Transcriptional repressor protein YY1

Overview
NameTranscriptional repressor protein YY1
Smed IDSMED30018775
Length (bp)1020
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcriptional repressor protein YY1 (SMED30018775) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcriptional repressor protein YY1 (SMED30018775) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcriptional repressor protein YY1 (SMED30018775) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcriptional repressor protein YY1 (SMED30018775) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018775

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018775h1SMcG0013048 SmedASXL_003824SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Human
Match: YY1 (YY1 transcription factor [Source:HGNC Symbol;Acc:HGNC:12856])

HSP 1 Score: 172.555 bits (436), Expect = 1.241e-49
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  296 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 409          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Human
Match: YY2 (YY2 transcription factor [Source:HGNC Symbol;Acc:HGNC:31684])

HSP 1 Score: 167.933 bits (424), Expect = 2.713e-48
Identity = 74/139 (53.24%), Postives = 98/139 (70.50%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            LSD +   +F+  K K +       + C++ GC K+F+D + MRKHLH H  + H+C  C K F+ESSKL+RH LVH+G KP +C FEGC K FSL  N++THLRIHTG++PF+CP+  CN+ FAQSTNLK+H LTH K
Sbjct:  229 LSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKTHILTHVK 367          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Human
Match: ZFP42 (ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:30949])

HSP 1 Score: 152.525 bits (384), Expect = 4.948e-43
Identity = 71/138 (51.45%), Postives = 95/138 (68.84%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLES-SGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            LSD +   +F+  K   N   +S S I+C   GCT+  ++++ +RKHL  H  + H+C  C K FVESSKLKRH+LVH+G KP +C FEGC K FSL  N++TH+RIHTGE+ F+CP+  CN+ F QS NLK+H LTH
Sbjct:  162 LSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTH 299          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Human
Match: ZFP42 (ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:30949])

HSP 1 Score: 152.525 bits (384), Expect = 4.948e-43
Identity = 71/138 (51.45%), Postives = 95/138 (68.84%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLES-SGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            LSD +   +F+  K   N   +S S I+C   GCT+  ++++ +RKHL  H  + H+C  C K FVESSKLKRH+LVH+G KP +C FEGC K FSL  N++TH+RIHTGE+ F+CP+  CN+ F QS NLK+H LTH
Sbjct:  162 LSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTH 299          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Human
Match: ZFP42 (ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:HGNC:30949])

HSP 1 Score: 152.525 bits (384), Expect = 4.948e-43
Identity = 71/138 (51.45%), Postives = 95/138 (68.84%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLES-SGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            LSD +   +F+  K   N   +S S I+C   GCT+  ++++ +RKHL  H  + H+C  C K FVESSKLKRH+LVH+G KP +C FEGC K FSL  N++TH+RIHTGE+ F+CP+  CN+ F QS NLK+H LTH
Sbjct:  162 LSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTH 299          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 91.2781 bits (225), Expect = 9.446e-21
Identity = 45/131 (34.35%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  598 NTKTKSNSFLESSGISCTFIGCT---KVFKDKSRMRKHLHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQ 978
            +T   SN     S   C + GC    K+FK K ++  H+  H   +  +C+VC K F  S  LK H  +HSG KP +C   GCTK F+   + K H+ +H+  +P+ C YP+C K +   ++L+ H   H+
Sbjct:  105 STHISSNHITHDSKFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHE 235          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 90.8929 bits (224), Expect = 1.091e-20
Identity = 45/131 (34.35%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  598 NTKTKSNSFLESSGISCTFIGCT---KVFKDKSRMRKHLHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQ 978
            +T   SN     S   C + GC    K+FK K ++  H+  H   +  +C+VC K F  S  LK H  +HSG KP +C   GCTK F+   + K H+ +H+  +P+ C YP+C K +   ++L+ H   H+
Sbjct:   92 STHISSNHITHDSKFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHE 222          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 90.8929 bits (224), Expect = 1.091e-20
Identity = 45/131 (34.35%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  598 NTKTKSNSFLESSGISCTFIGCT---KVFKDKSRMRKHLHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQ 978
            +T   SN     S   C + GC    K+FK K ++  H+  H   +  +C+VC K F  S  LK H  +HSG KP +C   GCTK F+   + K H+ +H+  +P+ C YP+C K +   ++L+ H   H+
Sbjct:   92 STHISSNHITHDSKFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHE 222          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Celegans
Match: F47E1.3 (pep chromosome:WBcel235:X:9046213:9054885:1 gene:WBGene00018567.1 transcript:F47E1.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F47E1.3)

HSP 1 Score: 88.5817 bits (218), Expect = 4.389e-19
Identity = 47/108 (43.52%), Postives = 65/108 (60.19%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKH-LHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSH 963
            CT   C + F+ + R+R H LH H+  + H+C VC+K F +SS L +H  VHSG +P KC F  C K F+    ++TH+R H+GE+PF C +  C KAFA      SH
Sbjct:  497 CTI--CNRSFEKRDRLRIHILHVHENHRPHVCSVCQKSFSQSSSLNKHLRVHSGERPYKCSF--CPKAFTASSILRTHVRQHSGEKPFKCAH--CGKAFASHAAHDSH 598          

HSP 2 Score: 63.5438 bits (153), Expect = 7.954e-11
Identity = 48/147 (32.65%), Postives = 75/147 (51.02%), Query Frame = 1
Query:  553 SDDSLSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKT-----KSHICEVCKKGFVESSKLKRHYL-VHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            ++D  S+ E +P+  +   K N  + S+G SC    C KVF  +    KHL   +      +   C +C + F +  +L+ H L VH   +P  C    C K+FS   ++  HLR+H+GERP+ C +  C KAF  S+ L++H   H
Sbjct:  436 TEDRKSEVE-EPEIIDDVAKKNENV-SNGFSCE--RCGKVFSYEYYRDKHLKYTRCVDNGNRKFPCTICNRSFEKRDRLRIHILHVHENHRPHVCSV--CQKSFSQSSSLNKHLRVHSGERPYKCSF--CPKAFTASSILRTHVRQH 574          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 84.7297 bits (208), Expect = 9.383e-18
Identity = 40/106 (37.74%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKTKSHI-CEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C K F   S ++ H+ TH  +    CE+C K F + + L++H+LVH+G +P +C+   C K FS   N+KTHLR+H G++P+ C    C+  F Q  +L+ H+  H
Sbjct:  513 CNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDI--CDKRFSSTSNLKTHLRLHNGQKPYTCDV--CDAKFTQYVHLRLHKRLH 614          

HSP 2 Score: 67.781 bits (164), Expect = 3.108e-12
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKH--LHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLT 972
            CTK F   + ++KH  +HT + + H C++C K F  +S LK H  +H+G+KP  C+   C   F+   +++ H R+H  ERP+ C    C K +   + L++H  T
Sbjct:  541 CTKEFTQLAHLQKHHLVHTGE-RPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDV--CDAKFTQYVHLRLHKRLHANERPYSC--GTCGKKYISPSGLRTHWKT 641          

HSP 3 Score: 67.3958 bits (163), Expect = 4.148e-12
Identity = 34/83 (40.96%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  727 HICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            + C+ C K F + S LK H   H+G +P KCE   CTK F+ + +++ H  +HTGERP  C    C+K F+ ++NLK+H   H
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEI--CTKEFTQLAHLQKHHLVHTGERPHRCDI--CDKRFSSTSNLKTHLRLH 586          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Fly
Match: pho (gene:FBgn0002521 transcript:FBtr0089204)

HSP 1 Score: 170.244 bits (430), Expect = 3.019e-48
Identity = 76/121 (62.81%), Postives = 89/121 (73.55%), Query Frame = 1
Query:  619 SFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            S+     I+C   GC K F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RPF+CP+  CNK FAQSTNLKSH LTH K
Sbjct:  350 SYTNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAK 470          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Fly
Match: pho (gene:FBgn0002521 transcript:FBtr0089205)

HSP 1 Score: 170.244 bits (430), Expect = 3.019e-48
Identity = 76/121 (62.81%), Postives = 89/121 (73.55%), Query Frame = 1
Query:  619 SFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            S+     I+C   GC K F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RPF+CP+  CNK FAQSTNLKSH LTH K
Sbjct:  350 SYTNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAK 470          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Fly
Match: phol (gene:FBgn0035997 transcript:FBtr0345600)

HSP 1 Score: 164.081 bits (414), Expect = 3.478e-45
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            CT  GC K F++ S MRKH+HTH  + H+C VC K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP+ CP   C+K FAQSTNLKSH LTH K
Sbjct:  504 CTHRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEGCGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTK 615          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Fly
Match: phol (gene:FBgn0035997 transcript:FBtr0076475)

HSP 1 Score: 164.081 bits (414), Expect = 3.478e-45
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            CT  GC K F++ S MRKH+HTH  + H+C VC K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP+ CP   C+K FAQSTNLKSH LTH K
Sbjct:  504 CTHRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEGCGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTK 615          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Fly
Match: MTF-1 (gene:FBgn0040305 transcript:FBtr0344236)

HSP 1 Score: 107.842 bits (268), Expect = 2.014e-25
Identity = 48/114 (42.11%), Postives = 69/114 (60.53%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNL 987
            C   GC K F  + R+  HL  H  ++  CE+C+K F   S LK+H   H+  +P KC  + C K F+  H++KTH R HTGE+P+ C   +C K+F+ S +LKSH+ THQ+ L
Sbjct:  391 CEVSGCDKAFNTRYRLHAHLRLHNGETFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTHTGEKPYPCQEDSCQKSFSTSHSLKSHKKTHQRQL 504          

HSP 2 Score: 80.4925 bits (197), Expect = 3.109e-16
Identity = 49/140 (35.00%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSL---------IHN------------------MKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C +  C + +     +R HL TH    S  C  + C K F+ S  LK H  VH+  KP +CE  GC K F+          +HN                  +K H+R HT ERP+ CP  +C KAF  S +LK+HR TH
Sbjct:  331 CNYENCYRSYSTIGNLRTHLKTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLHAHLRLHNGETFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTH 470          

HSP 3 Score: 58.151 bits (139), Expect = 5.151e-9
Identity = 25/56 (44.64%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C +E C +++S I N++THL+ HTG+  F CP   C+KAF  S +LK H   H K
Sbjct:  330 RCNYENCYRSYSTIGNLRTHLKTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTK 385          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Zebrafish
Match: yy1a (YY1 transcription factor a [Source:ZFIN;Acc:ZDB-GENE-030131-1117])

HSP 1 Score: 172.17 bits (435), Expect = 2.697e-50
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  239 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 352          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Zebrafish
Match: yy1b (YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2127])

HSP 1 Score: 170.629 bits (431), Expect = 1.072e-49
Identity = 74/114 (64.91%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GC+K+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  236 IACPHKGCSKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 349          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Zebrafish
Match: mtf1 (metal-regulatory transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-020424-1])

HSP 1 Score: 105.145 bits (261), Expect = 1.645e-24
Identity = 51/117 (43.59%), Postives = 67/117 (57.26%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKH--LHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS 990
            C   GC K F    R++ H  LHT KT +   E C K F   S L++H   H+G KP +C+ +GC K F+  H++KTH+R HTGE+PF CP   C K F+   +LKSH   H K  S
Sbjct:  213 CDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFFCPSDGCEKTFSSQYSLKSHIRGHDKGPS 329          

HSP 2 Score: 90.1225 bits (222), Expect = 2.024e-19
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKC-----------------------------EFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C F GCT+ +     +R H  TH+ + + +C  + C K F+ S  LK H  VH+  KP +C                             E EGCTK F+ + +++ H+R HTGE+PF C +  C KAFA S +LK+H  TH
Sbjct:  153 CLFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTH 294          

HSP 3 Score: 58.5362 bits (140), Expect = 5.229e-9
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C FEGCT+T+S   N++TH + H GE  F+C    C KAF  S +LK H   H K
Sbjct:  152 QCLFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTK 207          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Zebrafish
Match: mtf1 (metal-regulatory transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-020424-1])

HSP 1 Score: 105.531 bits (262), Expect = 1.739e-24
Identity = 51/117 (43.59%), Postives = 67/117 (57.26%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKH--LHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS 990
            C   GC K F    R++ H  LHT KT +   E C K F   S L++H   H+G KP +C+ +GC K F+  H++KTH+R HTGE+PF CP   C K F+   +LKSH   H K  S
Sbjct:  265 CDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFFCPSDGCEKTFSSQYSLKSHIRGHDKGPS 381          

HSP 2 Score: 90.5077 bits (223), Expect = 1.875e-19
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKC-----------------------------EFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C F GCT+ +     +R H  TH+ + + +C  + C K F+ S  LK H  VH+  KP +C                             E EGCTK F+ + +++ H+R HTGE+PF C +  C KAFA S +LK+H  TH
Sbjct:  205 CLFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTH 346          

HSP 3 Score: 58.5362 bits (140), Expect = 5.515e-9
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C FEGCT+T+S   N++TH + H GE  F+C    C KAF  S +LK H   H K
Sbjct:  204 QCLFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTK 259          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Zebrafish
Match: mtf1 (metal-regulatory transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-020424-1])

HSP 1 Score: 105.145 bits (261), Expect = 1.986e-24
Identity = 51/117 (43.59%), Postives = 67/117 (57.26%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKH--LHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS 990
            C   GC K F    R++ H  LHT KT +   E C K F   S L++H   H+G KP +C+ +GC K F+  H++KTH+R HTGE+PF CP   C K F+   +LKSH   H K  S
Sbjct:  240 CDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFFCPSDGCEKTFSSQYSLKSHIRGHDKGPS 356          

HSP 2 Score: 90.1225 bits (222), Expect = 2.201e-19
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKC-----------------------------EFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C F GCT+ +     +R H  TH+ + + +C  + C K F+ S  LK H  VH+  KP +C                             E EGCTK F+ + +++ H+R HTGE+PF C +  C KAFA S +LK+H  TH
Sbjct:  180 CLFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTH 321          

HSP 3 Score: 58.5362 bits (140), Expect = 6.016e-9
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C FEGCT+T+S   N++TH + H GE  F+C    C KAF  S +LK H   H K
Sbjct:  179 QCLFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTK 234          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Xenopus
Match: hcn1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:Xenbase;Acc:XB-GENE-950265])

HSP 1 Score: 172.555 bits (436), Expect = 3.806e-50
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  254 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 367          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Xenopus
Match: fam83h (family with sequence similarity 83 member H [Source:Xenbase;Acc:XB-GENE-5797458])

HSP 1 Score: 98.9821 bits (245), Expect = 1.191e-22
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            + C+F GC + F   + +R HL TH+  +S  C  E C K F    +LK H   H+G KP  C   GC K F+   N+K HLRIHTGE+PF+C    C ++FA+ ++L+ H++ H
Sbjct:  215 LHCSFQGCDRSFVYPTHLRYHLKTHRNDRSFACPSEGCGKRFYVLQRLKVHMRTHNGEKPFLCSEPGCGKQFTTAGNLKNHLRIHTGEKPFLCEMEGCGRSFAEYSSLRKHQVVH 329          

HSP 2 Score: 75.0998 bits (183), Expect = 2.158e-14
Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  643 SCTFIGCTKVFKDKSRMRKHLHTH-KTKSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            +C   GC K F    R++ H+ TH   K  +C    C K F  +  LK H  +H+G KP  CE EGC ++F+   +++ H  +H+G +   CP   C K F+QS +  +H   H
Sbjct:  246 ACPSEGCGKRFYVLQRLKVHMRTHNGEKPFLCSEPGCGKQFTTAGNLKNHLRIHTGEKPFLCEMEGCGRSFAEYSSLRKHQVVHSGVKSHQCPV--CGKTFSQSGSRNAHLRKH 357          

HSP 3 Score: 48.9062 bits (115), Expect = 7.446e-6
Identity = 24/87 (27.59%), Postives = 36/87 (41.38%), Query Frame = 1
Query:  805 KPIKCEFEGCTKTFS------------------------------LIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            K + C F+GC ++F                               ++  +K H+R H GE+PF+C  P C K F  + NLK+H   H
Sbjct:  213 KRLHCSFQGCDRSFVYPTHLRYHLKTHRNDRSFACPSEGCGKRFYVLQRLKVHMRTHNGEKPFLCSEPGCGKQFTTAGNLKNHLRIH 299          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Xenopus
Match: fam83h (family with sequence similarity 83 member H [Source:Xenbase;Acc:XB-GENE-5797458])

HSP 1 Score: 98.5969 bits (244), Expect = 1.426e-22
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            + C+F GC + F   + +R HL TH+  +S  C  E C K F    +LK H   H+G KP  C   GC K F+   N+K HLRIHTGE+PF+C    C ++FA+ ++L+ H++ H
Sbjct:  192 LHCSFQGCDRSFVYPTHLRYHLKTHRNDRSFACPSEGCGKRFYVLQRLKVHMRTHNGEKPFLCSEPGCGKQFTTAGNLKNHLRIHTGEKPFLCEMEGCGRSFAEYSSLRKHQVVH 306          

HSP 2 Score: 74.3294 bits (181), Expect = 2.950e-14
Identity = 39/114 (34.21%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  643 SCTFIGCTKVFKDKSRMRKHLHTH-KTKSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            +C   GC K F    R++ H+ TH   K  +C    C K F  +  LK H  +H+G KP  CE EGC ++F+   +++ H  +H+G +   CP   C K F+QS +  +H   H
Sbjct:  223 ACPSEGCGKRFYVLQRLKVHMRTHNGEKPFLCSEPGCGKQFTTAGNLKNHLRIHTGEKPFLCEMEGCGRSFAEYSSLRKHQVVHSGVKSHQCPV--CGKTFSQSGSRNAHLRKH 334          

HSP 3 Score: 48.9062 bits (115), Expect = 7.596e-6
Identity = 24/87 (27.59%), Postives = 36/87 (41.38%), Query Frame = 1
Query:  805 KPIKCEFEGCTKTFS------------------------------LIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            K + C F+GC ++F                               ++  +K H+R H GE+PF+C  P C K F  + NLK+H   H
Sbjct:  190 KRLHCSFQGCDRSFVYPTHLRYHLKTHRNDRSFACPSEGCGKRFYVLQRLKVHMRTHNGEKPFLCSEPGCGKQFTTAGNLKNHLRIH 276          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Xenopus
Match: znf143 (zinc finger protein 143 [Source:NCBI gene;Acc:595042])

HSP 1 Score: 99.7525 bits (247), Expect = 1.520e-22
Identity = 47/113 (41.59%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C   GC K F     ++ H+ TH   K + C  E C K F  S  L++H   H+G +P KC FEGC ++F+  +  K H+R HTGERP+ C  P C +AFA +TN K+H   H
Sbjct:  236 CDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIH 348          

HSP 2 Score: 87.4261 bits (215), Expect = 2.504e-18
Identity = 42/113 (37.17%), Postives = 62/113 (54.87%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHI-C--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C+   CTK FK    ++KH+ TH  +    C  E C + F  S+  K H   H+G +P  C   GC + F+   N K H+RIHTGE+P++C  P C+K F + ++L  H + H
Sbjct:  266 CSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVH 378          

HSP 3 Score: 68.1662 bits (165), Expect = 4.982e-12
Identity = 34/82 (41.46%), Postives = 44/82 (53.66%), Query Frame = 1
Query:  760 ESSKLKRHYLVHSGRKPIK----------CEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            ES K  +  L H  R P K          C++EGC K ++  H++K H R HTG+RP+ C +  C KAFA    LKSH  TH
Sbjct:  177 ESEKKMQIVLSHGSRIPAKPPQTNEKAFRCDYEGCGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTH 258          

HSP 4 Score: 61.2326 bits (147), Expect = 8.725e-10
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLT 972
            C F GC + F   +  + H+ TH   + + C    C + F  ++  K H  +H+G KP  C   GC K F+   ++  H  +HT  +P+ C +  C K + Q + L  H+ T
Sbjct:  296 CPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--CGKTYKQISTLAMHKRT 405          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Xenopus
Match: znf143 (zinc finger protein 143 [Source:NCBI gene;Acc:595042])

HSP 1 Score: 99.7525 bits (247), Expect = 1.656e-22
Identity = 47/113 (41.59%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C   GC K F     ++ H+ TH   K + C  E C K F  S  L++H   H+G +P KC FEGC ++F+  +  K H+R HTGERP+ C  P C +AFA +TN K+H   H
Sbjct:  259 CDHGGCRKAFATGYGLKSHVRTHTGEKPYRCSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIH 371          

HSP 2 Score: 87.4261 bits (215), Expect = 2.537e-18
Identity = 42/113 (37.17%), Postives = 62/113 (54.87%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHI-C--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C+   CTK FK    ++KH+ TH  +    C  E C + F  S+  K H   H+G +P  C   GC + F+   N K H+RIHTGE+P++C  P C+K F + ++L  H + H
Sbjct:  289 CSEENCTKSFKTSGDLQKHVRTHTGERPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVH 401          

HSP 3 Score: 68.1662 bits (165), Expect = 5.515e-12
Identity = 34/82 (41.46%), Postives = 44/82 (53.66%), Query Frame = 1
Query:  760 ESSKLKRHYLVHSGRKPIK----------CEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            ES K  +  L H  R P K          C++EGC K ++  H++K H R HTG+RP+ C +  C KAFA    LKSH  TH
Sbjct:  200 ESEKKMQIVLSHGSRIPAKPPQTNEKAFRCDYEGCGKLYTTAHHLKVHERSHTGDRPYQCDHGGCRKAFATGYGLKSHVRTH 281          

HSP 4 Score: 61.6178 bits (148), Expect = 7.347e-10
Identity = 33/112 (29.46%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLT 972
            C F GC + F   +  + H+ TH   + + C    C + F  ++  K H  +H+G KP  C   GC K F+   ++  H  +HT  +P+ C +  C K + Q + L  H+ T
Sbjct:  319 CPFEGCGRSFTTSNIRKVHIRTHTGERPYYCSEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--CGKTYKQISTLAMHKRT 428          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Mouse
Match: Yy1 (YY1 transcription factor [Source:MGI Symbol;Acc:MGI:99150])

HSP 1 Score: 172.17 bits (435), Expect = 1.157e-49
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  296 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 409          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Mouse
Match: Mbtps2 (membrane-bound transcription factor peptidase, site 2 [Source:MGI Symbol;Acc:MGI:2444506])

HSP 1 Score: 170.629 bits (431), Expect = 1.590e-49
Identity = 79/140 (56.43%), Postives = 99/140 (70.71%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            LSD +   +F++ + K         I+C+  GC K+FKD S MRKHLH H  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC + FSL  N++TH+RIHTG++PF+CP+  CNK FAQSTNLKSH LTH KN
Sbjct:  235 LSDPKQLAEFTSMRPKKPKGDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKN 374          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Mouse
Match: Yy2 (Yy2 transcription factor [Source:MGI Symbol;Acc:MGI:3837947])

HSP 1 Score: 170.629 bits (431), Expect = 1.590e-49
Identity = 79/140 (56.43%), Postives = 99/140 (70.71%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            LSD +   +F++ + K         I+C+  GC K+FKD S MRKHLH H  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC + FSL  N++TH+RIHTG++PF+CP+  CNK FAQSTNLKSH LTH KN
Sbjct:  235 LSDPKQLAEFTSMRPKKPKGDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKN 374          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Mouse
Match: Zfp42 (zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:99187])

HSP 1 Score: 144.436 bits (363), Expect = 2.084e-40
Identity = 64/116 (55.17%), Postives = 80/116 (68.97%), Query Frame = 1
Query:  634 SGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            S + C   GC K  +DK+ +RKH+  H  + H+C  C K F ESSKLKRH+LVH+G KP +C FEGC K FSL  N++TH+RIHTGER F+CP+  C K+F QS N K H LTH K
Sbjct:  168 SMLECPQAGCKKKLRDKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHTGEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAK 283          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Mouse
Match: Zfp42 (zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:99187])

HSP 1 Score: 144.436 bits (363), Expect = 2.084e-40
Identity = 64/116 (55.17%), Postives = 80/116 (68.97%), Query Frame = 1
Query:  634 SGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            S + C   GC K  +DK+ +RKH+  H  + H+C  C K F ESSKLKRH+LVH+G KP +C FEGC K FSL  N++TH+RIHTGER F+CP+  C K+F QS N K H LTH K
Sbjct:  168 SMLECPQAGCKKKLRDKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHTGEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAK 283          
BLAST of Transcriptional repressor protein YY1 vs. UniProt/SwissProt
Match: sp|P0C6P6|TYY2_RAT (Transcription factor YY2 OS=Rattus norvegicus OX=10116 GN=Yy2 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.868e-49
Identity = 79/140 (56.43%), Postives = 99/140 (70.71%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            LSD +   +F++ K K         ++C+  GC K+FKD S MRKHLH H  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC + FSL  N++TH+RIHTG++PF+CP+  CNK FAQSTNLKSH LTH KN
Sbjct:  233 LSDPKQLAEFTSMKPKKPKGDFPRPVACSHKGCGKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKN 372          
BLAST of Transcriptional repressor protein YY1 vs. UniProt/SwissProt
Match: sp|P25490|TYY1_HUMAN (Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 5.961e-49
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  296 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 409          
BLAST of Transcriptional repressor protein YY1 vs. UniProt/SwissProt
Match: sp|Q2FAY8|TYY2_RATRT (Transcription factor YY2 OS=Rattus rattus OX=10117 GN=Yy2 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.058e-49
Identity = 79/140 (56.43%), Postives = 99/140 (70.71%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            LSD +   +F++ K K         ++C+  GC K+FKD S MRKHLH H  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC + FSL  N++TH+RIHTG++PF+CP+  CNK FAQSTNLKSH LTH KN
Sbjct:  233 LSDPKQLAEFTSMKPKKPKGDFPRPVACSHKGCGKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKN 372          
BLAST of Transcriptional repressor protein YY1 vs. UniProt/SwissProt
Match: sp|Q00899|TYY1_MOUSE (Transcriptional repressor protein YY1 OS=Mus musculus OX=10090 GN=Yy1 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 8.090e-49
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  296 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 409          
BLAST of Transcriptional repressor protein YY1 vs. UniProt/SwissProt
Match: sp|Q3TTC2|TYY2_MOUSE (Transcription factor YY2 OS=Mus musculus OX=10090 GN=Yy2 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.112e-48
Identity = 79/140 (56.43%), Postives = 99/140 (70.71%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            LSD +   +F++ + K         I+C+  GC K+FKD S MRKHLH H  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC + FSL  N++TH+RIHTG++PF+CP+  CNK FAQSTNLKSH LTH KN
Sbjct:  235 LSDPKQLAEFTSMRPKKPKGDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKN 374          
BLAST of Transcriptional repressor protein YY1 vs. TrEMBL
Match: A0A5J6BTA5 (Transcriptional repressor protein YY1 OS=Dugesia japonica OX=6161 GN=yy1 PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.195e-124
Identity = 212/327 (64.83%), Postives = 259/327 (79.20%), Query Frame = 1
Query:   34 MLEMQKIFLDCEDSNITDPLNDKLMNLDFWNFYLKTRLKYSHSDLENTIDTNDSSFLVTFERHSLPKINDSINQDLDLKKFNIKTEP-------ISIPPRVLQNISNSNYEFNLVNRQSIFGNSNKTIYRNHVLNVIKYEKNLSSNELENISFPXXXXXXXXXXXXXXETPEL--DVDFEDRSDDSLSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNL 987
            M ++QKI  D ++S  +DPLNDKLMNLD+W F+L  RL+Y++ D ++ IDTNDS+FLVTFERHS       ++++L+L + ++K++P       I    RVLQNISNS  E +L +R+    ++ K     +V+  IKYEK ++S ELENIS PNSSNTDTSSDN LTE+ EL  D+++E++S DSLS+FEN+   SN K K  + LES GI CTF GC+KVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKC+FEGC+KTFSLIHNMKTHLRIHTGERPF CPYPNCNK+FAQSTNLKSH+LTHQKN+
Sbjct:    1 MWDVQKILFDSDESCCSDPLNDKLMNLDYWKFHLTNRLQYTYCDWDSLIDTNDSNFLVTFERHSAALTEKIVHKELELNE-SLKSQPSQCKLEEIDCHSRVLQNISNSTLEISL-DRKLFNLDNLKKFNSYNVVKTIKYEKIINS-ELENISLPNSSNTDTSSDNHLTESTELEHDLNYEEKSFDSLSEFENESD-SNDKNKIVNNLESIGIPCTFNGCSKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCQFEGCSKTFSLIHNMKTHLRIHTGERPFHCPYPNCNKSFAQSTNLKSHKLTHQKNM 323          
BLAST of Transcriptional repressor protein YY1 vs. TrEMBL
Match: A0A1D2MY96 (Transcriptional repressor protein YY1 OS=Orchesella cincta OX=48709 GN=Ocin01_08759 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 6.781e-49
Identity = 83/142 (58.45%), Postives = 101/142 (71.13%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS 990
            LSD +   +F+  K K  S   +  I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K  S
Sbjct:  221 LSDPKQLAEFARLKPKKPSDDVARTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKS 362          
BLAST of Transcriptional repressor protein YY1 vs. TrEMBL
Match: T1IWV8 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.136e-48
Identity = 81/139 (58.27%), Postives = 101/139 (72.66%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            LSD +   +F+  K + +S   +  I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  194 LSDPKQLAEFAKMKPRKHSDDVARTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 332          
BLAST of Transcriptional repressor protein YY1 vs. TrEMBL
Match: A0A087U7R7 (Transcriptional repressor protein YY1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_14037 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.383e-48
Identity = 82/139 (58.99%), Postives = 100/139 (71.94%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            LSD +   +F+  K +  S   S  I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:   16 LSDPKQLAEFAKMKPRKLSDDLSRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 154          
BLAST of Transcriptional repressor protein YY1 vs. TrEMBL
Match: A0A1B6C7T2 (Uncharacterized protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.14028 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 2.071e-48
Identity = 89/169 (52.66%), Postives = 108/169 (63.91%), Query Frame = 1
Query:  523 PELDVDFEDRSDD------------SLSDFENQPKFSN----TKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            P+ D D+ED   D             LSD +   +F+      K K  S L    I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  168 PDPDPDYEDYMTDRKIPTEGGIPGLDLSDPKQLAEFARPGHKIKLKKQSDLIDRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 336          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Cavefish
Match: yy1a (transcriptional repressor protein YY1-like [Source:NCBI gene;Acc:103039658])

HSP 1 Score: 172.17 bits (435), Expect = 2.062e-50
Identity = 81/140 (57.86%), Postives = 100/140 (71.43%), Query Frame = 1
Query:  565 LSDFENQPKFSNTKTKSNSFLESS-GISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            LSD +   +F+  K +     +S   I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  214 LSDPKQLAEFARMKPRKMKEDDSPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 353          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Cavefish
Match: yy1b (YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2127])

HSP 1 Score: 172.17 bits (435), Expect = 2.805e-50
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  251 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 364          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Cavefish
Match: mtf1 (metal regulatory transcription factor 1 [Source:NCBI gene;Acc:103028867])

HSP 1 Score: 104.375 bits (259), Expect = 3.201e-24
Identity = 50/115 (43.48%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKH--LHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            C   GC K F    R++ H  LHT KT +   E C K F   S L++H   H+G KP +C+ +GC K F+  H++KTH+R HTGE+PF CP   C K F+   +LKSH   H K 
Sbjct:  221 CDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFFCPSDGCEKTFSSQYSLKSHIRGHDKG 335          

HSP 2 Score: 90.1225 bits (222), Expect = 2.020e-19
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKC-----------------------------EFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C F GCT+ +     +R H  TH+ + + +C  + C K F+ S  LK H  VH+  KP +C                             E EGCTK F+ + +++ H+R HTGE+PF C +  C KAFA S +LK+H  TH
Sbjct:  161 CMFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTH 302          

HSP 3 Score: 69.3218 bits (168), Expect = 1.525e-12
Identity = 37/89 (41.57%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPF 903
            C   GCTK F   S +RKH+ TH   K   C+   C K F  S  LK H   H+G KP  C  +GC KTFS  +++K+H+R H    P+
Sbjct:  250 CESEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFFCPSDGCEKTFSSQYSLKSHIRGHDKGPPY 338          

HSP 4 Score: 58.151 bits (139), Expect = 5.584e-9
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C FEGCT+T+S   N++TH + H GE  F+C    C KAF  S +LK H   H K
Sbjct:  160 QCMFEGCTRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTK 215          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Cavefish
Match: znf143a (zinc finger protein 143a [Source:ZFIN;Acc:ZDB-GENE-041114-154])

HSP 1 Score: 100.138 bits (248), Expect = 7.433e-23
Identity = 47/113 (41.59%), Postives = 67/113 (59.29%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C   GC K F     ++ H+ TH   K + C+   CKK F  S  L++H  +H+G KP  C +EGC ++F+  +  K H+R HTGERP+ CP P C++AFA +TN K+H   H
Sbjct:  270 CDKPGCGKKFATGYGLKSHIRTHTGEKPYCCQELNCKKSFKTSGDLQKHTRIHTGEKPFMCPYEGCGRSFTTSNICKVHVRTHTGERPYHCPEPGCDRAFASATNYKNHIRIH 382          

HSP 2 Score: 86.6557 bits (213), Expect = 2.855e-18
Identity = 42/113 (37.17%), Postives = 59/113 (52.21%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C  + C K FK    ++KH   H   K  +C  E C + F  S+  K H   H+G +P  C   GC + F+   N K H+RIHTGERP++C  P C K F + ++L  H + H
Sbjct:  300 CQELNCKKSFKTSGDLQKHTRIHTGEKPFMCPYEGCGRSFTTSNICKVHVRTHTGERPYHCPEPGCDRAFASATNYKNHIRIHTGERPYVCTVPGCEKRFTEYSSLYKHHVVH 412          

HSP 3 Score: 73.1738 bits (178), Expect = 8.187e-14
Identity = 30/62 (48.39%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  790 VHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            V SG K  +C +EGC K ++  H++K H RIHTG++P+ C  P C K FA    LKSH  TH
Sbjct:  231 VQSGEKSFQCSYEGCGKLYTTAHHLKVHERIHTGDKPYCCDKPGCGKKFATGYGLKSHIRTH 292          

HSP 4 Score: 72.0182 bits (175), Expect = 1.889e-13
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  736 EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            E C K +  +  LK H  +H+G KP  C+  GC K F+  + +K+H+R HTGE+P+ C   NC K+F  S +L+ H   H
Sbjct:  243 EGCGKLYTTAHHLKVHERIHTGDKPYCCDKPGCGKKFATGYGLKSHIRTHTGEKPYCCQELNCKKSFKTSGDLQKHTRIH 322          

HSP 5 Score: 58.5362 bits (140), Expect = 4.004e-9
Identity = 32/112 (28.57%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKS--HICE-VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLT 972
            C + GC + F   +  + H+ TH  +   H  E  C + F  ++  K H  +H+G +P  C   GC K F+   ++  H  +HT  +P+ C +  C K + Q + L  H+ T
Sbjct:  330 CPYEGCGRSFTTSNICKVHVRTHTGERPYHCPEPGCDRAFASATNYKNHIRIHTGERPYVCTVPGCEKRFTEYSSLYKHHVVHTPCKPYCCNH--CGKTYKQISTLAMHKRT 439          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Cavefish
Match: znf384l (zinc finger protein 384 [Source:NCBI gene;Acc:103027624])

HSP 1 Score: 99.7525 bits (247), Expect = 1.016e-22
Identity = 49/115 (42.61%), Postives = 71/115 (61.74%), Query Frame = 1
Query:  643 SCTFIGCTKVFKDKSRMRKHLHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            +C++  C K F+  S +++H   H ++K H C  C K F  SS L +H  +HSG KP  C +  C KTF  + +++ H RIHTG+RP+ C +P C KAF Q +NL+SHR  H K+
Sbjct:  306 TCSY--CQKSFRQLSHLQQHTRNHTESKPHKCPHCSKSFANSSYLSQHIRIHSGAKPYTCSY--CQKTFRQLSHLQQHHRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKD 416          

HSP 2 Score: 79.337 bits (194), Expect = 7.100e-16
Identity = 36/106 (33.96%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHK-TKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C+K F + S + +H+  H   K + C  C+K F + S L++H+ +H+G +P KC   GC K F+ + N+++H R H  ++P+ C   NCN+ +  + +L+ H  TH
Sbjct:  338 CSKSFANSSYLSQHIRIHSGAKPYTCSYCQKTFRQLSHLQQHHRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPYKC--HNCNRGYTDAASLEVHLSTH 441          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Sea Lamprey
Match: yy1b (YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2127])

HSP 1 Score: 167.548 bits (423), Expect = 3.405e-49
Identity = 73/114 (64.04%), Postives = 88/114 (77.19%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GC K+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  C+K FAQSTNLKSH LTH K
Sbjct:  254 IACPHKGCNKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCSKKFAQSTNLKSHILTHAK 367          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 105.916 bits (263), Expect = 4.225e-26
Identity = 47/108 (43.52%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C K F     ++ HL TH   K ++C  E C+KGF  S  L++H   H+G KP KC FEGC ++F+  +  K H+R HTGERP++CP P C + F+ +TN K+H   H
Sbjct:  172 CGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIH 279          

HSP 2 Score: 73.1738 bits (178), Expect = 1.074e-14
Identity = 32/80 (40.00%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  736 EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            E C + +  +  LK H   H+G +P +C    C K FS  + +K+HLR HTGE+P++CP   C K F  S +L+ H  TH
Sbjct:  140 EGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTH 219          

HSP 3 Score: 66.6254 bits (161), Expect = 1.354e-12
Identity = 34/110 (30.91%), Postives = 57/110 (51.82%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHR 966
            C F GC + F   +  + H+ TH   + ++C    C +GF  ++  K H  +H+G KP  C   GC K F+   ++  H  +HT  +P+ C   NC+K + Q + L +H+
Sbjct:  227 CPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSC--SNCSKTYRQPSTLATHK 334          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 105.531 bits (262), Expect = 6.328e-26
Identity = 47/108 (43.52%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C K F     ++ HL TH   K ++C  E C+KGF  S  L++H   H+G KP KC FEGC ++F+  +  K H+R HTGERP++CP P C + F+ +TN K+H   H
Sbjct:  141 CGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIH 248          

HSP 2 Score: 72.7886 bits (177), Expect = 1.406e-14
Identity = 32/80 (40.00%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  736 EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            E C + +  +  LK H   H+G +P +C    C K FS  + +K+HLR HTGE+P++CP   C K F  S +L+ H  TH
Sbjct:  109 EGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTH 188          

HSP 3 Score: 68.1662 bits (165), Expect = 3.954e-13
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  739 VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            VC   F +S          SG K   C +EGC + ++  H++K H R HTG+RP+ C  P C KAF+    LKSH  TH
Sbjct:   80 VCGHHFCQSMNRASSSGQPSGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTH 158          

HSP 4 Score: 66.2402 bits (160), Expect = 1.929e-12
Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNL 987
            C F GC + F   +  + H+ TH   + ++C    C +GF  ++  K H  +H+G KP  C   GC K F+   ++  H  +HT  +P+ C   NC+K + Q + L +H+ +   ++
Sbjct:  196 CPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSC--SNCSKTYRQPSTLATHKRSAHGDM 310          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Sea Lamprey
Match: mtf1 (metal-regulatory transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-020424-1])

HSP 1 Score: 100.138 bits (248), Expect = 1.358e-23
Identity = 48/119 (40.34%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS*K 996
            C   GC K F    R++ H   H   +  C  E C K F   S L++H   H+G +P +C+  GC K FS+ H+++TH+R HTGERPF CP   C +AF+   +LKSH   H    S K
Sbjct:   68 CGVSGCEKSFNTLYRLKAHQRIHTGNTFNCDSEGCTKFFTTLSDLRKHVRTHTGERPFQCKHSGCGKAFSVSHHLRTHVRTHTGERPFPCPSGGCERAFSSQHSLKSHMKGHPSGASLK 186          

HSP 2 Score: 78.9518 bits (193), Expect = 1.518e-16
Identity = 44/142 (30.99%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHICE--VCKKGFVESSKLKRHYLVHSGRKPIK-----------------------------CEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C + GC + +     ++ H  TH+ + + +CE   C K F+ S   K H  VH+  KP +                             C+ EGCTK F+ + +++ H+R HTGERPF C +  C KAF+ S +L++H  TH
Sbjct:    8 CAYEGCERTYSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTREKPFECGVSGCEKSFNTLYRLKAHQRIHTGNTFNCDSEGCTKFFTTLSDLRKHVRTHTGERPFQCKHSGCGKAFSVSHHLRTHVRTH 149          

HSP 3 Score: 61.2326 bits (147), Expect = 1.126e-10
Identity = 30/83 (36.14%), Postives = 42/83 (50.60%), Query Frame = 1
Query:  736 EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            E C++ +  +  LK H   H G     CE  GC K F   ++ K H+R+HT E+PF C    C K+F     LK+H+  H  N
Sbjct:   11 EGCERTYSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTREKPFECGVSGCEKSFNTLYRLKAHQRIHTGN 93          

HSP 4 Score: 53.5286 bits (127), Expect = 3.257e-8
Identity = 23/56 (41.07%), Postives = 32/56 (57.14%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C +EGC +T+S   N+KTH + H GE  F+C    C KAF  S + K H   H +
Sbjct:    7 QCAYEGCERTYSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTR 62          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003937.1 (pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gene:ENSPMAG00000003606.1 transcript:ENSPMAT00000003937.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 8.906e-20
Identity = 44/108 (40.74%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKTKSHI-CEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            C K F   S ++ HL  H  +    C+ C KGF + + L++H+LVH+G KP +C+   C + FS   N+KTHLR+H+GE+PF C    C   F Q  +LK HR  H +
Sbjct:   20 CGKTFGQLSNLKVHLRIHSGERPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQV--CCRRFSSTSNLKTHLRLHSGEKPFQCKL--CPAKFTQFIHLKLHRRLHAR 123          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 83.5741 bits (205), Expect = 4.085e-18
Identity = 45/117 (38.46%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  634 SGISCTFIGCTKVFKDKSRMRKHLHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            S   C +  C + F  + ++ +HL  H K K + C+ CK+ F     L +H   HSG KP KC    C K F++  ++K H+R HTGE+P  C    C K F +S+NL  H  THQK
Sbjct:  736 SEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQK 848          

HSP 2 Score: 67.3958 bits (163), Expect = 7.861e-13
Identity = 44/118 (37.29%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHL---HTHKTKSH---ICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            + C + GC K F     +  HL   H  + KS    +   C + F +  KL RH  VHS  KP KC+   C + FS    +  H R H+GE+P+ C    CNK FA S++LK H  TH
Sbjct:  705 VICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818          

HSP 3 Score: 53.5286 bits (127), Expect = 2.352e-8
Identity = 32/104 (30.77%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRL 969
            C + F  +  + +H  TH   K + C +C K F  SS LK H   H+G KP++C+   C K F+   N+  H++ H  ++ + C   +C+K+F     L S ++
Sbjct:  773 CKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTH--QKKYKC--SDCSKSFDDLGKLNSQKV 870          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 80.1073 bits (196), Expect = 6.730e-17
Identity = 36/103 (34.95%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHR 966
            C ++F   + +  H+ +H   K  +C+ C K F +   L+ H  +H+G KP  C+   C K FS   N+  HL  H   +PF+C   NCNK F Q  N+K+H+
Sbjct:  598 CHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          

HSP 2 Score: 76.2554 bits (186), Expect = 1.043e-15
Identity = 36/92 (39.13%), Postives = 55/92 (59.78%), Query Frame = 1
Query:  706 HTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +T   K H C  C + F +++ L+ H   H G KP  C++  C K F+   N++TH R+HTGE+P+ C    C+K F++  NL +H +THQK
Sbjct:  586 NTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 63.929 bits (154), Expect = 8.134e-12
Identity = 39/111 (35.14%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKH-LHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLT 972
            C + GC K F   S + +H L  H+  ++  C+ C K FV+ S L+RH   HS  KP +C +  C K  +    +K H   HT  + FICP   CN  F +   L++H L+
Sbjct:   51 CDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKHPQLRAHILS 157          

HSP 2 Score: 49.2914 bits (116), Expect = 3.862e-7
Identity = 31/92 (33.70%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  721 KSHICEV--CKKGFVESSKLKRHYL-VHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNL 987
            K++ C+   C K F   S L  H L VH G +  +C+   C K+F    +++ HL  H+  +PF C Y  C K       LK H +TH K+ 
Sbjct:   47 KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCD--KCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHTKSF 134          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Yeast
Match: CMR3 (Putative zinc finger protein; YPR013C is not an essential gene [Source:SGD;Acc:S000006217])

HSP 1 Score: 61.6178 bits (148), Expect = 2.693e-11
Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  733 CEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGER 897
            C VC K     S LK HYL+H+G  P KC +EGCTK+F++  NM  HL+ H  +R
Sbjct:  256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Yeast
Match: SWI5 (Transcription factor that recruits Mediator and Swi/Snf complexes; activates transcription of genes expressed at the M/G1 phase boundary and in G1 phase; required for expression of the HO gene controlling mating type switching; localization to nucleus occurs during G1 and appears to be regulated by phosphorylation by Cdc28p kinase; SWI5 has a paralog, ACE2, that arose from the whole genome duplication [Source:SGD;Acc:S000002553])

HSP 1 Score: 61.6178 bits (148), Expect = 5.439e-11
Identity = 25/66 (37.88%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  784 YLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            Y+     K  +C F GCTKTF   +N+++H++ H  +RP+ C +P C+KAF ++ +L  H+ +HQ+
Sbjct:  541 YVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQE 606          

HSP 2 Score: 47.3654 bits (111), Expect = 2.083e-6
Identity = 30/107 (28.04%), Postives = 41/107 (38.32%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHR 966
            C F GCTK FK +  +R H+ TH                              +P  C+  GC K F   H++  H + H  E+ + CP   C K F +   L  HR
Sbjct:  552 CLFPGCTKTFKRRYNIRSHIQTHLED---------------------------RPYSCDHPGCDKAFVRNHDLIRHKKSHQ-EKAYACP---CGKKFNREDALVVHR 627          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Nematostella
Match: EDO36763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHM9])

HSP 1 Score: 162.925 bits (411), Expect = 3.485e-50
Identity = 74/115 (64.35%), Postives = 89/115 (77.39%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            ++C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K 
Sbjct:    3 LACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDACNKRFAQSTNLKSHILTHAKG 117          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Nematostella
Match: EDO35311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLW8])

HSP 1 Score: 98.5969 bits (244), Expect = 5.651e-24
Identity = 47/113 (41.59%), Postives = 67/113 (59.29%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C+F  C K F     ++ H+ TH   K + C  E C K F  S  L++H   H+G +P KC +EGC ++F+  +  K H+R HTGERP+IC +P C +AFA +TN K+H   H
Sbjct:   92 CSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERPYICEHPGCGRAFASATNYKNHSRIH 204          

HSP 2 Score: 97.4413 bits (241), Expect = 1.604e-23
Identity = 47/112 (41.96%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C   GC K F    R++ H  +H   +  CE   C K F+  S L +H   HSG KP +CE +GC + ++  H++K H R HTGE+PF C +  C+KAFA    LKSH  TH
Sbjct:    3 CNIDGCGKQFSTAYRLKAHGRSHTGDTFRCEENGCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGEKPFKCSFEQCDKAFATGYGLKSHMRTH 114          

HSP 3 Score: 87.0409 bits (214), Expect = 7.029e-20
Identity = 47/109 (43.12%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  658 GCTKVFKDKSRMRKHLHTHKT-KSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            GC K F  +S + KH+ TH   K   CEV  C + +  +  LK H   H+G KP KC FE C K F+  + +K+H+R HTGE+P+ CP   C KAF  S +L+ H  TH
Sbjct:   36 GCDKSFITQSDLTKHVRTHSGEKPFRCEVDGCGRVYTTAHHLKVHERAHTGEKPFKCSFEQCDKAFATGYGLKSHMRTHTGEKPYKCPKETCAKAFKTSGDLQKHIRTH 144          

HSP 4 Score: 79.337 bits (194), Expect = 3.973e-17
Identity = 42/108 (38.89%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKTKSHI-C--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C K FK    ++KH+ TH  +    C  E C + F  S+  K H   H+G +P  CE  GC + F+   N K H RIHTGERP++C    CNK F + ++L  H + H
Sbjct:  127 CAKAFKTSGDLQKHIRTHTGERPFKCPYEGCGRSFTTSNIRKVHMRTHTGERPYICEHPGCGRAFASATNYKNHSRIHTGERPYVCQVIGCNKRFTEYSSLYKHHVVH 234          

HSP 5 Score: 62.003 bits (149), Expect = 4.366e-11
Identity = 34/112 (30.36%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLT 972
            C + GC + F   +  + H+ TH   + +ICE   C + F  ++  K H  +H+G +P  C+  GC K F+   ++  H  +HT  +P+ C    CNK + Q++ L +H+ T
Sbjct:  152 CPYEGCGRSFTTSNIRKVHMRTHTGERPYICEHPGCGRAFASATNYKNHSRIHTGERPYVCQVIGCNKRFTEYSSLYKHHVVHTHTKPYTC--NACNKTYRQTSTLANHKRT 261          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Nematostella
Match: EDO25873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDG9])

HSP 1 Score: 94.3597 bits (233), Expect = 1.430e-23
Identity = 47/109 (43.12%), Postives = 67/109 (61.47%), Query Frame = 1
Query:  658 GCTKVFKDKSRMRKHLHTHKT-KSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            GC KVF     +  HL +H   + H C V  C+K F ++SKLK H   H+G +P  C+ EGC  +F+  + +K H R HTGERPF+C +  C+K F +S++LK+H L H
Sbjct:   31 GCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKLFTRSSHLKTHVLVH 139          

HSP 2 Score: 73.9442 bits (180), Expect = 4.866e-16
Identity = 36/93 (38.71%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  643 SCTFIGCTKVFKDKSRMRKHLHTHKTKSHI-C--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICP 912
             C   GC K F   S+++ H+ +H  +    C  E C   F  + KLKRH   H+G +P  C +EGC K F+   ++KTH+ +HTGE+P++CP
Sbjct:   56 GCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKLFTRSSHLKTHVLVHTGEKPYVCP 148          

HSP 3 Score: 66.6254 bits (161), Expect = 1.693e-13
Identity = 33/80 (41.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  736 EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            E C K F     L  H   HSG +P  C  EGC K F+    +K H+R HTGERPF C    C  +F  +  LK H+  H
Sbjct:   30 EGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKH 109          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Nematostella
Match: EDO46628 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS8])

HSP 1 Score: 94.3597 bits (233), Expect = 1.558e-22
Identity = 49/120 (40.83%), Postives = 71/120 (59.17%), Query Frame = 1
Query:  625 LESSGISCTFIGCTKVFKDKSRMRKHLHTHKT-KSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            L+     C   GC KVF     +  HL +H   + H C V  C+K F ++SKLK H   H+G +P  C+ EGC  +F+  + +K H R HTGERPF+C +  C+K+F +S++LK+H L H
Sbjct:   84 LQDKPYKCEVEGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKSFTRSSHLKTHVLVH 203          

HSP 2 Score: 85.5001 bits (210), Expect = 2.719e-19
Identity = 45/116 (38.79%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQ 978
             SC   GC   F    ++++H   H   +  +C  E C K F  SS LK H LVH+G KP  C  +GC K F+   ++  HLR HTGE+P+ C   +CNKA+  + NL++H+  H+
Sbjct:  149 FSCDEEGCGWSFTSAYKLKRHKRKHTGERPFVCSWEGCHKSFTRSSHLKTHVLVHTGEKPYVCPADGCGKAFTAGSSLNIHLRKHTGEKPYRCEESSCNKAYTTAANLRAHQKRHE 264          

HSP 3 Score: 80.4925 bits (197), Expect = 1.500e-17
Identity = 48/130 (36.92%), Postives = 64/130 (49.23%), Query Frame = 1
Query:  598 NTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTH--KTKSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            N KT   +   ++ I+C + GC K F    ++R H   H  + K + CEV  C K F     L  H   HSG +P  C  EGC K F+    +K H+R HTGERPF C    C  +F  +  LK H+  H
Sbjct:   44 NLKTHIRAHRRTNSIACNYEGCDKAFPTLHKLRVHERKHELQDKPYKCEVEGCGKVFAAMGVLTSHLKSHSGERPHGCPVEGCEKRFTKASKLKLHIRSHTGERPFSCDEEGCGWSFTSAYKLKRHKRKH 173          

HSP 4 Score: 63.1586 bits (152), Expect = 1.912e-11
Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  736 EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQ 978
            E C+  F  + KLKRH   H+G +P  C  +GC + F+  +N+KTH+R H       C Y  C+KAF     L+ H   H+
Sbjct:    3 EGCEWAFTTAYKLKRHERGHTGERPFACPEKGCGRRFTTAYNLKTHIRAHRRTNSIACNYEGCDKAFPTLHKLRVHERKHE 83          

HSP 5 Score: 55.0694 bits (131), Expect = 9.954e-9
Identity = 23/52 (44.23%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  826 EGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            EGC   F+  + +K H R HTGERPF CP   C + F  + NLK+H   H++
Sbjct:    3 EGCEWAFTTAYKLKRHERGHTGERPFACPEKGCGRRFTTAYNLKTHIRAHRR 54          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Nematostella
Match: EDO45177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU02])

HSP 1 Score: 88.5817 bits (218), Expect = 2.108e-21
Identity = 46/122 (37.70%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  643 SCTFIGCTKVFKDKSRMRKHL---HTHKTKSHICEVC--------KKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            SC ++GC  V+ ++  + +H+   H  + K+    +C         K F    KL  H  VHSG KP KC   GC K FS + N+K H+R HTGE+P++C +P C KAF+ S++   H+ TH
Sbjct:    1 SCRWLGCDAVYSEQDDLVRHIEKVHIDQRKADDLYICYWQDCSRQTKPFNARYKLVIHMRVHSGEKPNKCTHPGCNKAFSRLENLKIHMRSHTGEKPYLCQFPGCPKAFSNSSDRAKHQRTH 122          

HSP 2 Score: 59.3066 bits (142), Expect = 6.131e-11
Identity = 34/103 (33.01%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  664 TKVFKDKSRMRKHLHTHKT-KSHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSH 963
            TK F  + ++  H+  H   K + C    C K F     LK H   H+G KP  C+F GC K FS   +   H R H   +P+ C  P C K +   ++L+ H
Sbjct:   46 TKPFNARYKLVIHMRVHSGEKPNKCTHPGCNKAFSRLENLKIHMRSHTGEKPYLCQFPGCPKAFSNSSDRAKHQRTHLDTKPYACQVPGCPKRYTDPSSLRKH 148          

HSP 3 Score: 45.0542 bits (105), Expect = 6.357e-6
Identity = 24/81 (29.63%), Postives = 39/81 (48.15%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLR 879
            CT  GC K F     ++ H+ +H   K ++C+   C K F  SS   +H   H   KP  C+  GC K ++   +++ H +
Sbjct:   70 CTHPGCNKAFSRLENLKIHMRSHTGEKPYLCQFPGCPKAFSNSSDRAKHQRTHLDTKPYACQVPGCPKRYTDPSSLRKHFK 150          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Medaka
Match: yy1a (transcriptional repressor protein YY1 [Source:NCBI gene;Acc:101173824])

HSP 1 Score: 172.555 bits (436), Expect = 1.329e-50
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  231 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 344          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Medaka
Match: YY1 (transcriptional repressor protein YY1 [Source:NCBI gene;Acc:101158814])

HSP 1 Score: 172.555 bits (436), Expect = 1.616e-50
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  242 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 355          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Medaka
Match: YY1 (transcriptional repressor protein YY1 [Source:NCBI gene;Acc:101158814])

HSP 1 Score: 172.94 bits (437), Expect = 2.188e-50
Identity = 75/114 (65.79%), Postives = 89/114 (78.07%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            I+C   GCTK+F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CP+  CNK FAQSTNLKSH LTH K
Sbjct:  260 IACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAK 373          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Medaka
Match: mtf1 (metal regulatory transcription factor 1 [Source:NCBI gene;Acc:101170051])

HSP 1 Score: 103.605 bits (257), Expect = 5.669e-24
Identity = 48/115 (41.74%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTKSHICEV--CKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            C   GC K F    R++ H   H  K+  CE   C K F   S L++H   H+G KP +C+ +GC K F+  H++KTH+R HTGE+PF CP   C K F+   +LKSH   H K 
Sbjct:  220 CDVQGCEKAFNTLYRLKAHQRLHTGKTFNCETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFNCPSDGCEKTFSSQYSLKSHIRGHDKG 334          

HSP 2 Score: 91.2781 bits (225), Expect = 9.459e-20
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKTK-SHIC--EVCKKGFVESSKLKRHYLVHSGRKPIKC-----------------------------EFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            CTF GC + +     +R H  TH+ + + +C  + C K F+ S  LK H  VH+  KP +C                             E EGCTK F+ + +++ H+R HTGE+PF C +  C KAFA S +LK+H  TH
Sbjct:  160 CTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTH 301          

HSP 3 Score: 73.559 bits (179), Expect = 5.817e-14
Identity = 38/89 (42.70%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  646 CTFIGCTKVFKDKSRMRKHLHTHKT-KSHICE--VCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPF 903
            C   GCTK F   S +RKH+ TH   K   C+   C K F  S  LK H   H+G KP  C  +GC KTFS  +++K+H+R H   +PF
Sbjct:  249 CETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGEKPFNCPSDGCEKTFSSQYSLKSHIRGHDKGQPF 337          

HSP 4 Score: 56.9954 bits (136), Expect = 1.355e-8
Identity = 25/56 (44.64%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  814 KCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            +C FEGC +T+S   N++TH + H GE  F+C    C KAF  S +LK H   H K
Sbjct:  159 QCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTK 214          
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Medaka
Match: znf384l (zinc finger protein 384 [Source:NCBI gene;Acc:101167968])

HSP 1 Score: 102.064 bits (253), Expect = 1.576e-23
Identity = 55/135 (40.74%), Postives = 77/135 (57.04%), Query Frame = 1
Query:  592 FSNTKTKSNSFLESSGI---SCTFIGCTKVFKDKSRMRKHLHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKN 984
            F+N+   S      SG    +CT+  C K F+  S +++H   H + K H C  C K F  SS L +H  +H+G KP  C F  C KTF  + +++ H RIHTG+RP+ C +P C KAF Q +NL+SHR  H K+
Sbjct:  283 FANSSYLSQHIRIHSGAKPYTCTY--CQKTFRQLSHLQQHTRNHTEAKPHKCPHCSKSFANSSYLSQHIRIHTGAKPYSCSF--CQKTFRQLSHLQQHTRIHTGDRPYKCSHPGCEKAFTQLSNLQSHRRQHNKD 413          

HSP 2 Score: 77.0258 bits (188), Expect = 3.925e-15
Identity = 36/106 (33.96%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C+K F + S + +H+  H   K + C  C+K F + S L++H  +H+G +P KC   GC K F+ + N+++H R H  ++P+ C   NCN+ +  + +L+ H  TH
Sbjct:  335 CSKSFANSSYLSQHIRIHTGAKPYSCSFCQKTFRQLSHLQQHTRIHTGDRPYKCSHPGCEKAFTQLSNLQSHRRQHNKDKPYKC--HNCNRGYTDAASLEVHLSTH 438          

HSP 3 Score: 73.1738 bits (178), Expect = 7.897e-14
Identity = 42/106 (39.62%), Postives = 57/106 (53.77%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C   F  KS M+ H  +H + K H C  C K F  SS L +H  +HSG KP  C +  C KTF  + +++ H R HT  +P  CP+  C+K+FA S+ L  H   H
Sbjct:  251 CAVTFFSKSDMQIHAKSHTEAKPHKCPHCSKSFANSSYLSQHIRIHSGAKPYTCTY--CQKTFRQLSHLQQHTRNHTEAKPHKCPH--CSKSFANSSYLSQHIRIH 352          
BLAST of Transcriptional repressor protein YY1 vs. Planmine SMEST
Match: SMESG000039253.1 (SMESG000039253.1)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 316/319 (99.06%), Postives = 316/319 (99.06%), Query Frame = 1
Query:   34 MLEMQKIFLDCEDSNITDPLNDKLMNLDFWNFYLKTRLKYSHSDLENTIDTNDSSFLVTFERHSLPKINDSINQDLDLKKFNIKTEPISIPPRVLQNISNSNYEFNLVNRQSIFGNSNKTIYRNHVLNVIKYEKNLSSNELENISFPXXXXXXXXXXXXXXETPELDVDFEDRSDDSLSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS 990
            M EMQKI LDCEDSNITDPLNDKLMNLDFWNFYLKTRLKYSHSDLENTIDTNDSSFLVTFERHSLPKINDSINQDLDLKKFNIKTEPISIPPRVLQNISNSNYEFNLVNRQSIFGNSNKTIYRNHVLNVI YEKNLSSNELENISFPNSSNTDTSSDNLLTETPELDVDFEDRSDDSLSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS
Sbjct:    1 MWEMQKIILDCEDSNITDPLNDKLMNLDFWNFYLKTRLKYSHSDLENTIDTNDSSFLVTFERHSLPKINDSINQDLDLKKFNIKTEPISIPPRVLQNISNSNYEFNLVNRQSIFGNSNKTIYRNHVLNVINYEKNLSSNELENISFPNSSNTDTSSDNLLTETPELDVDFEDRSDDSLSDFENQPKFSNTKTKSNSFLESSGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQKNLS 319          
BLAST of Transcriptional repressor protein YY1 vs. Planmine SMEST
Match: SMESG000057001.1 (SMESG000057001.1)

HSP 1 Score: 169.088 bits (427), Expect = 4.133e-48
Identity = 74/114 (64.91%), Postives = 88/114 (77.19%), Query Frame = 1
Query:  640 ISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQK 981
            + C   GC+K F+D S MRKHLHTH  + H+C  C K FVESSKLKRH LVH+G KP +C FEGC K FSL  N++TH+RIHTG+RP++CPY NCNK FAQSTNLKSH +TH K
Sbjct:  246 VPCPNKGCSKSFRDNSSMRKHLHTHGPRVHVCSECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGKKFSLDFNLRTHVRIHTGDRPYLCPYENCNKRFAQSTNLKSHIVTHAK 359          
BLAST of Transcriptional repressor protein YY1 vs. Planmine SMEST
Match: SMESG000053472.1 (SMESG000053472.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.531e-18
Identity = 49/111 (44.14%), Postives = 67/111 (60.36%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKH-LHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSH-RLTHQKN 984
            C++ F+ + R+R H LH H K + H C VC K F +SS L +H  VHSG +P KC +  C K F+    ++TH+R H+GE+PF C Y  C K+FA      SH R TH +N
Sbjct:  391 CSRSFEKRDRLRIHVLHVHEKHRPHKCTVCGKSFSQSSSLNKHLRVHSGERPYKCIY--CDKAFTASSILRTHIRQHSGEKPFKCKY--CWKSFASHAAHDSHVRRTHGQN 497          
BLAST of Transcriptional repressor protein YY1 vs. Planmine SMEST
Match: SMESG000053472.1 (SMESG000053472.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.555e-18
Identity = 49/111 (44.14%), Postives = 67/111 (60.36%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKH-LHTH-KTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSH-RLTHQKN 984
            C++ F+ + R+R H LH H K + H C VC K F +SS L +H  VHSG +P KC +  C K F+    ++TH+R H+GE+PF C Y  C K+FA      SH R TH +N
Sbjct:  386 CSRSFEKRDRLRIHVLHVHEKHRPHKCTVCGKSFSQSSSLNKHLRVHSGERPYKCIY--CDKAFTASSILRTHIRQHSGEKPFKCKY--CWKSFASHAAHDSHVRRTHGQN 492          
BLAST of Transcriptional repressor protein YY1 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.996e-18
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKHLHTHKT-KSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            C K+F   S ++ H  TH   +  +C+ C KGF + + L++H LVH+G KP +C    C+K FS   N+KTH+R+H GE+PF C +  C   F Q  +L+ H   H
Sbjct:  392 CKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSV--CSKRFSSTSNLKTHMRLHRGEKPFKCEF--CKTKFTQLVHLQLHLRLH 493          

HSP 2 Score: 84.7297 bits (208), Expect = 7.418e-18
Identity = 44/103 (42.72%), Postives = 62/103 (60.19%), Query Frame = 1
Query:  661 CTKVFKDKSRMRKH--LHTHKTKSHICEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSH 963
            C K F   + ++KH  +HT + K H C VC K F  +S LK H  +H G KP KCEF  C   F+ + +++ HLR+HT ERPFIC  P CNK +   + +++H
Sbjct:  420 CGKGFTQLAHLQKHNLVHTGE-KPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEF--CKTKFTQLVHLQLHLRLHTNERPFIC--PRCNKCYISISGIRTH 517          

HSP 3 Score: 63.929 bits (154), Expect = 5.045e-11
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  733 CEVCKKGFVESSKLKRHYLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTHQ 978
            C VCKK F + S LK H   H+G +P  C  + C K F+ + +++ H  +HTGE+P  C    C+K F+ ++NLK+H   H+
Sbjct:  389 CSVCKKIFGQLSNLKVHQRTHTGERPFVC--QTCGKGFTQLAHLQKHNLVHTGEKPHECSV--CSKRFSSTSNLKTHMRLHR 466          

HSP 4 Score: 55.8398 bits (133), Expect = 2.231e-8
Identity = 30/82 (36.59%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  745 KKGFVESSKLKRHYLVHS-----GRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKAFAQSTNLKSHRLTH 975
            KK    + K+  H+L ++     G+    C    C K F  + N+K H R HTGERPF+C    C K F Q  +L+ H L H
Sbjct:  360 KKQIFSNEKINGHHLSYTLIKTDGKSKYNCSV--CKKIFGQLSNLKVHQRTHTGERPFVC--QTCGKGFTQLAHLQKHNLVH 437          
The following BLAST results are available for this feature:
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YY11.241e-4965.79YY1 transcription factor [Source:HGNC Symbol;Acc:H... [more]
YY22.713e-4853.24YY2 transcription factor [Source:HGNC Symbol;Acc:H... [more]
ZFP424.948e-4351.45ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZFP424.948e-4351.45ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
ZFP424.948e-4351.45ZFP42 zinc finger protein [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ref-29.446e-2134.35REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-21.091e-2034.35REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-21.091e-2034.35REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
F47E1.34.389e-1943.52pep chromosome:WBcel235:X:9046213:9054885:1 gene:W... [more]
blmp-19.383e-1837.74B lymphocyte-induced maturation protein 1 homolog ... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pho3.019e-4862.81gene:FBgn0002521 transcript:FBtr0089204[more]
pho3.019e-4862.81gene:FBgn0002521 transcript:FBtr0089205[more]
phol3.478e-4564.29gene:FBgn0035997 transcript:FBtr0345600[more]
phol3.478e-4564.29gene:FBgn0035997 transcript:FBtr0076475[more]
MTF-12.014e-2542.11gene:FBgn0040305 transcript:FBtr0344236[more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1a2.697e-5065.79YY1 transcription factor a [Source:ZFIN;Acc:ZDB-GE... [more]
yy1b1.072e-4964.91YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GE... [more]
mtf11.645e-2443.59metal-regulatory transcription factor 1 [Source:ZF... [more]
mtf11.739e-2443.59metal-regulatory transcription factor 1 [Source:ZF... [more]
mtf11.986e-2443.59metal-regulatory transcription factor 1 [Source:ZF... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn13.806e-5065.79hyperpolarization activated cyclic nucleotide gate... [more]
fam83h1.191e-2240.87family with sequence similarity 83 member H [Sourc... [more]
fam83h1.426e-2240.87family with sequence similarity 83 member H [Sourc... [more]
znf1431.520e-2241.59zinc finger protein 143 [Source:NCBI gene;Acc:5950... [more]
znf1431.656e-2241.59zinc finger protein 143 [Source:NCBI gene;Acc:5950... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Yy11.157e-4965.79YY1 transcription factor [Source:MGI Symbol;Acc:MG... [more]
Mbtps21.590e-4956.43membrane-bound transcription factor peptidase, sit... [more]
Yy21.590e-4956.43Yy2 transcription factor [Source:MGI Symbol;Acc:MG... [more]
Zfp422.084e-4055.17zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp422.084e-4055.17zinc finger protein 42 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C6P6|TYY2_RAT5.868e-4956.43Transcription factor YY2 OS=Rattus norvegicus OX=1... [more]
sp|P25490|TYY1_HUMAN5.961e-4965.79Transcriptional repressor protein YY1 OS=Homo sapi... [more]
sp|Q2FAY8|TYY2_RATRT6.058e-4956.43Transcription factor YY2 OS=Rattus rattus OX=10117... [more]
sp|Q00899|TYY1_MOUSE8.090e-4965.79Transcriptional repressor protein YY1 OS=Mus muscu... [more]
sp|Q3TTC2|TYY2_MOUSE1.112e-4856.43Transcription factor YY2 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J6BTA51.195e-12464.83Transcriptional repressor protein YY1 OS=Dugesia j... [more]
A0A1D2MY966.781e-4958.45Transcriptional repressor protein YY1 OS=Orchesell... [more]
T1IWV81.136e-4858.27Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A087U7R71.383e-4858.99Transcriptional repressor protein YY1 (Fragment) O... [more]
A0A1B6C7T22.071e-4852.66Uncharacterized protein (Fragment) OS=Clastoptera ... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1a2.062e-5057.86transcriptional repressor protein YY1-like [Source... [more]
yy1b2.805e-5065.79YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GE... [more]
mtf13.201e-2443.48metal regulatory transcription factor 1 [Source:NC... [more]
znf143a7.433e-2341.59zinc finger protein 143a [Source:ZFIN;Acc:ZDB-GENE... [more]
znf384l1.016e-2242.61zinc finger protein 384 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1b3.405e-4964.04YY1 transcription factor b [Source:ZFIN;Acc:ZDB-GE... [more]
znf143b4.225e-2643.52zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
znf143b6.328e-2643.52zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
mtf11.358e-2340.34metal-regulatory transcription factor 1 [Source:ZF... [more]
ENSPMAT00000003937.18.906e-2040.74pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gen... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP14.085e-1838.46Zinc-regulated transcription factor; binds to zinc... [more]
AZF16.730e-1734.95Zinc-finger transcription factor; involved in diau... [more]
PZF18.134e-1235.14Transcription factor IIIA (TFIIIA); essential DNA ... [more]
CMR32.693e-1149.09Putative zinc finger protein; YPR013C is not an es... [more]
SWI55.439e-1137.88Transcription factor that recruits Mediator and Sw... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367633.485e-5064.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353115.651e-2441.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258731.430e-2343.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466281.558e-2240.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451772.108e-2137.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yy1a1.329e-5065.79transcriptional repressor protein YY1 [Source:NCBI... [more]
YY11.616e-5065.79transcriptional repressor protein YY1 [Source:NCBI... [more]
YY12.188e-5065.79transcriptional repressor protein YY1 [Source:NCBI... [more]
mtf15.669e-2441.74metal regulatory transcription factor 1 [Source:NC... [more]
znf384l1.576e-2340.74zinc finger protein 384 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Transcriptional repressor protein YY1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039253.10.000e+099.06SMESG000039253.1[more]
SMESG000057001.14.133e-4864.91SMESG000057001.1[more]
SMESG000053472.11.531e-1844.14SMESG000053472.1[more]
SMESG000053472.11.555e-1844.14SMESG000053472.1[more]
SMESG000005754.13.996e-1839.62SMESG000005754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018775 ID=SMED30018775|Name=Transcriptional repressor protein YY1|organism=Schmidtea mediterranea sexual|type=transcript|length=1020bp
CTTTTTTTATCGGTTTTAATACAAAATTAATCAATGTTGGAAATGCAAAA
AATATTTCTAGATTGTGAAGATTCTAACATTACTGATCCTCTCAATGATA
AACTTATGAATTTAGATTTTTGGAATTTTTATCTCAAAACCCGTCTTAAA
TATTCTCATTCTGACCTGGAAAATACTATTGATACAAATGACTCGAGTTT
TCTTGTTACTTTTGAAAGACATTCTTTGCCAAAAATTAATGATTCGATTA
ACCAAGACTTAGATTTGAAAAAGTTTAATATTAAAACTGAACCTATTTCG
ATTCCGCCAAGAGTTCTGCAAAATATTTCCAATTCGAATTATGAATTTAA
TTTAGTAAATCGTCAATCTATCTTTGGAAATTCTAATAAAACAATTTATC
GAAATCATGTACTCAATGTAATAAAGTATGAAAAAAATCTCAGTAGCAAT
GAATTAGAAAATATTTCCTTTCCTAATTCGTCGAATACCGATACATCGTC
AGATAATCTTTTAACCGAAACCCCAGAACTTGATGTAGATTTTGAAGACA
GAAGTGATGATTCATTATCAGATTTTGAAAATCAGCCAAAATTCAGTAAT
ACAAAAACTAAATCAAATAGCTTTTTGGAAAGTAGTGGAATTTCTTGTAC
TTTTATTGGATGCACCAAAGTATTTAAAGATAAATCAAGAATGAGAAAGC
ATTTGCACACTCATAAAACTAAAAGTCATATATGTGAAGTTTGTAAAAAA
GGATTTGTTGAAAGTAGTAAACTCAAACGTCACTATTTAGTTCACTCCGG
GAGAAAACCGATTAAATGTGAATTTGAGGGCTGCACTAAAACCTTTTCAT
TAATTCATAATATGAAAACACATCTCAGAATTCATACGGGTGAAAGGCCT
TTCATTTGTCCATATCCAAACTGCAATAAAGCTTTTGCTCAGTCAACAAA
TTTAAAATCTCACAGATTGACCCATCAGAAAAATTTGAGTTGAAAATATT
TCTAGATTCCTAAAACAGCC
back to top

protein sequence of SMED30018775-orf-1

>SMED30018775-orf-1 ID=SMED30018775-orf-1|Name=SMED30018775-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MLEMQKIFLDCEDSNITDPLNDKLMNLDFWNFYLKTRLKYSHSDLENTID
TNDSSFLVTFERHSLPKINDSINQDLDLKKFNIKTEPISIPPRVLQNISN
SNYEFNLVNRQSIFGNSNKTIYRNHVLNVIKYEKNLSSNELENISFPNSS
NTDTSSDNLLTETPELDVDFEDRSDDSLSDFENQPKFSNTKTKSNSFLES
SGISCTFIGCTKVFKDKSRMRKHLHTHKTKSHICEVCKKGFVESSKLKRH
YLVHSGRKPIKCEFEGCTKTFSLIHNMKTHLRIHTGERPFICPYPNCNKA
FAQSTNLKSHRLTHQKNLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0042826histone deacetylase binding
GO:0043565sequence-specific DNA binding
GO:0044212transcription regulatory region DNA binding
GO:0046332SMAD binding
GO:0000400four-way junction DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0001158enhancer sequence-specific DNA binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003723RNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0031011Ino80 complex
GO:0031519PcG protein complex
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0016363nuclear matrix
Vocabulary: biological process
TermDefinition
GO:0034644cellular response to UV
GO:0034696response to prostaglandin F
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048593camera-type eye morphogenesis
GO:0051276chromosome organization
GO:0071347cellular response to interleukin-1
GO:1902894negative regulation of pri-miRNA transcription from RNA polymerase II promoter
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0000724double-strand break repair via homologous recombination
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006403RNA localization
GO:0006974cellular response to DNA damage stimulus
GO:0007283spermatogenesis
GO:0009952anterior/posterior pattern specification
GO:0010225response to UV-C
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0030154cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 260..284
e-value: 0.013
score: 24.6
coord: 290..314
e-value: 0.0029
score: 26.8
coord: 232..254
e-value: 0.043
score: 22.9
coord: 203..227
e-value: 0.0076
score: 25.5
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 232..254
e-value: 0.011
score: 16.2
coord: 290..314
e-value: 3.0E-4
score: 21.1
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 292..314
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 234..254
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 205..227
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 262..284
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 232..259
score: 13.838
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 203..232
score: 9.39
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 260..289
score: 14.066
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 290..319
score: 11.053
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 203..228
e-value: 7.1E-6
score: 27.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 286..319
e-value: 2.9E-12
score: 48.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 259..285
e-value: 1.8E-11
score: 45.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 230..258
e-value: 5.6E-9
score: 37.7
NoneNo IPR availablePANTHERPTHR14003TRANSCRIPTIONAL REPRESSOR PROTEIN YYcoord: 180..315
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 241..294
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 203..227
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 284..316