228e-1439.00cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CLEC18A8.087e-1125.95C-type lectin domain family 18 member A [Source:HG... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY13.634e-1534.43Sterol binding protein involved in the export of a... [more]
PRY33.990e-1533.33Cell wall-associated protein involved in export of... [more]
PRY24.152e-1229.29Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493106.767e-1631.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493095.915e-1533.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486631.810e-1432.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371142.327e-1430.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488815.709e-1430.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020674.27.715e-3035.59cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020676.21.141e-2935.63cysteine-rich venom protein pseudecin-like [Source... [more]
crispld28.375e-2837.10cysteine rich secretory protein LCCL domain contai... [more]
ENSORLT00000023160.23.922e-2735.47peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
pi15a4.364e-2734.76peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055797.11.766e-14099.47SMESG000055797.1[more]
SMESG000055797.11.872e-14099.47SMESG000055797.1[more]
SMESG000016022.11.888e-9366.31SMESG000016022.1[more]
SMESG000000510.13.032e-9263.10SMESG000000510.1[more]
SMESG000017377.16.960e-9262.57SMESG000017377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018781 ID=SMED30018781|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=627bp
CCATGAATTTTATAATTAAAATTACATTTGTTTTAGTTGCACTAGATTTC
TGTTCTGGAGATCTTTCTGATGAAGAAAGAAATCAAATCTTGGAAATCCA
TAACAAATTCCGAAAATCTGTGGCCAATGGAGAAGTTTCGAACCAACCCA
AAGCAGCGAACATGCAACAAATGGTATGGAGTGAAGAAGCGGCATCCAGA
GCGCAGGCAACCGCGGATAAATGCTCATTTAATCACGACACAATAAATGA
CCGTAAATATGGAAATTATGAATGGGTTGGACAGAATATTGCCATGTTCA
CAGGAGGAAATATTGCCAAGGGCGTACAATTGTGGTTTAACGAGGTTTCC
GGATACACATTTTCAGATAATAGTTGTTCAGAAAATACTTGCGGACATTA
TACACAAATTGTATGGGCCAAATCTAAAGAGCTGGGCTGTGGACTGGCCA
AATGTAAATATTCAAAGTATAAAATGAATTTTTTGGTTTGCAATTACGGT
CCAGGGGGTAATTTCAACAGTGAGCTACCTTACGAAACAGGCGAGCCATG
TTCAAAATGTCAATCCGGTTCAAACTGTAGTAATGGACTATGTTAAAGTT
TTCAATAAATAAAATTTGCATCCAATG
back to top

protein sequence of SMED30018781-orf-1

>SMED30018781-orf-1 ID=SMED30018781-orf-1|Name=SMED30018781-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MNFIIKITFVLVALDFCSGDLSDEERNQILEIHNKFRKSVANGEVSNQPK
AANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFT
GGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKELGCGLAK
CKYSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQSGSNCSNGLC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 130..146
score: 61.18
coord: 160..173
score: 50.23
coord: 57..75
score: 34.68
coord: 107..120
score: 30.98
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 19..194
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 20..36
score: 38.6
coord: 105..120
score: 32.81
coord: 129..148
score: 65.94
IPR014044CAP domainSMARTSM00198SCP_3coord: 24..173
e-value: 9.2E-50
score: 181.3
IPR014044CAP domainPFAMPF00188CAPcoord: 30..165
e-value: 3.7E-23
score: 82.7
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 15..197
e-value: 1.0E-59
score: 203.4
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 7..180
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 19..194
NoneNo IPR availableCDDcd05380CAP_eukcoord: 26..166
e-value: 2.85565E-44
score: 142.208
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.73
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 131..141
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 160..171