SMED30018780

Overview
NameSMED30018780
Smed IDSMED30018780
Length (bp)1327
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018780 (SMED30018780) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018780 (SMED30018780) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018780 (SMED30018780) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018780 (SMED30018780) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018780

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018780SMESG000062891.1 SmedASXL_007733SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018780SMESG000062891.1 dd_Smed_v6_13359_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018780SMESG000062891.1 dd_Smed_v4_13359_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018780 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002285:17020..22682 -6466
Homology
BLAST of SMED30018780 vs. Ensembl Human
Match: ZDHHC22 (zinc finger DHHC-type containing 22 [Source:HGNC Symbol;Acc:HGNC:20106])

HSP 1 Score: 73.559 bits (179), Expect = 4.653e-14
Identity = 50/163 (30.67%), Postives = 78/163 (47.85%), Query Frame = 1
Query:  679 PRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMP 1167
            P  H C VC +  L+ DHHCF TG CIG  N R F   CL+  +  +  +VAG  YI    +I        L ++ +     ++  +      +IL LY++  IG  C GF   Q ++IL+    G T  + +    ++    +R+   EVFG+ W+L   +P
Sbjct:   92 PSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFVLFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLLILR----GQTRHQVRKGVAVRAR-PWRKNLQEVFGKRWLLGLLVP 249          
BLAST of SMED30018780 vs. Ensembl Human
Match: ZDHHC24 (zinc finger DHHC-type containing 24 [Source:HGNC Symbol;Acc:HGNC:27387])

HSP 1 Score: 69.707 bits (169), Expect = 3.403e-13
Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  634 GLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVI 822
            G  W +C  CQ   PPR+ HC  C  CIL+RDHHC + GRC+G+ N  Y  FLCL      V+
Sbjct:   90 GQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGN--YRPFLCLLLHAAGVL 150          
BLAST of SMED30018780 vs. Ensembl Human
Match: ZDHHC24 (zinc finger DHHC-type containing 24 [Source:HGNC Symbol;Acc:HGNC:27387])

HSP 1 Score: 70.4774 bits (171), Expect = 6.679e-13
Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  634 GLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVI 822
            G  W +C  CQ   PPR+ HC  C  CIL+RDHHC + GRC+G+ N  Y  FLCL      V+
Sbjct:   90 GQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGN--YRPFLCLLLHAAGVL 150          
BLAST of SMED30018780 vs. Ensembl Human
Match: ZDHHC24 (zinc finger DHHC-type containing 24 [Source:HGNC Symbol;Acc:HGNC:27387])

HSP 1 Score: 68.5514 bits (166), Expect = 2.081e-12
Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  634 GLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVI 822
            G  W +C  CQ   PPR+ HC  C  CIL+RDHHC + GRC+G+ N  Y  FLCL      V+
Sbjct:   90 GQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGN--YRPFLCLLLHAAGVL 150          
BLAST of SMED30018780 vs. Ensembl Human
Match: ZDHHC5 (zinc finger DHHC-type containing 5 [Source:HGNC Symbol;Acc:HGNC:18472])

HSP 1 Score: 64.3142 bits (155), Expect = 6.382e-12
Identity = 30/72 (41.67%), Postives = 41/72 (56.94%), Query Frame = 1
Query:  646 RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVA-GAYYIIYH 858
            ++C  C+   PPR  HC VC+ C+ + DHHC     CIG  N RYF FL L +    ++GV   G  Y++YH
Sbjct:    2 KWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYF-FLFLLSLTAHIMGVFGFGLLYVLYH 72          
BLAST of SMED30018780 vs. Ensembl Celegans
Match: dhhc-10 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q21161])

HSP 1 Score: 92.0485 bits (227), Expect = 1.944e-20
Identity = 84/319 (26.33%), Postives = 135/319 (42.32%), Query Frame = 1
Query:  235 AMWNQKYIDLSMFKYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYERYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVAL-QNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGA---MCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIG----FRQRWHEVFGRFWILNFFMP 1167
            AM NQK   L  F   +  G  L  F+ ++  Y   + +   ++D+P   YW  +V   +      +  C + Y         +SV     K+   D     E +  +  ++ +    T  + R + + P  ESG +  FC  C  +AP R+HHC +C  C+L++DHHCFITG C+G  NQRYF     +  I   I +    +Y+  ++ +     +G ++ I  + +  W   L    F       +F   GA      GF  +Q     +    G T  E+ N       +G      +R   VFG+ W LNF +P
Sbjct:    4 AMVNQKLAVLGEFLVKW-GGTMLVTFVLISTYYSCVHVIAENMYDNPTHIYWLTLVAKLIILEIAVNLACFVYY------ARYNSVTYWHRKSCVADLRVYAEDNEAQPEVEYACAQPT--VERHLSWEPANESGSK--FCFTCNKEAPQRSHHCPLCKMCVLRKDHHCFITGACVGLGNQRYFMVFLFWCAIGLTIAMPHLFFYM--NTEVAYWYPFGFVYYIGPIAVVRWI--LGYVPFSQACFSTLFSFAGASLITAGGFFGMQVYYTSQ----GYTMYEWHNLTVRATFLGDGENMGERLRLVFGKHWALNFLIP 303          
BLAST of SMED30018780 vs. Ensembl Celegans
Match: dhhc-7 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9U3P7])

HSP 1 Score: 65.0846 bits (157), Expect = 8.877e-12
Identity = 33/101 (32.67%), Postives = 46/101 (45.54%), Query Frame = 1
Query:  592 HINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSL 894
            H+NR         S   W  C  C    PPRAHHC VC +C+ K DHHC     C+G  NQ++F     +   +S   ++      ++H A G   + G L
Sbjct:   41 HLNR--------SSATEWTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPL 133          
BLAST of SMED30018780 vs. Ensembl Celegans
Match: dhhc-7 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9U3P7])

HSP 1 Score: 65.0846 bits (157), Expect = 1.779e-11
Identity = 33/101 (32.67%), Postives = 46/101 (45.54%), Query Frame = 1
Query:  592 HINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSL 894
            H+NR         S   W  C  C    PPRAHHC VC +C+ K DHHC     C+G  NQ++F     +   +S   ++      ++H A G   + G L
Sbjct:  103 HLNR--------SSATEWTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPL 195          
BLAST of SMED30018780 vs. Ensembl Celegans
Match: dhhc-1 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:O62144])

HSP 1 Score: 63.1586 bits (152), Expect = 7.340e-11
Identity = 27/59 (45.76%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  643 WRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSV 819
            ++ C  C   +P RAHHC VC+ CIL+RDHHC     C+G+ NQRYF    +  FI ++
Sbjct:  102 YKHCHSCHSMSPLRAHHCPVCDVCILRRDHHCSFGAVCVGHFNQRYFVAAVINLFIMTL 160          
BLAST of SMED30018780 vs. Ensembl Celegans
Match: dhhc-2 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9XWD7])

HSP 1 Score: 62.7734 bits (151), Expect = 2.014e-10
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  520 DYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLF 897
            D  EI+E  R++   + + I +  H+    + +      ++ ++C  C+   PPR  HC +C+ C+L  DHHC   G CIG  N  YFY    F F  S++ +   A  + + S +  +  +G + 
Sbjct:  160 DNIEIIEMDRQQ--ANGNGINDVAHLRPRFQDVVVNGEHVKMKYCTTCRLYRPPRCSHCAICDNCVLMFDHHCPWVGNCIGLRNYTYFY---RFVFCLSILVIYLFASAVTHISLLAQEMPFGDVM 280          
BLAST of SMED30018780 vs. Ensembl Fly
Match: CG17198 (gene:FBgn0039366 transcript:FBtr0084924)

HSP 1 Score: 85.5001 bits (210), Expect = 2.583e-18
Identity = 52/144 (36.11%), Postives = 77/144 (53.47%), Query Frame = 1
Query:  508 TLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKEL 939
            T W  Y+ ILE+    R+   +L T      +M + +  EE    W FC ICQ + PPR+ HC +C+ CILKRDHHC   G C+G+ NQRYF +   +A I S + +    + + +   +G   +  + +II + YM    KEL
Sbjct:   76 TTWIVYN-ILEN---LRLCVTTLNTVDSLPPQMQQPMKGEEH--LWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDN-FMLAHKHGVGFFDLVKANYIIFNAYMNPGRKEL 212          
BLAST of SMED30018780 vs. Ensembl Fly
Match: CG17198 (gene:FBgn0039366 transcript:FBtr0344619)

HSP 1 Score: 85.5001 bits (210), Expect = 2.583e-18
Identity = 52/144 (36.11%), Postives = 77/144 (53.47%), Query Frame = 1
Query:  508 TLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKEL 939
            T W  Y+ ILE+    R+   +L T      +M + +  EE    W FC ICQ + PPR+ HC +C+ CILKRDHHC   G C+G+ NQRYF +   +A I S + +    + + +   +G   +  + +II + YM    KEL
Sbjct:   76 TTWIVYN-ILEN---LRLCVTTLNTVDSLPPQMQQPMKGEEH--LWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDN-FMLAHKHGVGFFDLVKANYIIFNAYMNPGRKEL 212          
BLAST of SMED30018780 vs. Ensembl Fly
Match: CG17197 (gene:FBgn0039367 transcript:FBtr0290204)

HSP 1 Score: 78.5666 bits (192), Expect = 6.417e-16
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
Query:  616 LPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVA 834
            +PE E   +W +C +C+   PPR+ HC++C  CILKRD HC  T  C+G+ NQRYF++  LF  + + + +  
Sbjct:   95 IPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALAT 167          
BLAST of SMED30018780 vs. Ensembl Fly
Match: CG4676 (gene:FBgn0033815 transcript:FBtr0087743)

HSP 1 Score: 77.411 bits (189), Expect = 1.226e-15
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 1
Query:  619 PEEESGL-RWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFII 903
            P + + L RW  C  CQ   PPR+ HC VCN C+LKRDHHC  T  CIG+ N RYF++  ++  I S+   +  + Y ++H  +     W +LF I
Sbjct:   87 PLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIY-LWHLHLDIYWRWSTLFTI 181          
BLAST of SMED30018780 vs. Ensembl Fly
Match: CG10344 (gene:FBgn0034729 transcript:FBtr0071841)

HSP 1 Score: 76.6406 bits (187), Expect = 2.406e-15
Identity = 62/202 (30.69%), Postives = 96/202 (47.52%), Query Frame = 1
Query:  607 VEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYI-IYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            V+ +      L WR C  CQ  APPR+ HC  C  CILKRDHHC  TG CIG  N R+F     + F+ SV  +V  + Y+ + H  I S   W ++  +    + L T    + ++++   L I     A+ +G + +   V + ++  G+++D  K  ++ K + G  Q    VFG    L +  P  I   L  +G  W
Sbjct:   78 VKKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSN--WVTVLKLACPMLHLVTGSFWTNMYLVFYSLNIL----ALAYGVLLLAYHVPIVLRG-GVSADRTKESKE-KYDRGVYQNLRSVFGNRMHLAWLSP-LIRSDLPEDGYHW 270          
BLAST of SMED30018780 vs. Ensembl Zebrafish
Match: zdhhc24 (zinc finger DHHC-type containing 24 [Source:ZFIN;Acc:ZDB-GENE-040718-8])

HSP 1 Score: 76.2554 bits (186), Expect = 5.332e-15
Identity = 38/97 (39.18%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  565 DKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIY 855
            + SL  +T    R V +L  +  G  WR+C  C+   PPR  HC  CN C+L+RDHHC   G+C+G+ N RYF    LF +   +  VV  A   I+
Sbjct:   76 NASLFVKTNPSIRGV-FLGGDTLGQGWRYCYNCETHTPPRCSHCYDCNVCVLRRDHHCVFFGQCVGFHNYRYFLTCLLFMWAGLLYAVVMNAEVFIF 171          
BLAST of SMED30018780 vs. Ensembl Zebrafish
Match: zdhhc24 (zinc finger DHHC-type containing 24 [Source:ZFIN;Acc:ZDB-GENE-040718-8])

HSP 1 Score: 76.2554 bits (186), Expect = 5.332e-15
Identity = 38/97 (39.18%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  565 DKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIY 855
            + SL  +T    R V +L  +  G  WR+C  C+   PPR  HC  CN C+L+RDHHC   G+C+G+ N RYF    LF +   +  VV  A   I+
Sbjct:   76 NASLFVKTNPSIRGV-FLGGDTLGQGWRYCYNCETHTPPRCSHCYDCNVCVLRRDHHCVFFGQCVGFHNYRYFLTCLLFMWAGLLYAVVMNAEVFIF 171          
BLAST of SMED30018780 vs. Ensembl Zebrafish
Match: zdhhc24 (zinc finger DHHC-type containing 24 [Source:ZFIN;Acc:ZDB-GENE-040718-8])

HSP 1 Score: 76.2554 bits (186), Expect = 5.383e-15
Identity = 38/97 (39.18%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  565 DKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIY 855
            + SL  +T    R V +L  +  G  WR+C  C+   PPR  HC  CN C+L+RDHHC   G+C+G+ N RYF    LF +   +  VV  A   I+
Sbjct:   76 NASLFVKTNPSIRGV-FLGGDTLGQGWRYCYNCETHTPPRCSHCYDCNVCVLRRDHHCVFFGQCVGFHNYRYFLTCLLFMWAGLLYAVVMNAEVFIF 171          
BLAST of SMED30018780 vs. Ensembl Zebrafish
Match: zdhhc24 (zinc finger DHHC-type containing 24 [Source:ZFIN;Acc:ZDB-GENE-040718-8])

HSP 1 Score: 76.2554 bits (186), Expect = 5.383e-15
Identity = 38/97 (39.18%), Postives = 52/97 (53.61%), Query Frame = 1
Query:  565 DKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIY 855
            + SL  +T    R V +L  +  G  WR+C  C+   PPR  HC  CN C+L+RDHHC   G+C+G+ N RYF    LF +   +  VV  A   I+
Sbjct:   76 NASLFVKTNPSIRGV-FLGGDTLGQGWRYCYNCETHTPPRCSHCYDCNVCVLRRDHHCVFFGQCVGFHNYRYFLTCLLFMWAGLLYAVVMNAEVFIF 171          
BLAST of SMED30018780 vs. Ensembl Zebrafish
Match: zdhhc22 (zinc finger DHHC-type containing 22 [Source:ZFIN;Acc:ZDB-GENE-131127-476])

HSP 1 Score: 70.8626 bits (172), Expect = 3.071e-13
Identity = 55/189 (29.10%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  658 ICQCDAPPRA---------HHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGN 1197
            +C  D P R          H C VC K ILKRDHHCF TG CIG  N RYF    ++   + +  +V G  Y+    +I  ++    L ++     + +   +    F +++ LYI+  IG +  GF   Q +++ +    G T  E +  Q  +    +R    +VFG  W+L  F+P   +  + GN
Sbjct:   82 VCSPDCPDRIDAHYLLNGRHFCKVCKKVILKRDHHCFFTGNCIGNRNMRYFIMFSIYTSSSCLYSLVIGVAYLTIEYSISFENPLTFLTLLPLSTGYFFLGLISGLQFFLVIMLYIWLGIGLVSVGFCCQQLLLVAR----GQTWCELQKGQLSECRGTWRANLTDVFGSHWVLGLFVPVPTVETVPGN 266          
BLAST of SMED30018780 vs. Ensembl Xenopus
Match: zdhhc24 (zinc finger, DHHC-type containing 24 [Source:NCBI gene;Acc:100170592])

HSP 1 Score: 90.1225 bits (222), Expect = 1.320e-19
Identity = 54/202 (26.73%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  613 YLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGA--YYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDE-FKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            +L     G  W +C  CQ   PPR HHC  CN C+L+RDHHC + G+C+G+ N RYF+   +  ++  ++     A  +  + H   G    + S F++   +M L T ++    F+         I    CF F ++ ++++ +    G T+ E F+       ++G+++ + E  G  W L    P  +  ++ GNG ++
Sbjct:   83 FLEHGSMGQGWEYCYSCQTHVPPRCHHCFDCNVCVLRRDHHCTLLGKCVGHSNYRYFFCTLVHGWLALLLATFLNAEIFMEVLHEGFG----FHSFFLLLMPWMMLVTGQVTLSAFVFAFVADTCVIGFLFCFAFFTLHSILLCR----GSTTKEWFRGSPKEDYDLGWKRNFMEYLGERWYLVLLSP-WVESRIPGNGINF 275          
BLAST of SMED30018780 vs. Ensembl Xenopus
Match: zdhhc24 (zinc finger, DHHC-type containing 24 [Source:NCBI gene;Acc:100170592])

HSP 1 Score: 89.7373 bits (221), Expect = 1.395e-19
Identity = 54/202 (26.73%), Postives = 96/202 (47.52%), Query Frame = 1
Query:  613 YLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGA--YYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDE-FKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            +L     G  W +C  CQ   PPR HHC  CN C+L+RDHHC + G+C+G+ N RYF+   +  ++  ++     A  +  + H   G      S F++   +M L T ++    F+         I    CF F ++ ++++ +    G T+ E F+       ++G+++ + E  G  W L    P  +  ++ GNG ++
Sbjct:   72 FLEHGSMGQGWEYCYSCQTHVPPRCHHCFDCNVCVLRRDHHCTLLGKCVGHSNYRYFFCTLVHGWLALLLATFLNAEIFMEVLHEGFGFH----SFFLLLMPWMMLVTGQVTLSAFVFAFVADTCVIGFLFCFAFFTLHSILLCR----GSTTKEWFRGSPKEDYDLGWKRNFMEYLGERWYLVLLSP-WVESRIPGNGINF 264          
BLAST of SMED30018780 vs. Ensembl Xenopus
Match: ENSXETT00000020897.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:112789489:112791251:1 gene:ENSXETG00000011895.1 transcript:ENSXETT00000020897.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.183e-13
Identity = 41/117 (35.04%), Postives = 59/117 (50.43%), Query Frame = 1
Query:  511 LWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLP-EEESGLRW--RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYII 852
            L E   ++  S  +  VL K LI       RM + LP +   GLR   R+C+ICQ   P R +HC VC+ C+LK DHHC     C+G+ N ++F    L+A +  +       YY +
Sbjct:   85 LSEADKQLYLSDERPEVLQKILI-------RMAKDLPIDNTQGLRRAIRYCMICQGLKPDRCYHCPVCDICVLKLDHHCVFLNNCVGFSNYKFFLLCVLYALLMCLFTCAVSLYYSV 194          
BLAST of SMED30018780 vs. Ensembl Xenopus
Match: ENSXETT00000036696.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:104436647:104439022:-1 gene:ENSXETG00000015947.1 transcript:ENSXETT00000036696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 9.999e-13
Identity = 41/131 (31.30%), Postives = 62/131 (47.33%), Query Frame = 1
Query:  469 TPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLP---EEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYII 852
            T     +V      L E   ++  S  ++ VL + LI       RM + LP    + S   +R+C+ICQ   P R +HC VC+ C+LK DHHC     C+G+ N ++F    L+A +  +       YY I
Sbjct:   65 TVITPPAVPPAKFRLSEADKQLYLSDERQEVLQEILI-------RMAKDLPIHNTQGSRRAYRYCMICQGLKPDRCYHCPVCDICVLKLDHHCVFLNNCVGFSNYKFFLLCVLYALLMCLFTCAVSLYYSI 188          
BLAST of SMED30018780 vs. Ensembl Xenopus
Match: ENSXETT00000023680.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:104436647:104438584:-1 gene:ENSXETG00000015947.1 transcript:ENSXETT00000023680.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.008e-12
Identity = 41/131 (31.30%), Postives = 62/131 (47.33%), Query Frame = 1
Query:  469 TPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLP---EEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYII 852
            T     +V      L E   ++  S  ++ VL + LI       RM + LP    + S   +R+C+ICQ   P R +HC VC+ C+LK DHHC     C+G+ N ++F    L+A +  +       YY I
Sbjct:   69 TVITPPAVPPAKFRLSEADKQLYLSDERQEVLQEILI-------RMAKDLPIHNTQGSRRAYRYCMICQGLKPDRCYHCPVCDICVLKLDHHCVFLNNCVGFSNYKFFLLCVLYALLMCLFTCAVSLYYSI 192          
BLAST of SMED30018780 vs. Ensembl Mouse
Match: Zdhhc22 (zinc finger, DHHC-type containing 22 [Source:MGI Symbol;Acc:MGI:2685108])

HSP 1 Score: 78.1814 bits (191), Expect = 9.078e-16
Identity = 52/168 (30.95%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  664 QCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMP 1167
            QC  PP  H C VC++  L+ DHHCF TG CIG  N R F   CL+  +  +  +VAG  YI    +I        L ++ +     ++  +      +IL LY++  +G  C GF   Q ++IL+    G T  + +    ++    +R+   EVFG+ W+L   +P
Sbjct:   88 QCP-PPSTHFCRVCSRVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILR----GQTRYQVRKGMAVRAR-PWRKNLQEVFGKRWLLGLLVP 249          
BLAST of SMED30018780 vs. Ensembl Mouse
Match: Zdhhc22 (zinc finger, DHHC-type containing 22 [Source:MGI Symbol;Acc:MGI:2685108])

HSP 1 Score: 78.1814 bits (191), Expect = 9.078e-16
Identity = 52/168 (30.95%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  664 QCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMP 1167
            QC  PP  H C VC++  L+ DHHCF TG CIG  N R F   CL+  +  +  +VAG  YI    +I        L ++ +     ++  +      +IL LY++  +G  C GF   Q ++IL+    G T  + +    ++    +R+   EVFG+ W+L   +P
Sbjct:   88 QCP-PPSTHFCRVCSRVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILR----GQTRYQVRKGMAVRAR-PWRKNLQEVFGKRWLLGLLVP 249          
BLAST of SMED30018780 vs. Ensembl Mouse
Match: Zdhhc24 (zinc finger, DHHC domain containing 24 [Source:MGI Symbol;Acc:MGI:1917855])

HSP 1 Score: 64.3142 bits (155), Expect = 5.392e-11
Identity = 29/63 (46.03%), Postives = 36/63 (57.14%), Query Frame = 1
Query:  634 GLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVI 822
            G  W +C  CQ   PPR+ HC  C  CIL+RDHHC + G C+G+ N  Y  FLCL      V+
Sbjct:   90 GQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHN--YRPFLCLLLHSAGVL 150          
BLAST of SMED30018780 vs. Ensembl Mouse
Match: Zdhhc20 (zinc finger, DHHC domain containing 20 [Source:MGI Symbol;Acc:MGI:1923215])

HSP 1 Score: 63.929 bits (154), Expect = 1.129e-10
Identity = 32/96 (33.33%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  535 LESSRKKRVLDKSLITETKH--INRMVEYLP--EEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFI 810
            L +S K+R  +K    E +   + R    LP     +    R+C  CQ   P RAHHC  C++C+LK DHHC     C+G+ N ++F    L++ +
Sbjct:   86 LSNSEKER-YEKEFSQERQQDILRRAARDLPIYTTSASKAIRYCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLL 180          
BLAST of SMED30018780 vs. Ensembl Mouse
Match: Zdhhc5 (zinc finger, DHHC domain containing 5 [Source:MGI Symbol;Acc:MGI:1923573])

HSP 1 Score: 64.3142 bits (155), Expect = 1.599e-10
Identity = 31/75 (41.33%), Postives = 43/75 (57.33%), Query Frame = 1
Query:  637 LRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVA-GAYYIIYH 858
            +R ++C  C+   PPR  HC VC+ C+ + DHHC     CIG  N RYF FL L +    ++GV   G  Y++YH
Sbjct:  101 VRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYF-FLFLLSLTAHIMGVFGFGLLYVLYH 174          
BLAST of SMED30018780 vs. UniProt/SwissProt
Match: sp|A0PK84|ZDH22_MOUSE (Palmitoyltransferase ZDHHC22 OS=Mus musculus OX=10090 GN=Zdhhc22 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.350e-15
Identity = 52/168 (30.95%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  664 QCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMP 1167
            QC  PP  H C VC++  L+ DHHCF TG CIG  N R F   CL+  +  +  +VAG  YI    +I        L ++ +     ++  +      +IL LY++  +G  C GF   Q ++IL+    G T  + +    ++    +R+   EVFG+ W+L   +P
Sbjct:   88 QCP-PPSTHFCRVCSRVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILR----GQTRYQVRKGMAVRAR-PWRKNLQEVFGKRWLLGLLVP 249          
BLAST of SMED30018780 vs. UniProt/SwissProt
Match: sp|Q2TGI8|ZDH22_RAT (Palmitoyltransferase ZDHHC22 OS=Rattus norvegicus OX=10116 GN=Zdhhc22 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.213e-14
Identity = 50/164 (30.49%), Postives = 79/164 (48.17%), Query Frame = 1
Query:  676 PPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMP 1167
            PP  H C VC +  L+ DHHCF TG CIG  N R F   CL+  +  +  +VAG  YI    +I        L ++ +     ++  +      +IL LY++  +G  C GF   Q ++IL+    G T  + +    ++    +R+   EVFG+ W+L   +P
Sbjct:   91 PPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILR----GQTRYQVRKGVAVRAR-PWRKNLQEVFGKRWLLGLLVP 249          
BLAST of SMED30018780 vs. UniProt/SwissProt
Match: sp|Q8N966|ZDH22_HUMAN (Palmitoyltransferase ZDHHC22 OS=Homo sapiens OX=9606 GN=ZDHHC22 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 2.234e-13
Identity = 50/163 (30.67%), Postives = 78/163 (47.85%), Query Frame = 1
Query:  679 PRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMP 1167
            P  H C VC +  L+ DHHCF TG CIG  N R F   CL+  +  +  +VAG  YI    +I        L ++ +     ++  +      +IL LY++  IG  C GF   Q ++IL+    G T  + +    ++    +R+   EVFG+ W+L   +P
Sbjct:   92 PSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFVLFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLLILR----GQTRHQVRKGVAVRAR-PWRKNLQEVFGKRWLLGLLVP 249          
BLAST of SMED30018780 vs. UniProt/SwissProt
Match: sp|Q6BHT4|ERFB_DEBHA (Palmitoyltransferase ERF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ERF2 PE=3 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.201e-12
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  607 VEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYH 858
            + Y  E+ +G+  ++C  C     PRA HC VCN CI+  DHHC     CIGY N +YF +  LFA +  ++  V    ++ Y+
Sbjct:  168 LPYNAEDHTGVGLKYCATCHIWRSPRASHCSVCNSCIISHDHHCVFLNNCIGYRNYKYFLWFLLFAVLGCILMSVISFIHVFYY 251          
BLAST of SMED30018780 vs. UniProt/SwissProt
Match: sp|Q6UX98|ZDH24_HUMAN (Probable palmitoyltransferase ZDHHC24 OS=Homo sapiens OX=9606 GN=ZDHHC24 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.207e-12
Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  634 GLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVI 822
            G  W +C  CQ   PPR+ HC  C  CIL+RDHHC + GRC+G+ N  Y  FLCL      V+
Sbjct:   90 GQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGN--YRPFLCLLLHAAGVL 150          
BLAST of SMED30018780 vs. TrEMBL
Match: A0A1I8I7J6 (Palmitoyltransferase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.600e-42
Identity = 118/332 (35.54%), Postives = 169/332 (50.90%), Query Frame = 1
Query:  274 KYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYE------RYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEIL--------------ESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            + ++ A IFLY   S T LY      +A   DD Y       RY  +V  CY++  +TA+WL   L D+++  T  D   L+ KTL+E + E L              E S K R   K           M+ Y  E ++GL+WR C++CQ DAPPR HHC VC  C+LKRDHHC++TGRC+G+ NQR+F  +  +  I    G    A Y+  H  +   S W  LF+  ++Y WL+   LE  L +++ H Y+F  IG MC  F   Q + + +    G T+ E    Q+I      R+R+  VFG F +LNF  P+ I++K   +G  W
Sbjct:   72 RVAFAASIFLYWSASSTILYT----TLAYAVDDFYAAWSDDIRYCIKVAACYIYINATANWLLTTLTDNSYKLT-LDRPNLR-KTLFEPFPEPLKRKLEEESDDSPDEEESGKGRPAIKDDTGLLDGRKFMLPYEAESDNGLQWRRCLVCQHDAPPRTHHCPVCRACVLKRDHHCYMTGRCVGFYNQRFFIVMVFYLMIGLGWGGGGSAVYLWQHYKV--HSRW-DLFLPYAIYRWLF-GHLEGHLVLMLYHCYLFWWIGPMCAVFFMGQLISVSR----GTTTHEDAQQQEIVCRQPVRRRFESVFGHFPLLNFLFPAVIIYKQFDDGIHW 389          
BLAST of SMED30018780 vs. TrEMBL
Match: A0A267FH64 (Palmitoyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016744g1 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.310e-42
Identity = 117/333 (35.14%), Postives = 171/333 (51.35%), Query Frame = 1
Query:  274 KYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYE------RYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINR---------------MVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            + ++ A IFLY   S T LY      +A   DD Y       RY  +V  CY++  +TA+WL   L D+++  T  D   L+ KTL+E + E L+   ++   D S   E     R               M+ Y  E ++GL+WR C++CQ DAPPR HHC VC  C+LKRDHHC++TGRC+G+ NQR+F  +  +  I    G    A Y+  H  +   S W  LF+  ++Y WL+   LE  L +++ H Y+F  IG MC  F   Q + + +    G T+ E    Q+I      R+R+  VFG F +LNF  P+ I++K   +G  W
Sbjct:   78 RVAFAASIFLYWSASSTILYT----TLAYAVDDFYAAWSDDIRYCIKVAACYIYINATANWLLTTLTDNSYKVT-LDRPNLR-KTLFEPFPEPLKRKLEEES-DDSPDEEENGKGRPAIKDDTGLLDGRKFMLPYEAESDNGLQWRRCLVCQHDAPPRTHHCPVCRACVLKRDHHCYMTGRCVGFYNQRFFIVMVFYLMIGLGWGGGGSAVYLWQHYKV--HSRW-DLFLPYAIYRWLF-GHLEGHLVLMLYHCYLFWWIGPMCAVFFMGQLISVSR----GTTTHEDAQQQEIVCRQPVRRRFESVFGHFPLLNFLFPAVIIYKQFDDGIHW 395          
BLAST of SMED30018780 vs. TrEMBL
Match: R7UKE2 (Palmitoyltransferase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220147 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.732e-40
Identity = 101/372 (27.15%), Postives = 178/372 (47.85%), Query Frame = 1
Query:  118 DKVTYRQNADKSCSVIALEDTFELTKEEFEKLPIHNKFSAMWNQKYIDLSMFKYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYER--YWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGS---QSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDWPGL 1218
            +K   + +  ++ ++I +      T ++  K+ +  K    + ++Y D  + + + +A    + F+  +++Y+   HVI  +F+   +   Y+ +    +++  + A+WLC+  Y S +   + D+ + +  T WE              L  S  +E+                L+WR C +C   APPR+HHC++CN+C+LKRDHHC++TG C+G+ NQRYF  L  +  + S+ G+     Y IY  A  +   Q  W +  +  +VY WL +  LE    +I+ HL      GA    F   Q  +I+     G T  E +  + ++        +  VFG FW +NFF P+ I+F+ EGNG  W  +
Sbjct:    2 EKHQTKDSTARNSTIIQMHGD---TNKQRSKMTLFEKLREAYTERYSDPEVSRLANIAAAAYFHFILHSQVYVTVFHVIPHLFEQSGDMTIYYLKAFVWFVYIETQANWLCLKFYQSVFKAHDDDNPSYEQMTPWER-------------LATSTTSES----------------LKWRTCSVCGLRAPPRSHHCIICNRCVLKRDHHCYMTGVCVGFYNQRYFIVLNFYIAVGSLCGL-----YFIYQFAKDTFLPQLGWENYVLPYTVYRWLASDGLELHQMLIVFHLCTLWWTGATAVAFFIWQICLIV----LGKTDHEVRQGKRVRYTGRVSDSFQSVFGHFWPVNFFFPAVIIFRQEGNGCFWENV 332          
BLAST of SMED30018780 vs. TrEMBL
Match: A0A1I8HZU4 (Palmitoyltransferase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.020e-40
Identity = 116/333 (34.83%), Postives = 169/333 (50.75%), Query Frame = 1
Query:  274 KYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYE------RYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINR---------------MVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            + ++ A IFLY   S T LY      +A   DD Y       RY  +V  CY++  +TA+WL   L D+++  T  D   L+ KTL+E + E L+   ++   D S   E     R               M+ Y  E ++GL+WR C++CQ DAPPR HHC VC  C+LKRDHHC++TGRC+G+ NQR+F  +  +  I    G    A Y+  H  +   S W  LF+  ++Y WL+   LE  L +++ H Y+F  IG MC   +S+           G T+ E    Q+I      R+R+  VFG F +LNF  P+ I++K   +G  W
Sbjct:   78 RVAFAASIFLYWSASSTILYT----TLAYAVDDFYAAWSDDIRYCIKVAACYIYINATANWLLTTLTDNSYKVT-LDRPNLR-KTLFEPFPEPLKRKLEEES-DDSPDEEENGKGRPAIKDDTGLLDGRKFMLPYEAESDNGLQWRRCLVCQHDAPPRTHHCPVCRACVLKRDHHCYMTGRCVGFYNQRFFIVMVFYLMIGLGWGGGGSAVYLWQHYKV--HSRW-DLFLPYAIYRWLF-GHLEGHLVLMLYHCYLFWWIGPMC-ALISVSR---------GTTTHEDAQQQEIVCRQPVRRRFESVFGHFPLLNFLFPAVIIYKQFDDGIHW 389          
BLAST of SMED30018780 vs. TrEMBL
Match: A0A1S3H9I3 (Palmitoyltransferase OS=Lingula unguis OX=7574 GN=LOC106152660 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.841e-39
Identity = 106/316 (33.54%), Postives = 160/316 (50.63%), Query Frame = 1
Query:  289 AGIFLYIFLSVTELYILRNHVIAAVFDDPYERYWY--RVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKH----INRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDWPGL 1218
            +GIF+Y     T  Y+    VI  ++   Y  Y Y  RV   + F    A+WLCV  Y++ +  T +D   L+ KTLW++   I E++    VLD    +  +     I    E++ +EE  L W+ C+ICQ DAPPR+HHC  C KCILK DHHC+  GRCIG+ NQRYF  L  +  + S+   +   YY+  HS +     W       + Y W   K +     ++I + YI    G +  GF   + +++L     G T+ E + +  +      R++   VFG FW  NF +P Q+L++  G+GT+W  L
Sbjct:   49 SGIFMYTLF--TGYYVGMIDVIPEIYQKDYPHYVYPLRVALTFCFIQVVANWLCVRCYETGYFVT-RDRPNLR-KTLWDEV-AIAETA----VLDNEHGSHRREGVSGIRTEQEFVSKEEMNLAWKRCLICQHDAPPRSHHCRDCRKCILKHDHHCYFVGRCIGFYNQRYFIVLSFYTGVGSLASFLHVLYYL--HSVLPDDMHWYDYAFPYTFYTWFEGK-ITFHNLLLISYCYILWWSGILGLGFFLWEMILVLT----GKTTFEVRQNLHVVCLSSMREKLRSVFGEFWFFNFILPLQLLYRQSGDGTEWNDL 348          
BLAST of SMED30018780 vs. Ensembl Cavefish
Match: zdhhc16a (zinc finger DHHC-type containing 16 [Source:NCBI gene;Acc:103039258])

HSP 1 Score: 73.9442 bits (180), Expect = 4.788e-14
Identity = 40/119 (33.61%), Postives = 60/119 (50.42%), Query Frame = 1
Query:  613 YLPEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAG------AYYII--YHSAIGSQSMWGSLFIIKSVYMWLWTKELE 942
            Y P+ ++ + +   C  C    PPR HHC +CN CILK DHHC     C+G+ N RYF+  CL+  +  +   V+G      AY  I  YH++    +    +F    +YMW+ T  + 
Sbjct:  138 YPPKMKNDIPFVSVCKKCVIPKPPRTHHCGICNTCILKMDHHCPWLNNCVGHFNHRYFFSFCLYMTLGCLYCSVSGRTLFIDAYNAIDSYHTSSTPYTFKDRMFHKSVIYMWVLTSTVA 256          
BLAST of SMED30018780 vs. Ensembl Cavefish
Match: zdhhc24 (probable palmitoyltransferase ZDHHC24 [Source:NCBI gene;Acc:103023843])

HSP 1 Score: 70.8626 bits (172), Expect = 2.465e-13
Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  613 YLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYII 852
            +L  E  G  WR+C  C+   PPR  HC  CN C+L+RDHHC   G+C+G+ N R+F     F +   +  VV  A   I
Sbjct:   91 FLGGEIVGQGWRYCYTCETHTPPRCSHCYDCNVCVLRRDHHCVFFGQCVGFRNYRFFLSCLFFMWSGLLYAVVMNAEVFI 170          
BLAST of SMED30018780 vs. Ensembl Cavefish
Match: zdhhc16a (zinc finger DHHC-type containing 16 [Source:NCBI gene;Acc:103039258])

HSP 1 Score: 68.5514 bits (166), Expect = 3.378e-12
Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  613 YLPEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAG 837
            Y P+ ++ + +   C  C    PPR HHC +CN CILK DHHC     C+G+ N RYF+  CL+  +  +   V+G
Sbjct:  138 YPPKMKNDIPFVSVCKKCVIPKPPRTHHCGICNTCILKMDHHCPWLNNCVGHFNHRYFFSFCLYMTLGCLYCSVSG 213          
BLAST of SMED30018780 vs. Ensembl Cavefish
Match: zdhhc16b (probable palmitoyltransferase ZDHHC16 [Source:NCBI gene;Acc:103038698])

HSP 1 Score: 65.855 bits (159), Expect = 2.182e-11
Identity = 28/64 (43.75%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  613 YLPEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLF 801
            Y P+E+S +     C  C    P R HHC +CN C+LK DHHC     C+G+ N RYF+  CL+
Sbjct:  142 YPPQEKSDIPTVTICKKCIVPKPARTHHCSICNTCVLKMDHHCPWLNNCVGHFNHRYFFSFCLY 205          
BLAST of SMED30018780 vs. Ensembl Cavefish
Match: zdhhc16b (probable palmitoyltransferase ZDHHC16 [Source:NCBI gene;Acc:103038698])

HSP 1 Score: 65.855 bits (159), Expect = 2.182e-11
Identity = 28/64 (43.75%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  613 YLPEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLF 801
            Y P+E+S +     C  C    P R HHC +CN C+LK DHHC     C+G+ N RYF+  CL+
Sbjct:  142 YPPQEKSDIPTVTICKKCIVPKPARTHHCSICNTCVLKMDHHCPWLNNCVGHFNHRYFFSFCLY 205          
BLAST of SMED30018780 vs. Ensembl Sea Lamprey
Match: zdhhc24 (zinc finger DHHC-type containing 24 [Source:ZFIN;Acc:ZDB-GENE-040718-8])

HSP 1 Score: 70.4774 bits (171), Expect = 7.206e-14
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 1
Query:  613 YLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYF 783
            +LP  + G  WR+C  C+   PPR+HHC  C+ C+L+RDHHC   GRC+G+ N   F
Sbjct:   84 FLPSHQ-GQGWRYCYHCESYVPPRSHHCFECHVCVLRRDHHCVFFGRCVGFANLPAF 139          
BLAST of SMED30018780 vs. Ensembl Sea Lamprey
Match: zdhhc16a (zinc finger DHHC-type containing 16a [Source:NCBI gene;Acc:394017])

HSP 1 Score: 68.5514 bits (166), Expect = 4.391e-13
Identity = 48/201 (23.88%), Postives = 82/201 (40.80%), Query Frame = 1
Query:  652 CVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFIN-SVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGL-----TSDEFKNHQDIKV-----NIGFRQRWHEVFG----RFWILNFFMPSQILFKLEGNGTDW 1209
            C  C    PPR HHC +CN+CILK DHHC     C+G  N RYF+  CL+  +  +   +     Y   H+          L ++         ++ E  +   I+ +++     ++  G +++    ++   E  +       +  + H+  KV     + G    W + FG    R W+    +PS      +GNG  W
Sbjct:  125 CKRCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGNYNHRYFFSFCLYMSMGCAFTSITLSRTYFRTHAPSQVAPSHSPLKLLSPASTTAEPEKREDHVHNSIVFVWVLTSTVSVVLGALTLWHAALISRGETSVERHINRKERARLHKKGKVFKNPYHFGSLSNWKQFFGVKHRRHWLTRVLLPSG--HAPQGNGLVW 323          
BLAST of SMED30018780 vs. Ensembl Sea Lamprey
Match: zdhhc6 (zinc finger DHHC-type containing 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3189])

HSP 1 Score: 63.5438 bits (153), Expect = 2.908e-11
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  619 PEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFIN 813
            PE+   +++ ++C ICQ   PPR+HHC  CN+C++K DHHC     C G+ N  YF +  L A + 
Sbjct:   89 PEKPEDVQYLQYCNICQGYKPPRSHHCRKCNRCVMKMDHHCPWINNCCGHYNHAYFTWFLLLAPLG 154          
BLAST of SMED30018780 vs. Ensembl Sea Lamprey
Match: zdhhc3a (zinc finger DHHC-type containing 3a [Source:ZFIN;Acc:ZDB-GENE-040718-484])

HSP 1 Score: 58.9214 bits (141), Expect = 1.813e-10
Identity = 28/71 (39.44%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  652 CVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSA 864
            C  C    P RAHHC VC +CI K DHHC     C+G  NQ+YF    ++  + SV  +V    +++Y S 
Sbjct:   27 CPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGESNQKYFVLFTMYIALISVHALVMVLIHLVYCSG 97          
BLAST of SMED30018780 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004672.1 (pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 gene:ENSPMAG00000004227.1 transcript:ENSPMAT00000004672.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 9.162e-10
Identity = 31/68 (45.59%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  580 TETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYF 783
            TE +    +VE L E  S     FC  C    P R+ HC VCN+CI K DHHC   G C+G  N RYF
Sbjct:  419 TEEQKKKTIVE-LAEAGSLDLSIFCSTCLIRKPVRSKHCSVCNRCIAKFDHHCPWVGNCVGAGNHRYF 485          
BLAST of SMED30018780 vs. Ensembl Yeast
Match: ERF2 (Subunit of a palmitoyltransferase; this complex adds a palmitoyl lipid moiety to heterolipidated substrates such as Ras1p and Ras2p through a thioester linkage; mutants partially mislocalize Ras2p to the vacuole; palmitoyltransferase is composed of Erf2p and Shr5p [Source:SGD;Acc:S000004236])

HSP 1 Score: 61.2326 bits (147), Expect = 8.850e-11
Identity = 28/73 (38.36%), Postives = 39/73 (53.42%), Query Frame = 1
Query:  646 RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSA 864
            ++C  C+   PPR+ HC  CN C++  DHHC     CIG  N R+F    L A ++SVI +   A +I   S 
Sbjct:  173 KYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLTNCAIHIARESG 245          
BLAST of SMED30018780 vs. Ensembl Yeast
Match: PFA4 (Palmitoyltransferase with autoacylation activity; required for palmitoylation of amino acid permeases containing a C-terminal Phe-Trp-Cys site; required for modification of Chs3p; member of the DHHC family of putative palmitoyltransferases [Source:SGD;Acc:S000005363])

HSP 1 Score: 58.5362 bits (140), Expect = 6.940e-10
Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 1
Query:  643 WR-FCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYF 783
            WR FC  CQ   P R+HHC  CN+C+L  DHHC  T  C+G+ N  +F
Sbjct:   76 WRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHF 123          
BLAST of SMED30018780 vs. Ensembl Yeast
Match: PFA3 (Palmitoyltransferase for Vac8p; required for vacuolar membrane fusion; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; autoacylates; required for vacuolar integrity under stress conditions [Source:SGD;Acc:S000005270])

HSP 1 Score: 56.9954 bits (136), Expect = 1.748e-9
Identity = 26/61 (42.62%), Postives = 35/61 (57.38%), Query Frame = 1
Query:  640 RWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYF----YFLCLFAFI 810
            R+R C +C    P R HHC  C+ CILK DHHC     C G+ NQ++F     +  L+AF+
Sbjct:  102 RFRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFL 162          
BLAST of SMED30018780 vs. Ensembl Yeast
Match: SWF1 (Palmitoyltransferase that acts on transmembrane proteins; including the SNAREs Snc1p, Syn8p, Tlg1p and likely all SNAREs; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; may have a role in vacuole fusion [Source:SGD;Acc:S000002533])

HSP 1 Score: 51.2174 bits (121), Expect = 1.193e-7
Identity = 26/76 (34.21%), Postives = 39/76 (51.32%), Query Frame = 1
Query:  652 CVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQS 879
            C  C+   P R+ HC +CN+C+L  DHHC     CIG  N   FY      F+ S I  +  A+  +++ ++ S S
Sbjct:  136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYL-----FLISNIFSMCYAFLRLWYISLNSTS 206          
BLAST of SMED30018780 vs. Ensembl Nematostella
Match: EDO31864 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SWQ7])

HSP 1 Score: 88.1965 bits (217), Expect = 1.220e-19
Identity = 56/191 (29.32%), Postives = 96/191 (50.26%), Query Frame = 1
Query:  643 WRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVI--LKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDW 1209
            W +C  CQ ++PPRA+HC VC+ C+L+RDHHC   G+C+G+ N RY+ FL  + ++ ++   +    Y+   S + + ++W    +   +  W+         +  I   ++  I     F FV    ++   L +   G TS E K  + I  + G+ + + EV G  W L++  P +I   L  NGTD+
Sbjct:   99 WAYCPFCQLNSPPRAYHCHVCDICVLRRDHHCIFAGKCVGHSNYRYYLFLAFYLWLGALYANLFHWEYVT--SVMDNFTLWTMFTMFMPMLSWM-------LGYTTIYQTFVTFITAISLFAFVMFSGLLFFQLNIIARGQTSYERKRKRRI-YDKGWLRNFIEVLGENWFLSWIWP-KITSPLPHNGTDY 278          
BLAST of SMED30018780 vs. Ensembl Nematostella
Match: EDO46304 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQK1])

HSP 1 Score: 66.6254 bits (161), Expect = 3.695e-12
Identity = 26/62 (41.94%), Postives = 35/62 (56.45%), Query Frame = 1
Query:  652 CVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAG 837
            C  C    PPR HHC +C +CILK DHHC     C+G+ N RYF   C++  + S+   V+ 
Sbjct:  130 CRKCSQAKPPRTHHCSICKRCILKMDHHCPWINNCVGHFNHRYFILFCIYMTLGSLYVAVSS 191          
BLAST of SMED30018780 vs. Ensembl Nematostella
Match: EDO40825 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7S6A3])

HSP 1 Score: 66.2402 bits (160), Expect = 3.844e-12
Identity = 45/166 (27.11%), Postives = 79/166 (47.59%), Query Frame = 1
Query:  409 YLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINS--VIGVVAGAYYIIYHSAIGSQSMWGSLFI 900
            + F +  ++W  +L  D    P+ Q +++  +K L E+ + + E   +   + K+L T T+ ++  V            R+C IC    P R HHC +C KCILK DHHC     C+GY N ++F     +A + +  V G V   +   + +++  +     LF+
Sbjct:   59 FFFMLIISYWRTILA-DQGIVPS-QFALSKTDKDLVENGENVREVLTR---VSKNLPTATRTLSGGV------------RYCDICCHIKPDRCHHCSMCRKCILKMDHHCPWVNNCVGYSNYKFFLLFLFYAILYTFYVTGTVTKYFIAFWSNSLEGEGKLHILFL 207          
BLAST of SMED30018780 vs. Ensembl Nematostella
Match: EDO38376 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SD39])

HSP 1 Score: 62.3882 bits (150), Expect = 5.742e-11
Identity = 31/77 (40.26%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  622 EEESGLRWRFCVICQCDAPPRAHHC-----VVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAG 837
            + +S   W  C  C+   PPRAHHC     ++C +CI K DHHC     C+G  NQ+YF    LF F   V+ V A 
Sbjct:   91 KPQSNTEWTACTRCEAYRPPRAHHCRLLFMLICGRCIKKMDHHCPWINNCVGENNQKYFV---LFLFYTGVLSVYAA 164          
BLAST of SMED30018780 vs. Ensembl Nematostella
Match: EDO44298 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RWD7])

HSP 1 Score: 60.8474 bits (146), Expect = 1.884e-10
Identity = 38/124 (30.65%), Postives = 56/124 (45.16%), Query Frame = 1
Query:  517 EDYDEILESSRKKRV-LDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMW 885
            ++++ IL S  K  V ++     E+ +     + L     G R R C  C    P R  HC  C +C+ K DHHC   G C+G  N R+F+      F+ S   +VA A  I +H  +   S W
Sbjct:   74 QEHNNILISYEKAEVDIESQSENESDNAEETCKILATPPFGSRLRRCGYCAIMQPLRTKHCEDCGRCVRKYDHHCPWLGTCVGERNHRFFW-----CFLVSQNALVAWAIEIAWHGFVYKDSWW 192          
BLAST of SMED30018780 vs. Ensembl Medaka
Match: zdhhc22 (zinc finger DHHC-type containing 22 [Source:NCBI gene;Acc:101164114])

HSP 1 Score: 70.8626 bits (172), Expect = 2.249e-13
Identity = 48/162 (29.63%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  688 HHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQ 1173
            H C +C K ILKRDHHCF TG CIG  N RYF   C++     +  +V G  ++    +I  ++    L ++       +   +      ++L LY++  IG +C GF S Q +++ +    G T  + +  + ++    +R     VFG  WIL   +P Q
Sbjct:  105 HFCKLCKKIILKRDHHCFFTGNCIGNKNMRYFLMFCIYTSCTCLYSLVLGVAFLTVEYSISFENPLTFLTLLPLSVCSFFMGTISGLQLFLVLMLYVWLGIGLVCAGFCSQQMLLVAR----GQTWCQMQRGELVRNCSNWRANLKHVFGTRWILGLILPVQ 262          
BLAST of SMED30018780 vs. Ensembl Medaka
Match: zdhhc24 (zinc finger DHHC-type containing 24 [Source:NCBI gene;Acc:101174200])

HSP 1 Score: 70.4774 bits (171), Expect = 3.422e-13
Identity = 31/76 (40.79%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  613 YLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGA 840
            +L  +  G  WR+C  C+   PPR  HC  C  C+L+RDHHC   G+C+G+ N RYF    LF +   +  VV  A
Sbjct:   91 FLGGDGLGQGWRYCYTCETHTPPRCSHCFDCKVCVLRRDHHCVFFGQCVGFRNYRYFLSCLLFMWSGLLYAVVMNA 166          
BLAST of SMED30018780 vs. Ensembl Medaka
Match: zdhhc16a (palmitoyltransferase ZDHHC16A-like [Source:NCBI gene;Acc:101164249])

HSP 1 Score: 67.3958 bits (163), Expect = 7.191e-12
Identity = 32/76 (42.11%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  613 YLPEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAG 837
            Y P E++   +   C  C    P R HHC +CN+CILK DHHC     CIG+ N RYF+  CLF  +  V   ++G
Sbjct:  140 YPPTEKNDRPFVAVCKKCIIPKPARTHHCGICNRCILKMDHHCPWLNNCIGHFNHRYFFSFCLFMTLGCVYCSISG 215          
BLAST of SMED30018780 vs. Ensembl Medaka
Match: zdhhc16a (palmitoyltransferase ZDHHC16A-like [Source:NCBI gene;Acc:101164249])

HSP 1 Score: 67.3958 bits (163), Expect = 8.520e-12
Identity = 32/76 (42.11%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  613 YLPEEESGLRW-RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAG 837
            Y P E++   +   C  C    P R HHC +CN+CILK DHHC     CIG+ N RYF+  CLF  +  V   ++G
Sbjct:  140 YPPTEKNDRPFVAVCKKCIIPKPARTHHCGICNRCILKMDHHCPWLNNCIGHFNHRYFFSFCLFMTLGCVYCSISG 215          
BLAST of SMED30018780 vs. Ensembl Medaka
Match: zdhhc23a (palmitoyltransferase ZDHHC23-like [Source:NCBI gene;Acc:101160931])

HSP 1 Score: 67.3958 bits (163), Expect = 8.863e-12
Identity = 43/133 (32.33%), Postives = 62/133 (46.62%), Query Frame = 1
Query:  541 SSRKKRV------LDKSLITETKHINRMVEYLPEEES-GLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYF-LCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVY 915
            S+RKK +      L+K L           E L +EE+   +W  C +C+   PPRA HC  C  C+L+ DHHC     C+G  N R F   LC+F  + +V G+      ++  S    Q +  +LF    VY
Sbjct:  185 SNRKKNIKEDFTYLEKCLQPAASCSMTSSELLKKEEAPSTKWSLCPVCKIIRPPRAGHCRSCGACVLRLDHHCIWINSCVGQANHRSFLLTLCVFV-LTAVYGI-----SLVLRSLCPRQYLMTALFYCPGVY 311          
BLAST of SMED30018780 vs. Planmine SMEST
Match: SMESG000062891.1 (SMESG000062891.1)

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 377/382 (98.69%), Postives = 377/382 (98.69%), Query Frame = 1
Query:  112 MNDKVTYRQNADKSCSVIALEDTFELTKEEFEKLPIHNKFSAMWNQKYIDLSMFKYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYERYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDWPGLISLKGLTSLKQYK 1257
            MNDKVTYRQNADKSCSVIALEDTFELTKEEFEKLPIHNKFSAMWNQKYIDLSMFKYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYERYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESFLFIIILHLYIFPIIGAMCFGFVSIQTVVILK    GLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDWPGLISLKGL SLKQYK
Sbjct:    1 MNDKVTYRQNADKSCSVIALEDTFELTKEEFEKLPIHNKFSAMWNQKYIDLSMFKYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYERYWYRVVCCYLFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRVLDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESFLFIIILHLYIFPIIGAMCFGFVSIQTVVILK----GLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDWPGLISLKGLMSLKQYK 378          
BLAST of SMED30018780 vs. Planmine SMEST
Match: SMESG000027921.1 (SMESG000027921.1)

HSP 1 Score: 78.1814 bits (191), Expect = 9.031e-16
Identity = 53/202 (26.24%), Postives = 96/202 (47.52%), Query Frame = 1
Query:  643 WRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFIN------SVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESXXXXXXXXXXXXXXXGAMCFGFVSIQTVVILKVKEFGLTSDEFKNHQDIKV------NIGFRQRWHEVFGRFWILNFFMPSQILFKLEGNGTDWP 1212
            W++C+ CQ   PPR++HC VC  CIL  +HHC++TGRC+GY  +R F  LC ++ +       ++ G +   Y+   + ++ + +    + II  ++    T             L++F +  A    F+++    I  +  F LT     +H+   +      N+ F      VFG+++ ++F  P +    + GNG  WP
Sbjct:  126 WKYCMSCQVTVPPRSYHCEVCQVCILGGNHHCYLTGRCVGYTTKRRFIVLCFYSIVGCLYTTWNIAGFLTKHYFPFDYLSVNTLNYVLPIPIITCLFSQRIT------------ILFLFLLTNAYISCFLTLFATFIF-ILHFILTFTGQTSHEGFNLIRRYQRNVNFNVE--SVFGKYFFIHFLWPFET--AIPGNGYHWP 310          
BLAST of SMED30018780 vs. Planmine SMEST
Match: SMESG000077927.1 (SMESG000077927.1)

HSP 1 Score: 75.485 bits (184), Expect = 2.528e-15
Identity = 29/67 (43.28%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  646 RFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYY 846
            R+C IC+C  PPR++HC VC  CIL+RDHHC  +G C+G  N RY+     + F+ ++ G     +Y
Sbjct:   57 RYCSICECYCPPRSYHCYVCKTCILRRDHHCVFSGSCVGLYNHRYYIITIFYCFVAALYGSYFNVFY 123          
BLAST of SMED30018780 vs. Planmine SMEST
Match: SMESG000004244.1 (SMESG000004244.1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.014e-12
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  625 EESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFL-------CLFAFINSV 819
             + G   RFC ICQ   P RAHHC  C +C+L+ DHHC   G C+G+ N ++F  L       CLF    S+
Sbjct:  113 RDIGSNIRFCSICQLIKPDRAHHCSSCGRCLLRMDHHCPWVGNCVGFHNHKFFILLLGYGSLFCLFVAATSI 184          
BLAST of SMED30018780 vs. Planmine SMEST
Match: SMESG000004244.1 (SMESG000004244.1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.129e-12
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  625 EESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFL-------CLFAFINSV 819
             + G   RFC ICQ   P RAHHC  C +C+L+ DHHC   G C+G+ N ++F  L       CLF    S+
Sbjct:  113 RDIGSNIRFCSICQLIKPDRAHHCSSCGRCLLRMDHHCPWVGNCVGFHNHKFFILLLGYGSLFCLFVAATSI 184          
The following BLAST results are available for this feature:
BLAST of SMED30018780 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZDHHC224.653e-1430.67zinc finger DHHC-type containing 22 [Source:HGNC S... [more]
ZDHHC243.403e-1347.62zinc finger DHHC-type containing 24 [Source:HGNC S... [more]
ZDHHC246.679e-1347.62zinc finger DHHC-type containing 24 [Source:HGNC S... [more]
ZDHHC242.081e-1247.62zinc finger DHHC-type containing 24 [Source:HGNC S... [more]
ZDHHC56.382e-1241.67zinc finger DHHC-type containing 5 [Source:HGNC Sy... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhhc-101.944e-2026.33Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-78.877e-1232.67Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-71.779e-1132.67Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-17.340e-1145.76Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-22.014e-1027.78Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG171982.583e-1836.11gene:FBgn0039366 transcript:FBtr0084924[more]
CG171982.583e-1836.11gene:FBgn0039366 transcript:FBtr0344619[more]
CG171976.417e-1641.10gene:FBgn0039367 transcript:FBtr0290204[more]
CG46761.226e-1540.63gene:FBgn0033815 transcript:FBtr0087743[more]
CG103442.406e-1530.69gene:FBgn0034729 transcript:FBtr0071841[more]
back to top
BLAST of SMED30018780 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc245.332e-1539.18zinc finger DHHC-type containing 24 [Source:ZFIN;A... [more]
zdhhc245.332e-1539.18zinc finger DHHC-type containing 24 [Source:ZFIN;A... [more]
zdhhc245.383e-1539.18zinc finger DHHC-type containing 24 [Source:ZFIN;A... [more]
zdhhc245.383e-1539.18zinc finger DHHC-type containing 24 [Source:ZFIN;A... [more]
zdhhc223.071e-1329.10zinc finger DHHC-type containing 22 [Source:ZFIN;A... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc241.320e-1926.73zinc finger, DHHC-type containing 24 [Source:NCBI ... [more]
zdhhc241.395e-1926.73zinc finger, DHHC-type containing 24 [Source:NCBI ... [more]
ENSXETT00000020897.11.183e-1335.04pep primary_assembly:Xenopus_tropicalis_v9.1:6:112... [more]
ENSXETT00000036696.19.999e-1331.30pep primary_assembly:Xenopus_tropicalis_v9.1:5:104... [more]
ENSXETT00000023680.11.008e-1231.30pep primary_assembly:Xenopus_tropicalis_v9.1:5:104... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zdhhc229.078e-1630.95zinc finger, DHHC-type containing 22 [Source:MGI S... [more]
Zdhhc229.078e-1630.95zinc finger, DHHC-type containing 22 [Source:MGI S... [more]
Zdhhc245.392e-1146.03zinc finger, DHHC domain containing 24 [Source:MGI... [more]
Zdhhc201.129e-1033.33zinc finger, DHHC domain containing 20 [Source:MGI... [more]
Zdhhc51.599e-1041.33zinc finger, DHHC domain containing 5 [Source:MGI ... [more]
back to top
BLAST of SMED30018780 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0PK84|ZDH22_MOUSE6.350e-1530.95Palmitoyltransferase ZDHHC22 OS=Mus musculus OX=10... [more]
sp|Q2TGI8|ZDH22_RAT4.213e-1430.49Palmitoyltransferase ZDHHC22 OS=Rattus norvegicus ... [more]
sp|Q8N966|ZDH22_HUMAN2.234e-1330.67Palmitoyltransferase ZDHHC22 OS=Homo sapiens OX=96... [more]
sp|Q6BHT4|ERFB_DEBHA1.201e-1236.90Palmitoyltransferase ERF2 OS=Debaryomyces hansenii... [more]
sp|Q6UX98|ZDH24_HUMAN3.207e-1247.62Probable palmitoyltransferase ZDHHC24 OS=Homo sapi... [more]
back to top
BLAST of SMED30018780 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I7J61.600e-4235.54Palmitoyltransferase OS=Macrostomum lignano OX=282... [more]
A0A267FH644.310e-4235.14Palmitoyltransferase OS=Macrostomum lignano OX=282... [more]
R7UKE21.732e-4027.15Palmitoyltransferase OS=Capitella teleta OX=283909... [more]
A0A1I8HZU42.020e-4034.83Palmitoyltransferase OS=Macrostomum lignano OX=282... [more]
A0A1S3H9I31.841e-3933.54Palmitoyltransferase OS=Lingula unguis OX=7574 GN=... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc16a4.788e-1433.61zinc finger DHHC-type containing 16 [Source:NCBI g... [more]
zdhhc242.465e-1340.00probable palmitoyltransferase ZDHHC24 [Source:NCBI... [more]
zdhhc16a3.378e-1239.47zinc finger DHHC-type containing 16 [Source:NCBI g... [more]
zdhhc16b2.182e-1143.75probable palmitoyltransferase ZDHHC16 [Source:NCBI... [more]
zdhhc16b2.182e-1143.75probable palmitoyltransferase ZDHHC16 [Source:NCBI... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc247.206e-1447.37zinc finger DHHC-type containing 24 [Source:ZFIN;A... [more]
zdhhc16a4.391e-1323.88zinc finger DHHC-type containing 16a [Source:NCBI ... [more]
zdhhc62.908e-1140.91zinc finger DHHC-type containing 6 [Source:ZFIN;Ac... [more]
zdhhc3a1.813e-1039.44zinc finger DHHC-type containing 3a [Source:ZFIN;A... [more]
ENSPMAT00000004672.19.162e-1045.59pep scaffold:Pmarinus_7.0:GL477315:17052:39954:-1 ... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ERF28.850e-1138.36Subunit of a palmitoyltransferase; this complex ad... [more]
PFA46.940e-1050.00Palmitoyltransferase with autoacylation activity; ... [more]
PFA31.748e-942.62Palmitoyltransferase for Vac8p; required for vacuo... [more]
SWF11.193e-734.21Palmitoyltransferase that acts on transmembrane pr... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO318641.220e-1929.32Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO463043.695e-1241.94Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO408253.844e-1227.11Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO383765.742e-1140.26Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO442981.884e-1030.65Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of SMED30018780 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc222.249e-1329.63zinc finger DHHC-type containing 22 [Source:NCBI g... [more]
zdhhc243.422e-1340.79zinc finger DHHC-type containing 24 [Source:NCBI g... [more]
zdhhc16a7.191e-1242.11palmitoyltransferase ZDHHC16A-like [Source:NCBI ge... [more]
zdhhc16a8.520e-1242.11palmitoyltransferase ZDHHC16A-like [Source:NCBI ge... [more]
zdhhc23a8.863e-1232.33palmitoyltransferase ZDHHC23-like [Source:NCBI gen... [more]
back to top
BLAST of SMED30018780 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062891.10.000e+098.69SMESG000062891.1[more]
SMESG000027921.19.031e-1626.24SMESG000027921.1[more]
SMESG000077927.12.528e-1543.28SMESG000077927.1[more]
SMESG000004244.14.014e-1241.67SMESG000004244.1[more]
SMESG000004244.14.129e-1241.67SMESG000004244.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018780 ID=SMED30018780|Name=SMED30018780|organism=Schmidtea mediterranea sexual|type=transcript|length=1327bp
AAAAGCTTGTATATTTTAATTGCTGGATTTATAATAATTTTATACAAATT
ACTCTACCATTACGACCATACGATATTACAATTATATATAAACTAATTTC
AAAAATCAACGATGAATGATAAAGTTACTTACAGACAAAATGCGGATAAA
TCCTGCTCTGTAATCGCACTTGAGGACACATTTGAATTAACTAAAGAAGA
ATTTGAGAAATTGCCAATTCATAATAAATTTTCAGCAATGTGGAATCAGA
AATACATCGATTTATCAATGTTCAAATATTCGTATTTAGCTGGGATTTTT
CTTTACATTTTTCTTTCTGTAACCGAATTGTATATATTGAGAAATCACGT
GATTGCTGCAGTGTTTGACGATCCATATGAGCGATATTGGTACCGAGTTG
TGTGTTGCTACTTGTTTTACATTTCCACTGCTCATTGGCTGTGCGTTTTG
CTATATGATTCCAATTGGACTCCAACCAATCAAGATTCAGTGGCCTTGCA
AAATAAAACCCTTTGGGAAGATTATGATGAAATATTGGAATCAAGTCGAA
AGAAACGTGTGCTTGATAAATCTTTGATTACAGAAACAAAACATATAAAT
CGAATGGTTGAATACTTGCCAGAAGAAGAATCTGGGCTCCGGTGGCGATT
TTGTGTTATATGTCAGTGCGATGCCCCGCCGAGGGCCCACCACTGTGTAG
TTTGTAACAAATGCATTCTTAAACGTGACCATCATTGCTTTATCACTGGC
AGATGTATTGGGTACTGTAACCAGCGATATTTCTATTTCTTGTGCCTTTT
TGCTTTTATCAATTCTGTCATTGGAGTTGTTGCCGGAGCTTATTACATCA
TTTATCATTCTGCCATTGGATCGCAATCAATGTGGGGAAGTCTGTTTATT
ATTAAATCGGTCTATATGTGGTTATGGACAAAAGAACTGGAATCCTTTTT
ATTCATTATTATACTTCATCTTTATATTTTCCCGATTATTGGAGCGATGT
GTTTTGGATTTGTTTCTATACAAACTGTGGTTATACTCAAGGTAAAGGAA
TTTGGTTTGACTTCAGATGAGTTCAAGAATCACCAAGACATCAAAGTAAA
TATTGGATTTCGTCAAAGGTGGCATGAAGTATTTGGCAGATTTTGGATTT
TAAACTTTTTCATGCCTTCCCAAATATTATTTAAACTCGAAGGTAATGGG
ACTGATTGGCCTGGGTTGATCAGTTTGAAAGGTTTGACGTCTCTAAAACA
GTACAAATAGTCTTGACAAACTTTAGAAGAATTAAAATTTTAGTTAAATT
TTGTGCTCTATTTTTAAATTTAAGAGA
back to top

protein sequence of SMED30018780-orf-1

>SMED30018780-orf-1 ID=SMED30018780-orf-1|Name=SMED30018780-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MNDKVTYRQNADKSCSVIALEDTFELTKEEFEKLPIHNKFSAMWNQKYID
LSMFKYSYLAGIFLYIFLSVTELYILRNHVIAAVFDDPYERYWYRVVCCY
LFYISTAHWLCVLLYDSNWTPTNQDSVALQNKTLWEDYDEILESSRKKRV
LDKSLITETKHINRMVEYLPEEESGLRWRFCVICQCDAPPRAHHCVVCNK
CILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHS
AIGSQSMWGSLFIIKSVYMWLWTKELESFLFIIILHLYIFPIIGAMCFGF
VSIQTVVILKVKEFGLTSDEFKNHQDIKVNIGFRQRWHEVFGRFWILNFF
MPSQILFKLEGNGTDWPGLISLKGLTSLKQYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0019706protein-cysteine S-palmitoyltransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR001594Palmitoyltrfase_DHHC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001594Palmitoyltransferase, DHHC domainPFAMPF01529DHHCcoord: 178..309
e-value: 3.1E-22
score: 79.1
NoneNo IPR availablePANTHERPTHR22883:SF23PALMITOYLTRANSFERASEcoord: 56..343
NoneNo IPR availablePANTHERPTHR22883ZINC FINGER DHHC DOMAIN CONTAINING PROTEINcoord: 56..343
NoneNo IPR availablePROSITEPS50216DHHCcoord: 179..229
score: 21.758
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 279..301
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 91..113