Voltage gated potassium channel

Overview
NameVoltage gated potassium channel
Smed IDSMED30018771
Length (bp)2096
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018771

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30018771SMESG000075712.1 Contig2781_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNB1 (potassium voltage-gated channel subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:6231])

HSP 1 Score: 130.568 bits (327), Expect = 1.052e-30
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNB1 (potassium voltage-gated channel subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:6231])

HSP 1 Score: 130.568 bits (327), Expect = 1.052e-30
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNB2 (potassium voltage-gated channel subfamily B member 2 [Source:HGNC Symbol;Acc:HGNC:6232])

HSP 1 Score: 125.561 bits (314), Expect = 5.160e-29
Identity = 128/447 (28.64%), Postives = 210/447 (46.98%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLG-------TSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            R  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + E +L             FFDR P  F  +LNFYRTG+LH     C   F +EL++WGI+E ++E CC ++Y   K   N  L++ +E+  +      + T     +  L+      + ++ ++  +I++   I+ + + + L        T  FG+++  RQ                       L  VE     +F  + +LR   SPN++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KF +I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:   11 RKTSRSTLSLPPEPVDIIRSKTCSR--RVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQETDEFGQLNDNRQ-----------------------LAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 428          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCND1 (potassium voltage-gated channel subfamily D member 1 [Source:HGNC Symbol;Acc:HGNC:6237])

HSP 1 Score: 113.235 bits (282), Expect = 2.136e-25
Identity = 115/429 (26.81%), Postives = 187/429 (43.59%), Query Frame = 1
Query:  595 LPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIE-----KSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNA-TAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRI-------DLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNE---AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            LPP P      K     E +   V G +F+++  T+   P++ L +   E      SGE   FFDRDPD F +VLNFYRTGRLH P   C+  F+EEL F+G+  E +  CC  +Y   K      ++ +E +E     +  A  A    +  L+ AF     +  +  +           +   F+  S    +          R+  RE    E     F           ++ A    F  + +LR F +P+R  F    ++          +     Y  +    N+      + L++ R+FR+FK + +   G+  +  T+++   +L  +   + + I  F  ++F  E   +    + F +I    W+ IVTM T+GYGD +P T  G + G IC L G+++  LPVP+ + NFS  Y+Q Q
Sbjct:   27 LPPAPGV----KASRGDEVLVVNVSGRRFETWKNTLDRYPDTLLGSSEKEFFYDADSGEY--FFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRKK--ENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPHTSTAALVF---------YYVTGFFIAVSVIANVVETIPCRGSARRSSREQPCGERFPQAF---------FCMDTACVLIFTGEYLLRLFAAPSRCRFLRSVMSL------IDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVFRIFKFSRH-SQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAE---KGTNKTNFTSIPAAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQ 419          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNS2 (potassium voltage-gated channel modifier subfamily S member 2 [Source:HGNC Symbol;Acc:HGNC:6301])

HSP 1 Score: 106.301 bits (264), Expect = 1.358e-23
Identity = 119/420 (28.33%), Postives = 206/420 (49.05%), Query Frame = 1
Query:  664 VGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSN--------KNATAFE-----KWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX---XXXXXXXXYSEMATGFNEAYVI-ILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            VGG + +    T++  P ++L   ++  S E IL             +FDR+P+ F YVL+FY TG+LH  +  C+  F +E+E+WGINE F++ CC   Y   KV     K   +S ++   S+         +A+ F+      ++  L+LA      +++S+ +SI++   ++ +I+ M L +              +    +S  N  ED        IVE     +F  +++ R  ++P+   FF + +N ID+++      +L+  L+     T  N   V  +L++ RIFR+ KL A   +G+ ++  T++ S  ++ L+ L + + IS F V+ + I    E +E     TI    WWA V+M TVGYGD +P T  G +    CIL GI++  LP+ +    FS +Y + +
Sbjct:   23 VGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSILVVMGSIITMCLNS------------LPDFQIPDSQGNPGEDP----RFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLMRIFRILKL-ARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTI----EKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQK 421          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 140.198 bits (352), Expect = 3.586e-35
Identity = 134/427 (31.38%), Postives = 217/427 (50.82%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSG-ELIL---FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCV----------------YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNE-SILNYFEDTGILYE---------LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            R+   VGG + +++  T+  IP ++L+      +  + +L   FFDR P  F  +LN+YRTG+LH P + C   FEEEL++WG++    EPCC+      +   + LK   E   +                  Y N + +A++K K  ++  F   + +  +Q+ + I+   +I AI++  L T    RI  +   F    +N  S  +      I  +          + +E     +F  +I+ R    P+RF +    +N IDI+AT +  I  L     AT   E + II    RI RLFKLT +  SG+  ++ T RAS  +L+L+   +V+ +  F  L++  E V E +E ++F +I IG+WWAIVTM T+GYGD  P T  G ++G IC L G++   LPVP+ + NF+++Y+  Q+R
Sbjct:   24 RIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIP-ELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATADLEFFSII----RIMRLFKLTHH-NSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERV-ESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQAR 443          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 139.813 bits (351), Expect = 3.821e-35
Identity = 134/427 (31.38%), Postives = 217/427 (50.82%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSG-ELIL---FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCV----------------YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNE-SILNYFEDTGILYE---------LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            R+   VGG + +++  T+  IP ++L+      +  + +L   FFDR P  F  +LN+YRTG+LH P + C   FEEEL++WG++    EPCC+      +   + LK   E   +                  Y N + +A++K K  ++  F   + +  +Q+ + I+   +I AI++  L T    RI  +   F    +N  S  +      I  +          + +E     +F  +I+ R    P+RF +    +N IDI+AT +  I  L     AT   E + II    RI RLFKLT +  SG+  ++ T RAS  +L+L+   +V+ +  F  L++  E V E +E ++F +I IG+WWAIVTM T+GYGD  P T  G ++G IC L G++   LPVP+ + NF+++Y+  Q+R
Sbjct:    6 RIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIP-ELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATADLEFFSII----RIMRLFKLTHH-NSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERV-ESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQAR 425          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 140.198 bits (352), Expect = 3.986e-35
Identity = 134/427 (31.38%), Postives = 217/427 (50.82%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSG-ELIL---FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCV----------------YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNE-SILNYFEDTGILYE---------LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            R+   VGG + +++  T+  IP ++L+      +  + +L   FFDR P  F  +LN+YRTG+LH P + C   FEEEL++WG++    EPCC+      +   + LK   E   +                  Y N + +A++K K  ++  F   + +  +Q+ + I+   +I AI++  L T    RI  +   F    +N  S  +      I  +          + +E     +F  +I+ R    P+RF +    +N IDI+AT +  I  L     AT   E + II    RI RLFKLT +  SG+  ++ T RAS  +L+L+   +V+ +  F  L++  E V E +E ++F +I IG+WWAIVTM T+GYGD  P T  G ++G IC L G++   LPVP+ + NF+++Y+  Q+R
Sbjct:   27 RIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIP-ELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATADLEFFSII----RIMRLFKLTHH-NSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERV-ESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQAR 446          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shl-1 (SHaL family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q95XD1])

HSP 1 Score: 110.153 bits (274), Expect = 5.774e-25
Identity = 107/412 (25.97%), Postives = 190/412 (46.12%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATC-----VIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFE-KWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFED-----TGILYE--LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNE---AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            E++   + G +F+++  T+   P + L +        E +GE   FFDRDPD F ++L FYRTG+LH P + CL  ++EEL F+GI  + +  CCY  Y   K      ++  E  ++    N + +  +   K  ++ AF     T I+  +           ++  F+  S    I             E+I   +ED      G  YE    +++ A    F  +  LR   +P+R  F    ++          +     Y  +    N+      + L++ R+FR+FK + +   G+  +  T+++   +L  +   + + I  F  +++  E   ++D  ++F +I    W+ IVT+ T+GYGD +P T  G +VG +C L G+++  LPVP+ + NFS  Y+Q Q
Sbjct:   46 EKLAINISGRRFETWKNTLEKFPETLLGSNEKEFFYDEDTGEY--FFDRDPDIFRHILTFYRTGKLHYPRHECLVAYDEELSFFGIMPDLISDCCYEDYKDKK------RENQERLQEERVENADISTLKLSLKEKMWAAFENPHTTSIALVF---------YYVIGFFIAVSVMCNI------------VETIPCGYEDNVSVTCGEAYEEQFFVIDTACVIIFTIEYFLRLISAPDRIKFMRSIMS------VIDVIAIMPYYVSLVLTDNKDVSGLFVTLRVFRVFRIFKFSRH-SQGLRILGYTLKSCASELGFLVFSLAMAIIIFATIMYYAE--KKVD-ATRFTSIPSAFWYTIVTLTTLGYGDMVPSTIMGKIVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQ 418          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 90.8929 bits (224), Expect = 9.117e-19
Identity = 42/108 (38.89%), Postives = 65/108 (60.19%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSG-ELIL---FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTL 957
             RV   VGG + +++   +  IP ++L+      +  + +L   FFDR P  F+ +LN+YRTG+LH P+N C   FEEELEFWG++   +EPCC+  Y  ++   +TL
Sbjct:  101 HRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTL 208          

HSP 2 Score: 73.1738 bits (178), Expect = 2.894e-13
Identity = 49/127 (38.58%), Postives = 85/127 (66.93%), Query Frame = 1
Query: 1459 IFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            + RLFKLT +  SG+  +I T +AS  +L L+   V++ I  F  L++  E  +++++ ++F +I +G+WW++VT++TVG+GD +P T  G +VG +C L G++   LPVP+ + NFS  Y+ +Q+R
Sbjct:  400 VLRLFKLTQHF-SGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAER-SQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQAR 524          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305207)

HSP 1 Score: 105.145 bits (261), Expect = 4.840e-23
Identity = 116/440 (26.36%), Postives = 203/440 (46.14%), Query Frame = 1
Query:  598 PPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES---KEKCVYSNKNATAFEKWKTHLY----LAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLK-----SGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            PP P  I + K      RV+  VGG + +    T+  +P+++L       + E I+             FFDR P  F+ +LNFYRTG+LH     C+  F ++LE+WG++E ++E CC  +Y   K   +  ++K +ES   +++  +       ++K+   L      +F      +IS  +              + L T A             L + + I N          ++  E     +F  + ILR   SP+++ FF   +N ID+LA     +S  L  E      + +  + ++ ++FR+ ++   LK     +G+ ++  T+R S  +L L+ L + + +  F  L +  E   + ++ +KF +I    WWA +TM TVGYGD  P T  G V+G +C + G+++  LP+PI + NF+ +Y     R
Sbjct:  293 PPEPFMIAQSKAVNS--RVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILF--------------IVLSTIAL--------TLNTLPQLQHIDNGTPQDNPQLAMV--EAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLL-ETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAE---KDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRR 702          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305203)

HSP 1 Score: 104.76 bits (260), Expect = 9.405e-23
Identity = 116/440 (26.36%), Postives = 203/440 (46.14%), Query Frame = 1
Query:  598 PPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES---KEKCVYSNKNATAFEKWKTHLY----LAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLK-----SGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            PP P  I + K      RV+  VGG + +    T+  +P+++L       + E I+             FFDR P  F+ +LNFYRTG+LH     C+  F ++LE+WG++E ++E CC  +Y   K   +  ++K +ES   +++  +       ++K+   L      +F      +IS  +              + L T A             L + + I N          ++  E     +F  + ILR   SP+++ FF   +N ID+LA     +S  L  E      + +  + ++ ++FR+ ++   LK     +G+ ++  T+R S  +L L+ L + + +  F  L +  E   + ++ +KF +I    WWA +TM TVGYGD  P T  G V+G +C + G+++  LP+PI + NF+ +Y     R
Sbjct:  293 PPEPFMIAQSKAVNS--RVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILF--------------IVLSTIAL--------TLNTLPQLQHIDNGTPQDNPQLAMV--EAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLL-ETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAE---KDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRR 702          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shawl (gene:FBgn0085395 transcript:FBtr0332598)

HSP 1 Score: 93.5893 bits (231), Expect = 2.111e-19
Identity = 79/196 (40.31%), Postives = 113/196 (57.65%), Query Frame = 1
Query: 1255 VELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEP-SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            VEL    +F  ++I+R  +SPN + F    +N ID  AT S     +      TG  EA+ I+    RI RLFKLT +   G+  +I T +AS  +L L+   +V+ I FF  L +  E +   D P ++FK+I +G+WWAIVTM TVGYGD  P T  G  VG +C L G++   LPVP+ + NFS++Y+  Q+R
Sbjct:  320 VELVCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTDVMQRMGEYTGLLEAFSIV----RIMRLFKLTRH-SPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQ--DNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQAR 508          

HSP 2 Score: 90.1225 bits (222), Expect = 3.058e-18
Identity = 42/107 (39.25%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLA--TCVIEKSGELI--LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTL 957
            R+   V G +++++  T+  IP ++L+  T  +     ++   FFDR P  F  +LN+YRTG+LH P++ C   FEEELEFWG++   +EPCC+S Y  ++   NTL
Sbjct:    6 RIILNVSGIRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFTQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTL 112          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shawl (gene:FBgn0085395 transcript:FBtr0308029)

HSP 1 Score: 93.5893 bits (231), Expect = 2.762e-19
Identity = 79/196 (40.31%), Postives = 113/196 (57.65%), Query Frame = 1
Query: 1255 VELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEP-SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            VEL    +F  ++I+R  +SPN + F    +N ID  AT S     +      TG  EA+ I+    RI RLFKLT +   G+  +I T +AS  +L L+   +V+ I FF  L +  E +   D P ++FK+I +G+WWAIVTM TVGYGD  P T  G  VG +C L G++   LPVP+ + NFS++Y+  Q+R
Sbjct:  320 VELVCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTDVMQRMGEYTGLLEAFSIV----RIMRLFKLTRH-SPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQ--DNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQAR 508          

HSP 2 Score: 90.1225 bits (222), Expect = 3.150e-18
Identity = 42/107 (39.25%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLA--TCVIEKSGELI--LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTL 957
            R+   V G +++++  T+  IP ++L+  T  +     ++   FFDR P  F  +LN+YRTG+LH P++ C   FEEELEFWG++   +EPCC+S Y  ++   NTL
Sbjct:    6 RIILNVSGIRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFTQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTL 112          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 88.5817 bits (218), Expect = 5.095e-18
Identity = 43/107 (40.19%), Postives = 64/107 (59.81%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLA--TCVIEKSGELI--LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTL 957
            RV   VGG + +++  T+  IP ++L+  T  +     ++   FFDR P  F  VLN+YRTG+LH P++ C   FEEELEFWG++   +EPCC+  Y  ++    TL
Sbjct:   11 RVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETL 117          

HSP 2 Score: 85.5001 bits (210), Expect = 4.518e-17
Identity = 71/196 (36.22%), Postives = 110/196 (56.12%), Query Frame = 1
Query: 1255 VELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVI-ILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            +E     +F  +I++R   SPN++ F   ++N I     T S    L+    A+    A ++    I RI RLFKLT +  SG+  +I T RAS  +L L+   +V+ I  F  L++  E + + +  + F +I +G+WWA+VTM TVGYGD  P T  G  VG +C L G++   LPVP+ + NF++YY+  Q+R
Sbjct:  234 IECVCNAWFTFEILVRFISSPNKWEFIKSSVN-IIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRH-SSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERI-QPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQAR 426          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 153.68 bits (387), Expect = 3.526e-39
Identity = 133/441 (30.16%), Postives = 216/441 (48.98%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESK--------------EKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYE--LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEI-DEPSK-----FKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ERV   VGGT+ +++  T+  +P ++LA    E   EL+L                   FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F  +               E  V ++   + + +W+  ++  F     +  +++ +  +   I+ +I    L T  AF  I  K    R    NE++ +  +   I  +  L  VE     +F  + ++R   SP++  F    +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +    ++P+      FK I IG WWA+VTM T+GYGD  P T  G VVG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 ERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNTIINKTDPLR----NETLTDISQQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 154.066 bits (388), Expect = 4.315e-39
Identity = 133/441 (30.16%), Postives = 216/441 (48.98%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESK--------------EKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYE--LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEI-DEPSK-----FKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ERV   VGGT+ +++  T+  +P ++LA    E   EL+L                   FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F  +               E  V ++   + + +W+  ++  F     +  +++ +  +   I+ +I    L T  AF  I  K    R    NE++ +  +   I  +  L  VE     +F  + ++R   SP++  F    +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +    ++P+      FK I IG WWA+VTM T+GYGD  P T  G VVG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 ERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNTIINKTDPLR----NETLTDISQQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFV-GLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1b (potassium voltage-gated channel, Shaw-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-080414-3])

HSP 1 Score: 152.525 bits (384), Expect = 1.423e-38
Identity = 125/445 (28.09%), Postives = 214/445 (48.09%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKS----------GELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------------------SESKEKCVYSNKNATA---------FEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWX--XXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELV----NEIDEPS--KFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            +R+   VGG + Q++  T+  +P ++L+      +          GE   FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                    +E  E    + + A           + +W+   +  F     +  ++W +  +   I+ +I    L T  AF  I  + + + E   NE++   F +T  + +L  +E     +F  + I+R    P++  F  +T+N I    +      +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ +L+ + + + +  F  +I+  E +    N+ D  S   FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 DRIVINVGGIKHQTYRSTLRTLPGTRLSWLAEPDAPNNFDYDANIGEF--FFDRHPSVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFTGGALDLGHDDPEPEGVVEAAEGDEGVEMTRRLAQGDSPDNRSGRWSRWQKKAWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTETYME--GNETVERIFPETETMVQLTYIEGVCVVWFTFEFIIRVTTCPDKLKFLRNTLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGRNPNDPDASSDTHFKNIPIGFWWAVVTMTTLGYGDMYPQTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 447          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1b (potassium voltage-gated channel, Shaw-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-080414-3])

HSP 1 Score: 152.525 bits (384), Expect = 1.423e-38
Identity = 125/445 (28.09%), Postives = 214/445 (48.09%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKS----------GELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------------------SESKEKCVYSNKNATA---------FEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWX--XXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELV----NEIDEPS--KFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            +R+   VGG + Q++  T+  +P ++L+      +          GE   FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                    +E  E    + + A           + +W+   +  F     +  ++W +  +   I+ +I    L T  AF  I  + + + E   NE++   F +T  + +L  +E     +F  + I+R    P++  F  +T+N I    +      +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ +L+ + + + +  F  +I+  E +    N+ D  S   FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 DRIVINVGGIKHQTYRSTLRTLPGTRLSWLAEPDAPNNFDYDANIGEF--FFDRHPSVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFTGGALDLGHDDPEPEGVVEAAEGDEGVEMTRRLAQGDSPDNRSGRWSRWQKKAWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINRTETYME--GNETVERIFPETETMVQLTYIEGVCVVWFTFEFIIRVTTCPDKLKFLRNTLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGRNPNDPDASSDTHFKNIPIGFWWAVVTMTTLGYGDMYPQTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 447          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 144.821 bits (364), Expect = 4.638e-36
Identity = 127/442 (28.73%), Postives = 212/442 (47.96%), Query Frame = 1
Query:  637 EKLERVTFIVGGTQFQSFIETIVHIPNSKLA--------------TCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNA--------------TAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILY------ELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNE--AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN-EIDEPS-----KFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            E  +++   VGGT+ +++  T+  IP S+LA              T     + E   FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F     +    +++                  E W+  ++  F           YS   AA +IA + + F+  S         + F E + +    +    T I+        L +VE     +F  + ++R    PN+ +F  + +N ID +A     +   L    +    +   ++ +++  RI R+FKLT +   G+  +  T+RAS ++  L+ + + + +  F  +I+  E ++ + D+PS      FK I IG WWA+VTM T+GYGD +P T  G +VG +C + G++   +PVP+ + NF +YY+ A +
Sbjct:   33 EDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEF--FFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQPKIWALF--------EDPYS-SRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHTDTKSATNSTTIIQVMDTKPVLTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 145.591 bits (366), Expect = 3.885e-36
Identity = 130/448 (29.02%), Postives = 207/448 (46.21%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL------------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEK-WKTHLYLAFVVGDKTIISQW--------------YSXXXXXXXXXXXXXMFLGT---------SAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWX--XXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN-EIDEPS-----KFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            ER+   VGGT+ +++  T+  +P ++LA    E   E  L                  FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F E+ +           +E+     L +  VV     + +W              YS   A  I  A +   L +          AF  I  K +      +  S++    D  + Y    VE     +F  + ++R    P++  F  + +N I    +      +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +     +PS     +FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 ERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIF-ETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTIINKTETVNNGTELISLIEIETDPALTY----VEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 449          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 145.206 bits (365), Expect = 4.646e-36
Identity = 127/447 (28.41%), Postives = 210/447 (46.98%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL------------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSE----------------------SKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEI-DEPS-----KFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            ER+   VGGT+ +++  T+  +P ++LA    E   E  L                  FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F                        + E  V  +     + + +  ++  F     +  +++ +  +   I+ +I    L T  AF  I  K +      +  S++    D  + Y    VE     +F  + ++R    P++  F  + +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +     +PS     +FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 ERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTIINKTETVNNGTELISLIEIETDPALTY----VEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 449          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 136.732 bits (343), Expect = 3.332e-33
Identity = 123/435 (28.28%), Postives = 213/435 (48.97%), Query Frame = 1
Query:  637 EKLERVTFIVGGTQFQSFIETIVHIPNSKLATCV----------IEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF-----------SESKEKCVYSNKNATAFEKWK---THLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGT-SAFGRIDLKRQKFRE--LYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEI------DEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            E  +++   VGG + +++  T+  +P ++L+               K+ E   FFDR P  F YVLN+YRTG+LH P++ C   +EEEL FWGI+E  +E CC+  Y  ++ A   L  F            + K  C+   ++     +WK     ++  F     +  +++ +  +   I+ +I    L T  AF  ++ K + F +  + + E+IL    +  + Y    VE     +F  + ++R    P++  F   ++N ID +A       I     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          + + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEF--FFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCL--QEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPFLTY----VEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 136.732 bits (343), Expect = 3.504e-33
Identity = 123/435 (28.28%), Postives = 213/435 (48.97%), Query Frame = 1
Query:  637 EKLERVTFIVGGTQFQSFIETIVHIPNSKLATCV----------IEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF-----------SESKEKCVYSNKNATAFEKWK---THLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRE--LYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEI------DEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            E  +++   VGG + +++  T+  +P ++L+               K+ E   FFDR P  F YVLN+YRTG+LH P++ C   +EEEL FWGI+E  +E CC+  Y  ++ A   L  F            + K  C+   ++     +WK     ++  F     +  +++ +  +   I+ +I    L T  AF  ++ K + F +  + + E+IL    +  + Y    VE     +F  + ++R    P++  F   ++N ID +A       I     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          + + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEF--FFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCL--QEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPFLTY----VEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 136.732 bits (343), Expect = 3.892e-33
Identity = 123/435 (28.28%), Postives = 213/435 (48.97%), Query Frame = 1
Query:  637 EKLERVTFIVGGTQFQSFIETIVHIPNSKLATCV----------IEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF-----------SESKEKCVYSNKNATAFEKWK---THLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRE--LYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEP------SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            E  +++   VGG + +++  T+  +P ++L+               K+ E   FFDR P  F YVLN+YRTG+LH P++ C   +EEEL FWGI+E  +E CC+  Y  ++ A   L  F            + K  C+   ++     +WK     ++  F     +  +++ +  +   I+ +I    L T  AF  ++ K + F +  + + E+IL    +  + Y    VE     +F  + ++R    P++  F   ++N ID +A       I     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +    +       + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEF--FFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCL--QEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPFLTY----VEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96666])

HSP 1 Score: 130.568 bits (327), Expect = 8.678e-31
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96666])

HSP 1 Score: 130.568 bits (327), Expect = 8.678e-31
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnb2 (potassium voltage gated channel, Shab-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:99632])

HSP 1 Score: 127.487 bits (319), Expect = 7.691e-30
Identity = 132/441 (29.93%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            R  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + E +L             FFDR P  F  +LNFYRTG+LH     C   F +EL++WGI+E ++E CC ++Y   K   N  L++ +E+ +E+      N    EK K  L+      + ++ ++  +          + I+F+       I L      EL +N+     F       +L  VE     +F  + +LR   SPN++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KF +I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:   11 RKTSRSTLSLPPEPVDIIRSKTCSR--RVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKK-LWDLLEKPNSSVAAKILA---------IVSILFI---VLSTIALSLNTLPELQENDE----FGQPSDNRKLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 428          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnb2 (potassium voltage gated channel, Shab-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:99632])

HSP 1 Score: 127.487 bits (319), Expect = 7.691e-30
Identity = 132/441 (29.93%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            R  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + E +L             FFDR P  F  +LNFYRTG+LH     C   F +EL++WGI+E ++E CC ++Y   K   N  L++ +E+ +E+      N    EK K  L+      + ++ ++  +          + I+F+       I L      EL +N+     F       +L  VE     +F  + +LR   SPN++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KF +I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:   11 RKTSRSTLSLPPEPVDIIRSKTCSR--RVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKK-LWDLLEKPNSSVAAKILA---------IVSILFI---VLSTIALSLNTLPELQENDE----FGQPSDNRKLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 428          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnd1 (potassium voltage-gated channel, Shal-related family, member 1 [Source:MGI Symbol;Acc:MGI:96671])

HSP 1 Score: 113.235 bits (282), Expect = 1.744e-25
Identity = 115/425 (27.06%), Postives = 188/425 (44.24%), Query Frame = 1
Query:  595 LPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIE-----KSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNA-TAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLK---RQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNE---AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            LPP P      K     E +   V G +F+++  T+   P++ L +   E     +SGE   FFDRDPD F +VLNFYRTGRLH P   C+  F+EEL F+G+  E +  CC  +Y   K      ++ +E +E        A  A    +  L+ AF     +  +  +           +   F+  S    +      R   R   K +S  + F           ++ A    F  + +LR F +P+R  F    ++          +     Y  +    N+      + L++ R+FR+FK + +   G+  +  T+++   +L  +   + + I  F  ++F  E   +    + F +I    W+ IVTM T+GYGD +P T  G + G IC L G+++  LPVP+ + NFS  Y+Q Q
Sbjct:   27 LPPAPEV----KASRGDEVLVVNVSGRRFETWKNTLDRYPDTLLGSSEKEFFYDAESGEY--FFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRKK--ENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPHTSTAALVF---------YYVTGFFIAVSVIANVVETIPCRGTPRWPSKEQSCGDRFPTA-----FFCMDTACVLIFTGEYLLRLFAAPSRCRFLRSVMSL------IDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVFRIFKFSRH-SQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAE---KGTSKTNFTSIPAAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQ 419          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|O18868|KCNB1_PIG (Potassium voltage-gated channel subfamily B member 1 OS=Sus scrofa OX=9823 GN=KCNB1 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.414e-30
Identity = 135/441 (30.61%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  T    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQTTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P15387|KCNB1_RAT (Potassium voltage-gated channel subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Kcnb1 PE=1 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 4.782e-30
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q14721|KCNB1_HUMAN (Potassium voltage-gated channel subfamily B member 1 OS=Homo sapiens OX=9606 GN=KCNB1 PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 5.051e-30
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q03717|KCNB1_MOUSE (Potassium voltage-gated channel subfamily B member 1 OS=Mus musculus OX=10090 GN=Kcnb1 PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 6.070e-30
Identity = 134/441 (30.39%), Postives = 210/441 (47.62%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R T  LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  +    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSTSSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q9MZ19|KCNB1_RABIT (Potassium voltage-gated channel subfamily B member 1 OS=Oryctolagus cuniculus OX=9986 GN=KCNB1 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 7.996e-30
Identity = 134/441 (30.39%), Postives = 209/441 (47.39%), Query Frame = 1
Query:  568 RAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACN-TLKKFSES-KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFN----EAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            +  +R    LPP P  I R K   +  RV   VGG   +    T+  +P ++L       + + +L             FFDR P  F  +LNFYRTGRLH     C   F +EL++WGI+E ++E CC ++Y   K   N  LK+ +E+ +E+      N    EK K  L+      + ++ ++  +          I IMF+       I L      EL      L+ F  T    +L  VE     +F  + +LR   SP ++ FF   +N ID+LA     ++  L     +          V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+F  E   + ++ +KFK+I    WWA +TM TVGYGD  P T  G +VG +C + G+++  LP+PI + NFS +Y + +
Sbjct:    7 KHGSRSASSLPPEPMEIVRSKACSR--RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRK-KLWDLLEKPNSSVAAKILA---------IISIMFI---VLSTIALSLNTLPELQS----LDEFGQTTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAE---KDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 424          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2T7PK23 (BTB domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05004 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.822e-43
Identity = 144/469 (30.70%), Postives = 239/469 (50.96%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLATCVIEK---------SGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVY--------------------SNKNATAFEKWKTHLYLAFVVGDKT---------IISQWYSXXXXXXXXXXXXXMF----LGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVI-ILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS--RLTHQSKVLTISMDPESMKESETNEEDS 1920
            RV   VGG ++++F  T+  IP+++L+     +         +GE   FFDR P  FN +LN+YRTG+LHAP++ C   FEEEL FWGI+E+ +EPCC+S Y A++ A  TL +     +                        +++    F++W+  ++   ++ D T         I S  + +I  A  +A   + F     G +      LK ++ +E  + ++ L   E T +             YF  +++LR    P+R       + W+D+L+   +    ++ +  A      YVI  L++ RIFR+ +LT    SG+  +  T+RAS  +L L+ +++ I +  F   I+  E ++E D  + F+ I IG WWA+VTM T+GYGD  P T  GY+VG IC L G+++  LPVP+ + NF++YY+ AQ+  RL H+ K + +    +++K +E   E S
Sbjct:   35 RVVINVGGVRYETFRSTLKSIPDTRLSWLTEAQDHNPDYDPATGEY--FFDRHPGVFNMILNYYRTGKLHAPADVCGPMFEEELAFWGIDEKQIEPCCWSGYSAHRDAQETLAELESDHDDSENDDNNEEDEEIARRFGIVLEDAHEEKHCFQRWQPRVW--HLLEDPTSSSGAQIISIASVVFVLIFIAIFVAESHMQFRDPRAGVNVSSSDTLKVRELQEATEPKAWLKVLEYTCV------------SYFTLELLLRVIFCPDRAALCRHVLTWVDLLSVLPTYTYIIMMAANAGAHESLYVISSLRMIRIFRILRLTRYF-SGLKILAHTLRASAKELFLLIIVLGIGVLVFASFIYYFEQIDE-DPKNDFRNIPIGFWWAVVTMTTLGYGDIYPRTAFGYIVGGICALCGLLMLALPVPVIVNNFTLYYSHAQAKMRLPHKKKNMLVGA-ADALKNTEAVVEGS 484          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2R2MQY6 (potassium voltage-gated channel subfamily C member 1-like OS=Lingula unguis OX=7574 GN=LOC106163607 PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.592e-40
Identity = 137/450 (30.44%), Postives = 234/450 (52.00%), Query Frame = 1
Query:  571 AAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKS---------GELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF----SESKEKCVYSNKNATAF------------EKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXX--XXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNE-IDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            AA  +T      P   Y D       +V   VGG +++++  T+ ++P+++LA     KS         GE   FFDR P  F  +LN+YRTG+LHAPS+ C   FE ELE+WGI+E+ +EPCC+  Y+++K A  TL +     +ES+E+    ++ AT F            ++W+  ++        + +++  + ++   I+ +I    L T  + R  +             I N  +       L  V +A   +F  + +LR    P++  F  + +NW+D+ +          ++       +   ++ + ++ RIFR+FKLT +  SG+  +  T++AS  +L+L+ LI+ + I  F  LI+  EL++E  ++PS F  I  G WWA+VTM T+GYGD +P T  GY+VG +C + G+++  LPVP+ + NF++YY  AQ+
Sbjct:   17 AACAVTPTGSMIPSRRYSDS-----NKVVINVGGVRYETYKSTLKNVPDTRLAWLTETKSQNTDYDAVTGEY--FFDRHPGIFVMILNYYRTGKLHAPSDLCGPIFEAELEYWGIDEKQIEPCCWMNYISHKEAQKTLDEMDGADTESEEENDEVSRIATIFGIEEAPPDQNCWQRWRPKIWAILEDPYSSRLAKVITSVSLLFIVISITAFCLETVCYVREPISEHGNTGAVPITHIRNQSQPVAAFAYLEYVYMA---FFTLEFVLRVLFCPDKKKFCKEILNWVDLFSILPFYMEYIVIIIDPSIQSYQIQFLKLFRLIRIFRIFKLTRHF-SGIKILSHTLKASARELVLLILILFLGILIFATLIYYAELLDENPNDPSSFWNIPRGFWWAVVTMTTLGYGDIVPKTPYGYIVGALCAMCGVLMIALPVPVIVNNFAMYYTHAQA 455          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: Q4S1G4 (Chromosome 13 SCAF14769, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00025571001 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.718e-38
Identity = 125/443 (28.22%), Postives = 220/443 (49.66%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFS----------------ESKEKCV------------YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            +R+   VGG + Q++  T+  +P ++L+      +             FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                 E  E  V            + ++  + + +W+ H++  F     +  ++W ++ +   I+ +I    L T  AF  I + R +  E+  N ++++ +++T     L  +E     +F  + ++R    PN+F F  +T+N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          E ++FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 DRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGGGLLDLVSDDPEPDHEHAEDEVDEMTRRLAQADTHDHRTGSLWSRWQKHVWALFEDPYSSKYARWVALASLFFILVSITTFCLETHEAFNPI-INRTEL-EVVNNFTVVHIYQETETAPYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNTLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTQFKNIPIGFWWAVVTMTTLGYGDMCPQTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 447          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A3P8PJ58 (Potassium voltage-gated channel, Shaw-related subfamily, member 1b OS=Astatotilapia calliptera OX=8154 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.750e-38
Identity = 126/443 (28.44%), Postives = 219/443 (49.44%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFS----------------ESKEKCV------------YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXX--XXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            +R+   VGG + Q++  T+  +P ++L+      +             FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  FS                E  E  V               +N + + +W+  ++  F     +  ++W ++ +   I+ +I    L T  AF  I + R ++ ++  NE+++N +++T     L  +E     +F  + ++R    PN+F F  + +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          E + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 DRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFSGGGLLDLGNDDQEPDQEHAEDDVDEMTRRLAQGDSPDTRNGSLWSRWQKRVWALFEDPYSSKYARWVALASLFFILVSITTFCLETHEAFNPI-INRTEW-DVVDNETVMNTYQETETAIYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 447          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A3B4GQW1 (Potassium voltage-gated channel, Shaw-related subfamily, member 1b OS=Pundamilia nyererei OX=303518 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.750e-38
Identity = 126/443 (28.44%), Postives = 219/443 (49.44%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFS----------------ESKEKCV------------YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXX--XXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            +R+   VGG + Q++  T+  +P ++L+      +             FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  FS                E  E  V               +N + + +W+  ++  F     +  ++W ++ +   I+ +I    L T  AF  I + R ++ ++  NE+++N +++T     L  +E     +F  + ++R    PN+F F  + +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          E + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 DRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFSGGGLLDLGNDDQEPDQEHAEDDVDEMTRRLAQGDSPDTRNGSLWSRWQKRVWALFEDPYSSKYARWVALASLFFILVSITTFCLETHEAFNPI-INRTEW-DVVDNETVMNTYQETETAIYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 447          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 148.673 bits (374), Expect = 2.046e-37
Identity = 121/442 (27.38%), Postives = 214/442 (48.42%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI-LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------------------------------SESKEKCVY---SNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ERV   VGG + +++  T+  +P ++LA    +  G     FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                                +E   +  +   ++ +   +++W+  ++  F     +  ++W +  +   I+ +I    L T  AF  I + R ++ ++  NE +      T  + +L  +E     +F  + ++R    P++  F  + +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ +L+ + + + +  F  +I+  E +          E + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 ERVVLNVGGVRHETYRGTLRTLPGTRLARLAEQAEGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETDVEPCCWMTYRQHREAEEALVSFGGAAPLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLETHEAFNPI-INRTEY-DVVDNEIVERNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 147.902 bits (372), Expect = 3.493e-37
Identity = 119/442 (26.92%), Postives = 212/442 (47.96%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI-LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------------------------------SESKEKCVY---SNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWX--XXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ERV   VGG + +++  T+  +P ++LA    +  G     FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                                +E   +  +   ++ +   +++W+  ++  F     +  ++W +  +   I+ +I    L T  AF  I + R ++ ++  NE +      T  + +L  +E     +F  + ++R    P++  F  + +N I    +      +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ +L+ + + + +  F  +I+  E +          E + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 ERVVLNVGGVRHETYRGTLRTLPGTRLARLAEQAEGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETDVEPCCWMTYRQHREAEEALVSFGGAAPLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLETHEAFNPI-INRTEY-DVVDNEIVERNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 144.436 bits (363), Expect = 4.535e-36
Identity = 128/440 (29.09%), Postives = 210/440 (47.73%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-----------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------------------SESKEKCVYSNKNA-TAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYE--LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNE------IDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ER+   VGGT+ +++  T+  +P ++LA    E                  FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F                     E+ E+  +++K   T + +W+  ++  F     +  +++ +  +   I+ +I    L T  AF  I  K    R    N+S+L       I  +  L  VE     +F  + ++R   SP++  F    +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAS ++  L+ + + + +  F  +I+  E +          + + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:   19 ERIILNVGGTRHETYRNTLRTLPGTRLALLATELPSSACAVTVRARANNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFDMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAFNTIINKTDALR----NDSLLEVSPQYEIETDPALTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 453          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 141.354 bits (355), Expect = 3.498e-35
Identity = 127/439 (28.93%), Postives = 209/439 (47.61%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI----------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------------------SESKEKCVYSNKNA-TAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYE--LIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNE------IDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
             R+   VGGT+ +++  T+  +P ++LA    E                 FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F                     E+ E+  +++K   T + +W+  ++  F     +  +++ +  +   I+ +I    L T  AF  I  K    R    N+S+L       I  +  L  VE     +F  + ++R   SP++  F    +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAS ++  L+ + + + +  F  +I+  E +          + + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    5 HRIILNVGGTRHETYRNTLRTLPGTRLALLATELPSSACQQVRARANNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFDMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAFNTIINKTDALR----NDSLLEVSPQYEIETDPALTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 438          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 140.198 bits (352), Expect = 1.079e-34
Identity = 119/450 (26.44%), Postives = 206/450 (45.78%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKC------------------------------VYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMA-TGFNE-------AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            +RV   VGG + Q++  T+  +P ++LA      +             FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F     +                                   K    +++W+  ++  F     +  ++W +  +   I+ +I    L T  AF  I + R     +  +  I   +++T     L  +E     +F  + ++R    P++  F  +T+N          +     Y E+  +G +         ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          E + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 DRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPI-INRTDIDPVDNSTRI---YQETETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLN------IIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 137.502 bits (345), Expect = 3.459e-34
Identity = 127/435 (29.20%), Postives = 208/435 (47.82%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCV----------IEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------SESKEKCVYSNK-----------NATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNE--AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNE------IDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ERV   VGGT+ +++  T+  +P ++L+               K  E   FFDR P  F ++LN+YRTG+LH PS  C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F         E  E    S +                 +W+  ++  F     +  ++  ++ +   I+ +I    L T  AF  +  K + +     N +    + D      L+ VE     +F  + ++R    P++ VF  + +N ID +A     +   L S  +    +   ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +IF  E            + + FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NFS+YY+ A +
Sbjct:   36 ERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEF--FFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAFNTVLNKTENY--TINNVTTQKVYVDVETDPVLMYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSLTSKPARDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 5.316e-29
Identity = 120/416 (28.85%), Postives = 199/416 (47.84%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKL----ATCVIEKSGELI---------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNT-LKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQ-KFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNE-----AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEP-SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQ 1833
            RV   VGG   +    T+  +P ++L    AT       EL           FFDR P  F  VLNFYRTGRLH     C   F +EL++WG++E ++E CC ++Y   K   +  L++ +ES  +        T     +  L+      + ++ ++  +I++   I+ + + + L T      DL+ + +F  +  N              +L  VE     +F  + +LR   +PN++ FF   +N +  L        T+  +E + G ++       V I +I RI R+ KL A   +G+ ++  T+R S ++L L+ L + + I  F  L+       E DEP +KF +I    WWA +TM TVGYGD  P T  G ++G +C + G+++  LP+PI + NFS +Y + +
Sbjct:    1 RVRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARYHQKKEQMSEELRREAESAREREGDEFEGTCCADKRRKLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNTLP----DLQHKDEFSHIIDNP-------------KLAQVEAVCIAWFTMEYLLRFMSAPNKWKFFKGALN-VIDLMAILPYYITIFLTESSRGVSQFQNVRRVVQIFRIMRILRILKL-ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLV----FFAEKDEPDTKFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK 393          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnf1b (potassium voltage-gated channel, subfamily F, member 1b [Source:ZFIN;Acc:ZDB-GENE-090312-39])

HSP 1 Score: 97.0561 bits (240), Expect = 9.195e-22
Identity = 103/426 (24.18%), Postives = 193/426 (45.31%), Query Frame = 1
Query:  664 VGGTQFQSFIETIVHIPNSKLATCVIE--------------KSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSES--KEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXX----XXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQA---QSRLTHQSKVLTIS 1872
            VGG++     E +  +P+S LAT ++                SGE   FFDRDP  F+ +L+ Y  G +H   + C   F++E++FWG+  + ++ CC  +Y   +   + + +  E+  ++            E+ +  ++      D + +++  ++ + A I+ + ++M LGT      +L+     +    E              +  +E    G+F  +  LR F +P+R  F +  +N +D+LA         ++ +  S M     +  V  L+I R+ R+FKL A   SG+  +   +++S  +L L+ L + + +  F  L +    V +    + F +I    WWAI+TM TVGYGD  P T+ G  +         +   LP+   + NF  +YN+    +    HQ ++L++S
Sbjct:    6 VGGSRHVLRSELLARLPDSLLATLLVRPGAARRPAYDDFDPDSGEF--FFDRDPRAFDRILDAYHFGEVHMDRSACPMCFKQEMDFWGVGADCLDDCCRFRYSELQEELDEIVQMVETELRDSGTAGAAQRGRCERARVGVWQLMEKPDSSRLARSLALTSFAFIVVSSVVMCLGTIP----ELQPGPGADGAAGEEHPT----------IAAIETVCIGWFTVEFALRFFSAPDRVKFMSSPMNVVDLLAVLPYFVVLALTEMGGSVMGLASMQQGVQALRIMRVARVFKL-ARHSSGLQTLTYALKSSFKELGLLLLYLGVGVYLFSALGYT---VEQSHPETLFSSIPHSFWWAIITMTTVGYGDIYPKTELGK-INAAVSFLCGLAIALPIHPIINNFVKFYNKQRVLEMAAKHQLELLSVS 410          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 89.3521 bits (220), Expect = 5.736e-19
Identity = 123/474 (25.95%), Postives = 221/474 (46.62%), Query Frame = 1
Query:  616 IYRDKPE-------EKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI------LFFDRDPDCFNYVLNFYRTG-RLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYK-NESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMA-------TGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQS--KVLTISMDPESMKESETNEEDSNRISLAKHLTKE*KF 1965
            +  D PE       E  ER+   V G +F++ ++++   P++ L      K            FFDR+   F+ +L +Y++G RL  P N  +  F EE++F+ +  E M                   KF E  E  +   +     ++++  ++L F   + +  ++  +I++   I+ +I+I  L T    R D K QKF      N + +     +       IVE     +F  ++++R F  P++  FF   +N IDI+A     I+    +EMA          + A + ++++ R+FR+FKL+ + K G+  +  T++AS  +L L+   + I +  F   ++  E  ++    S+F++I    WWA+VTM TVGYGD  P T GG +VG +C + G++   LPVP+ + NF+ +Y++      H +   V + S   ES K    +   S  + +   L+ +  F
Sbjct:   11 LLEDGPETAEPLTHEYCERIVINVSGLRFETQLKSLDQFPDTLLGNP--SKRSRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVSIDVFSEEIKFYELGNEAM------------------AKFQED-EGFIKEEEKPLPSDEFQRQVWLLFEYPESSNPARGIAIVSVLVILISIIIFCLETLPEFR-DEKEQKFLPAKDINGTQVKIMHGSSFTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLG--TEMAKHQGSGQQAMSLAILRVIRLVRVFRIFKLSRHSK-GLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQ---NSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDNEEHANYLHVSSCSHQEESRKSRSPSMSRSEYMEMDDGLSNDVDF 456          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 87.4261 bits (215), Expect = 9.333e-19
Identity = 114/404 (28.22%), Postives = 193/404 (47.77%), Query Frame = 1
Query:  643 LERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI------LFFDRDPDCFNYVLNFYRTG-RLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFR-ELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX-XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSK-FKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYN 1824
            L+RV   V G +F++ ++T+   P+S L     +K            FFDR    F+ +L +Y++G RL  P +     F EE+EF+ + EE +           K   NTL    E        N +   F++   H++  F   D +I ++  S+++    I +I +M L T    R D +    R E     SI N       L    ++E A   +F+ ++ +R +  P++  F  D +N IDILA     +   L   +      +  + I+++ R+ R+FKL+ + +  +  + LT++AS  +L ++   + + +  F   I+ +E     D+P K F +I    WWA+VTM  VGYGD  P T GG +VG +C + G++   LPVP+ + NF  +YN
Sbjct:    4 LQRVVINVSGERFETQLKTLDQFPDSLLGHP--DKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVA----------KYGENTLDTPEEE-------NVHGKDFQQ---HVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYN-------LDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQD-LQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE----ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 373          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 151.754 bits (382), Expect = 4.568e-40
Identity = 128/425 (30.12%), Postives = 215/425 (50.59%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESK---------EKCVYS-------NKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKR-QKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVI-ILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRL 1842
            +RV   VGG + +++I T+ +IP+++L   + E   +L          FFDR P  F  VLNFYRTG+LH P++ C   FE+EL FWGI+E  +EPCC+  Y  ++ A   L  F             +  VY         +N T ++K++  ++  F     +I +Q          + A + MFL  S+     L+   KF     +E  + Y           I+E     +F  + + R    P++  FF   +NWID+ A     ++ ++     + F    V+ ++++ R+FR+FKL+ +   G+  +  T+R+S  +L L+   + I +  F  +IF  E   +  + + F TI    WWA+VTM T+GYGD +P T  G +VG +C + G+++  LPVP+ + NFS+YY+ A++R+
Sbjct:   16 DRVVINVGGQKHETYIGTLKNIPDTRLYW-ITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQ----------VLAFITMFLIISSVCLFCLETVPKFDNPKTSEGFVLY-----------ILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYLTLIVRE---SNFKTIVVLRVVRLIRVFRIFKLSRH-SYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAE---KDTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARM 411          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 137.502 bits (345), Expect = 3.657e-35
Identity = 115/414 (27.78%), Postives = 206/414 (49.76%), Query Frame = 1
Query:  649 RVTFIVGGTQFQSFIETIVHIPNSKLA----TCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF---------SESKEKCVYSNKNATAFEKWK---THLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRL 1842
            R+   VGG + ++ + T+ +IP+++L+       + +  +   FFDR P  F  VLNFYRTG+LH P+  C   FEEEL FWGI+E+ MEPCC+  Y  ++ A   LK F          E  E  + S  +      WK     L+       +T+     S +       + + + L  + F    +   +   +  +   L++            +E+  + +F  ++ +R    P++  F    +NWID +A     ++    + +   F     ++++I R+FR  KL+     G+  +I T++AS+ +L+L+ L+V+I +  F  +++ +E++ E    ++F ++    WW ++TM TVGYGD  P T  G ++G  C + G++I  LP+ +   NF++YY  AQ+RL
Sbjct:   17 RIIINVGGFRHETSVSTLQNIPDTRLSWIAENSTVNEDNKREYFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAFVGPGFNDLKDEPAENHMGSYGSINELNCWKRIQPQLW-------ETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIRKNNIMGSREGLDH------------IEMFCSIFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPFYVNIFYPNPIVRMF-----LVIRIMRLFRFIKLS----YGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIE-GRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARL 401          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO48067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ6])

HSP 1 Score: 134.806 bits (338), Expect = 3.670e-34
Identity = 125/428 (29.21%), Postives = 208/428 (48.60%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIET---IVHIPNSKLATCVI-----EKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF--------SESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYS-----XXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGIL--YELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEP-SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQSK 1857
            +RV    GG +F+ ++ T   I  +P SK+    I     E+SGE   FFDR P  F  VLN+ +TG+LH P N C   FE+EL +WGI+E+ ME CC+S Y  ++ A  +LK           E + K  Y + N +    W+ H  + + + D+   S         +++   I    + MF G S     ++ R      + N +  +Y+     +  Y L+I++    G+F  + +LR    P++  F     NWID++      +       M   F    +  ++I RIFR FKL  +L+     +  T++AS   L+++ +I++I +  F  L+   E     D+  ++F  +   +WW ++TM T+GYGD +P +  G V+G I  + G+II      +    FS+YYN AQ++L   +K
Sbjct:    4 DRVVINCGGKRFEPYLSTLKNITDLPLSKITENKIKLDYDEESGEY--FFDRHPAVFAQVLNYLQTGKLHCPRNVCGPLFEQELAYWGIDEQQMESCCWSNYTKHRDAQESLKALDFRPRYDEDEERRKVHYDDPNLSW---WQRHQPIVWEILDEPYSSSTAKDYTPFLVSIFTICIWTVEMFKGDSKTVTRNVTRN---ATHGNTTTKSYYMPVSDVPRYVLMIIDSVCTGWFTLEFLLRLVFCPSKLKFILTLQNWIDLIVIIPLYLML----AMEKSFVLDVLNTMRIVRIFRFFKLLYDLQ----ILTKTVKASRQHLMILLIILMIPVIVFSSLVLYSEKRWGSDKSKAQFYNVPNSVWWGLITMTTIGYGDMVPTSFMGKVIGGIASICGVIILSTSASVIGSTFSLYYNLAQAQLKLPTK 415          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 134.42 bits (337), Expect = 3.725e-34
Identity = 132/418 (31.58%), Postives = 208/418 (49.76%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI-------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFS----ESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXX-XXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEA-YVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXE------LVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRL 1842
            +RV   VGG + ++++ T+  +P+S+LA      S +         +FFDR P  F  VLN+YRTG+LH P + C   FEEEL FWGI E  MEPCC+S Y  ++ A  TLK F     ++++    + +     +K K   + A       ++ Q YS        + +++I+ L  + F    ++   F + +K E     F+   ILY +         +F  + + R    P++  F  + + W         L    LY   A G     ++ +L++ RIFRLF+    + SGM  I  T+RAS  +L L+ LI++I +  F  L+F  E      L   I+   +F +I    WWAI+TM TVGYGD  P T  G  +G +C   G++I  LPV +   NF+++Y+ AQ++L
Sbjct:    6 DRVILNVGGYRHETYLSTLRVVPDSRLAWIGENASKQADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEELQMEPCCWSNYTQHRDAQATLKAFEGLQKDTEDSEYEAGERLARRQKTKMQQFWA-------LLEQPYSSKYAQILAMVSLVIIILSVTTFC---IESMPFADAFKKE-----FQILEILYCV---------WFTFEFVARAIACPSKVEFIKNFMTW------VDVLSIIPLYISFAKGDQTLDFLFVLRLVRIFRLFRFFRTM-SGMQVIGHTLRASARELFLLVLILLIPMVIFSTLVFYAEKSVSKFLNQRINSKGEFPSIPDAFWWAIITMTTVGYGDVTPKTPHGRFIGTLCACIGVLIVALPVSVIGSNFTLFYSHAQAQL 392          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 128.257 bits (321), Expect = 5.865e-32
Identity = 131/429 (30.54%), Postives = 215/429 (50.12%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFS--------ESKEK----------CVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEA-----YVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRL 1842
            +RV+  VGG + +++  T+ +IP+++L+      +G           FFDR P  F  VLN+YRTG+LH P + C   FE+EL FWGI+++ +E CC+  Y  ++ A  TL  F         E  E+             S  + T +E+++  ++        T++ + +S   A  I    + + L +     ++   +KF E         Y +D      L+I+E     +F  ++++R    P +  FF   +NWID LA             ++ GFN        ++I+++ RIFR+FKL+ +  SG+  +  T+RAS  +LLL+   ++I +  F  LIF  E   +    +KF  I    WWA+VTM TVGYGD  P +  G  +G +C + G++   LPVP+ + NFS+YY+ AQ+RL
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGRYGFNFAAESEPDKTWWERYQPRIW--------TLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLE-SMEKFSE--------KYLKDL-----LVILEGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFY--------VSLGFNNNNNDIDALMIIRLIRIFRIFKLSRH-SSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCE---KKIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARL 395          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc2 (potassium voltage-gated channel subfamily C member 2 [Source:NCBI gene;Acc:101159160])

HSP 1 Score: 148.673 bits (374), Expect = 2.501e-37
Identity = 129/439 (29.38%), Postives = 216/439 (49.20%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELIL-------------------FFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKC--------------VYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXX--XXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN-EIDEP-----SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQS 1836
            ER+   VGGT+ +++  T+  +P ++LA    +   + +L                   FFDR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L  F  + +                V+ + NA  + KW+  ++  F     +  +++ +  +   I+ +I    L T  AF  I + +   R     + +  Y  +T     L  VE     +F  + ++R    P +  F  + +N ID +A       +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +  + ++P     +KFK I IG WWA+VTM T+GYGD  P+T  G VVG +C L G++   +PVP+ + NF +YY+ A +
Sbjct:    8 ERIILNVGGTRHETYKSTLKTLPGTRLALLASDSDIDSVLDQLQQVPGFIEYNARTKQYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFELNVDNGDEDDDVGGGLGIEDVHVDGNAGLWRKWQPVIWNLFEDPYSSRAARFVAFASLFFILVSITTFCLETHEAFNTI-INKTNMRNNSCQDLVPQYEIETDP--ALTYVEGVCVFWFTIEFLVRVTFCPVKLEFVKNVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKANDPTASQHTKFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 442          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 147.902 bits (372), Expect = 3.381e-37
Identity = 118/443 (26.64%), Postives = 211/443 (47.63%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF------------------------SESKEKCVYSN----KNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWX--XXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            +R+   VGG + Q++  T+  +P ++L+      +             FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                         E   +    +    ++ + + +W+  ++  F     +  ++W ++ +   I+ +I    L T  AF  I    + + E   N +  N +++T     L  +E     +F  + ++R    PN+F F  + +N I    +      +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          + ++FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 DRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFNPI--VNRTYVEHLDNITTENTYQETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 447          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 147.517 bits (371), Expect = 5.583e-37
Identity = 118/443 (26.64%), Postives = 211/443 (47.63%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELI--------LFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF------------------------SESKEKCVYSN----KNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWX--XXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN------EIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            +R+   VGG + Q++  T+  +P ++L+      +             FFDR P  F ++LN+YRTG+LH P++ C   +EEEL FWGI+E  +EPCC+  Y  ++ A   L  F                         E   +    +    ++ + + +W+  ++  F     +  ++W ++ +   I+ +I    L T  AF  I    + + E   N +  N +++T     L  +E     +F  + ++R    PN+F F  + +N I    +      +     S  A      ++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +          + ++FK I IG WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    8 DRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFNPI--VNRTYVEHLDNITTENTYQETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 447          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 144.05 bits (362), Expect = 9.272e-36
Identity = 125/450 (27.78%), Postives = 217/450 (48.22%), Query Frame = 1
Query:  646 ERVTFIVGGTQFQSFIETIVHIPNSKLATCV----------IEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKF-------------------SESKEKCVYSN-KNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELY-KNESI-LNYFEDTGILYELII------VELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMA-TGFNE-------AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVN-EIDEPSK-----FKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSR 1839
            E++    GG + +++  T+  +P ++L+               KS E   FFDR P  F ++LN+YRTG+LH PS+ C   FEEEL FWGI+E  +E CC+  Y  ++ A   L  F                    + K  C+  + + AT ++ W+  ++  F          + S        A++  + L  S F       + F  +Y K E++ +  F    I+YE++       VE     +F  +++ R    P++  FF   +N          +     Y E+A +G +        +++ +++  RI R+FKLT +   G+  +  T+RAST++ LL+ + + + +  F  +I+  E +  + ++P+      FK I IG WWA+VTM T+GYGD  P+T  G +VG +C L G++   +PVP+ + NF +YY+ A ++
Sbjct:    9 EKIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEF--FFDRHPATFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPEDDPALTGCADGDLKRLCMQEDGRRATRWQVWQPWMWALFE-------DPYSSKYARYVAFASLFFILLSISTF--CLETHEAFNTIYNKTENVTVGNFTHEEIVYEVVTDGWLTYVEGVCVIWFTIEVMARVIFCPDKAEFFRSALN------IIDFVAIVPFYLEVALSGLSSKTAKDILSFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPNDPTAAAHTTFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAK 440          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000007744.2 (potassium voltage-gated channel subfamily C member 4 [Source:NCBI gene;Acc:101165306])

HSP 1 Score: 142.124 bits (357), Expect = 3.340e-35
Identity = 135/473 (28.54%), Postives = 225/473 (47.57%), Query Frame = 1
Query:  637 EKLERVTFIVGGTQFQSFIETIVHIPNSKLA-----------TCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESK--------------EKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTS-AFGR-IDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMAT-GFNE-------AYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEI-DEP-----SKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQSKVLTISMDPE------SMKESETNEE 1914
            E  +++   VGGT+ +++  T+  +P ++LA             V E       F+DR P  F YVLN+YRTG+LH P++ C   FEEEL FWGI+E  +EPCC+  Y  ++ A   L+ F                  E C  S+++ +  E W+  L+  F     +  ++  + ++   I+ +I    L T  AF   +D   Q      K+++ L     + IL+    VE     +F  + ++R    PN+  F  +T+N          +     Y EM   G +         ++ +++  RI R+FKLT +   G+  +  T+RAS ++ LL+ + + + +  F  +I+  E +    ++P     + FK I I  WWA+VTM T+GYGD  P T  G +VG +C L G++   +PVP+ + NF +YY+ A ++     K    + +PE      S  +SETN  
Sbjct:   33 EDSDKIVINVGGTRHETYKSTLRTLPGTRLAWLAEPDAQVSTDSVAEPPSAAEFFYDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMSYRQHRDAEAALEIFEPPDPDDTDDEAPRRFGIEDC--SDRSRSCCEVWQPKLWALFDDPYSSRAARGVAFVSLFFILLSITTFCLETHDAFNEWMDKVFQGNNTSGKSKAELG---GSKILHG---VEGVCVFWFTLEFLVRIICCPNKCFFIKNTLN------IIDFVAILPFYLEMCLEGLSSKAAKNVLGFLRVVRFVRILRIFKLTRHF-VGLRVLGHTLRASVNEFLLLVIFLALGVLIFATMIYYAERIGASPNDPTGFNHTHFKNIPISFWWAVVTMTTLGYGDMYPQTWLGMMVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHTPNPEILTDSASFGKSETNSH 490          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000075712.1 (SMESG000075712.1)

HSP 1 Score: 1160.98 bits (3002), Expect = 0.000e+0
Identity = 634/634 (100.00%), Postives = 634/634 (100.00%), Query Frame = 1
Query:   55 MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQSKVLTISMDPESMKESETNEEDSNRISLAKHLTKE 1956
            MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSIITAACIIAAIMIMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWIDILATTSSLISTLLYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDLLLVFLIVVIFISFFGVLIFVIELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVGCICILFGIIICQLPVPIFLRNFSIYYNQAQSRLTHQSKVLTISMDPESMKESETNEEDSNRISLAKHLTKE
Sbjct:    1 MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSIITAACIIAAIMIMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWIDILATTSSLISTLLYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDLLLVFLIVVIFISFFGVLIFVIELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVGCICILFGIIICQLPVPIFLRNFSIYYNQAQSRLTHQSKVLTISMDPESMKESETNEEDSNRISLAKHLTKE 634          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000075712.1 (SMESG000075712.1)

HSP 1 Score: 1018.07 bits (2631), Expect = 0.000e+0
Identity = 535/621 (86.15%), Postives = 580/621 (93.40%), Query Frame = 1
Query:   55 MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEIDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQS-KVLTISMDPESMKESETNEE 1914
            MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYS++T  CII +IM+MF GTS FGRID+  ++FR +Y+NESIL+YFE T +  +L+ ++L  +GYFMADIILRC LSP+RFVFFTDTINWIDILAT +S++S  L + ++TGFNEAY+++LKIPR+FRLFKLTANLKSGMDAIILTIRAS+ DLLLVFLIVVIF+SFFGVLIFV+ELVNE  +PSKFK+IYIG+WWA+VTM TVGYGDY P+TQGGY+V C CI+ G+II QLPVPIFLRNFSIYYNQA S L      +L++S+DPE++KES  + E
Sbjct:    1 MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSMLTTLCIIGSIMVMFFGTSEFGRIDMHTKEFRPIYENESILSYFEHTDVHADLLFMDLGFSGYFMADIILRCLLSPDRFVFFTDTINWIDILATMTSVLSAFLNNTLSTGFNEAYIVLLKIPRMFRLFKLTANLKSGMDAIILTIRASSSDLLLVFLIVVIFVSFFGVLIFVVELVNEKKKPSKFKSIYIGIWWAVVTMTTVGYGDYTPETQGGYIVACACIITGLIINQLPVPIFLRNFSIYYNQATSLLNKDKINLLSVSVDPENLKESPGDTE 621          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000075712.1 (SMESG000075712.1)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 342/344 (99.42%), Postives = 343/344 (99.71%), Query Frame = 1
Query:   55 MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWY 1086
            MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQ +
Sbjct:    1 MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQEH 344          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000075613.1 (SMESG000075613.1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.188e-127
Identity = 231/479 (48.23%), Postives = 322/479 (67.22%), Query Frame = 1
Query:  478 KRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCV-YSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNEID---EPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQSKVLTISMDPESMKESE 1902
            KR S  L D++ ++ T+KKVN LRY+ENVFRAA ++T+++PPFP W Y+D   + L      VGG  F+ F E++++I  SKL  C+       I FFDRD  CF+ +LNFYRTGRLH P+N CL+ FEEELEFWGI+E+FMEPCC+S++   K A NTLKK+ E  +K   +++ + T F   +  LY    VG   I+++W S I A  I+ +I IM +GT+ +GR+ L    + E  +NE++ +Y   T     +I  E  ++GYFMA+++ R FL PNR   F+DT+NW+D+LAT ++L+S L     +TG  E Y+++LK+PRIFRLFKLTA L+SGMDA  LT+RA  ++L L+FL++ I  + FG LIFV+E+VNE     E S    IY+GMWWAIV+M TVG+GD++P T  GYV G I I+ G+IICQLPVPI L+NFS+Y NQA +RLT+++       DPE   E +
Sbjct:  173 KRNSIHLHDLQCNKITYKKVNFLRYKENVFRAACKLTKEIPPFPDWSYQDDDTKHLMITKINVGGQIFEIFGESLLNIVYSKLTKCISSHQSPGIPFFDRDFTCFSAILNFYRTGRLHVPANTCLTLFEEELEFWGISEQFMEPCCWSEFETLKRATNTLKKYGEDLDKDEDFNDFDQTIFLNARKKLYKIMTVGTGNILARWVSSICALFILLSIYIMIVGTTPYGRVSLNGTSYPEFEENETVSHYLSRTKFPPFMINFEFVISGYFMAELLFRLFLCPNRLELFSDTLNWVDLLATVTTLLSNLFLKAESTGNFEGYMLLLKLPRIFRLFKLTAGLRSGMDAFTLTLRACANELRLIFLLLFIMTAIFGSLIFVVEMVNESSDHGEKSAITNIYLGMWWAIVSMTTVGFGDFVPITTVGYVFGSITIMVGVIICQLPVPIVLKNFSVYNNQASARLTNKNHFKAHISDPELFTEKK 651          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000075700.1 (SMESG000075700.1)

HSP 1 Score: 370.933 bits (951), Expect = 2.110e-119
Identity = 235/604 (38.91%), Postives = 364/604 (60.26%), Query Frame = 1
Query:  124 ATSTKPPRKPQNSFEEKLTKSKKQPLYKDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRRISKKFMNNRINMNRKSF---NDVFNADILFITDQVKENRLQDKVKRESFGLFDIEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERVTFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVLNFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNTLKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSXXXXXXXXXXXXXMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELIIVELALAGYFMADIILRCFLSPNRFVFFTDTINWXXXXXXXXXXXXXXXYSEMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDXXXXXXXXXXXXXXXXXXXXXXELVNE-IDEPSKFKTIYIGMWWAIVTMATVGYGDYIPDTQGGYVVXXXXXXXXXXXXQLPVPIFLRNFSIYYNQAQSRLTHQSKVLTISMDPESMKESETNEEDSN 1923
            A   K    PQ  F+  L ++K   L K ++NP  +I+  +    P + V+RF  SE       +       I +   + + +  +  + RKSF    ++F+  I+ +      N+ + K+ +    L + E + N F+ V +LRYRENVFRA+++++++LPPFP W Y++  E+ L ++   VGGT F+ F ET++++P++KL+   +    +  +FFDRD  CFN VLNFYRTGRLHAP+N CLSFFEEEL FWG+NE+FMEPCC S Y A +  C TL  + E+ +  +      + F K K+      +    ++ S+WY+ I    I+  I+ +  GT+  GRID          K E+I +YF+ T     + +++  L G+F+ D + R  LSP++ +F+ D+INW D+    SS +S          + E ++++LK+PR+FR+F LT  L+ GMDA ILT+R ST +LLLV +I ++ I FFGV I+V+EL+NE  D  S FK+I+ GMWWA+ T+ATVGYGD++P +  G+ VG  CIL GIII QLPVPIFL+NFS +YNQ ++R+   + ++  ++DPE+++  +T  +  N
Sbjct:   16 APIAKYQNHPQEGFQRLLRRTK---LEKIEQNPERSISKDSIRIKPGKSVLRFRDSEEMMSRKSTDSDKKLKITETHRTPEMIPPKKKLGRKSFIKKTEMFHRHIMKVA---YNNKRKAKLDKRRILLSERETNLNLFQHVTVLRYRENVFRASSKLSKNLPPFPSWCYKNNSEKNLHKIQINVGGTNFEVFDETLMNLPHTKLSDSFLFHCEDSTMFFDRDCLCFNAVLNFYRTGRLHAPANSCLSFFEEELMFWGLNEDFMEPCCISDYQANRKICQTLDNYMENMKLPINDFDKKSCFIKSKSACNKIALSETNSLFSRWYTFIYGMAIVGTIITLVFGTTVLGRIDKTTNHVSGYEKGETIEHYFKRTECSPIIFLIDRILDGFFLLDFVTRFILSPDKLIFWADSINWCDLSVIISSTLSDFPIFGSINHY-EPFLVVLKLPRLFRIFYLTKQLRVGMDAFILTLRLSTSELLLVGIITIVAICFFGVSIYVVELINEKPDRFSDFKSIFDGMWWAVGTLATVGYGDFVPRSTYGFFVGYFCILTGIIITQLPVPIFLKNFSTFYNQIEARMKLVNAIINSNIDPETIQFGQTILDSEN 612          
The following BLAST results are available for this feature:
BLAST of Voltage gated potassium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNB11.052e-3030.39potassium voltage-gated channel subfamily B member... [more]
KCNB11.052e-3030.39potassium voltage-gated channel subfamily B member... [more]
KCNB25.160e-2928.64potassium voltage-gated channel subfamily B member... [more]
KCND12.136e-2526.81potassium voltage-gated channel subfamily D member... [more]
KCNS21.358e-2328.33potassium voltage-gated channel modifier subfamily... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-33.586e-3531.38SHaW family of potassium channels [Source:UniProt... [more]
shw-33.821e-3531.38SHaW family of potassium channels [Source:UniProt... [more]
shw-33.986e-3531.38SHaW family of potassium channels [Source:UniProt... [more]
shl-15.774e-2525.97SHaL family of potassium channels [Source:UniProt... [more]
shw-19.117e-1938.89SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shab4.840e-2326.36gene:FBgn0262593 transcript:FBtr0305207[more]
Shab9.405e-2326.36gene:FBgn0262593 transcript:FBtr0305203[more]
Shawl2.111e-1940.31gene:FBgn0085395 transcript:FBtr0332598[more]
Shawl2.762e-1940.31gene:FBgn0085395 transcript:FBtr0308029[more]
Shaw5.095e-1840.19gene:FBgn0003386 transcript:FBtr0332184[more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc23.526e-3930.16potassium voltage-gated channel, Shaw-related subf... [more]
kcnc24.315e-3930.16potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1b1.423e-3828.09potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1b1.423e-3828.09potassium voltage-gated channel, Shaw-related subf... [more]
kcnc44.638e-3628.73potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC23.885e-3629.02potassium channel, voltage gated Shaw related subf... [more]
KCNC24.646e-3628.41potassium channel, voltage gated Shaw related subf... [more]
tamm413.332e-3328.28TAM41 mitochondrial translocator assembly and main... [more]
tamm413.504e-3328.28TAM41 mitochondrial translocator assembly and main... [more]
tamm413.892e-3328.28TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnb18.678e-3130.39potassium voltage gated channel, Shab-related subf... [more]
Kcnb18.678e-3130.39potassium voltage gated channel, Shab-related subf... [more]
Kcnb27.691e-3029.93potassium voltage gated channel, Shab-related subf... [more]
Kcnb27.691e-3029.93potassium voltage gated channel, Shab-related subf... [more]
Kcnd11.744e-2527.06potassium voltage-gated channel, Shal-related fami... [more]
back to top
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18868|KCNB1_PIG1.414e-3030.61Potassium voltage-gated channel subfamily B member... [more]
sp|P15387|KCNB1_RAT4.782e-3030.39Potassium voltage-gated channel subfamily B member... [more]
sp|Q14721|KCNB1_HUMAN5.051e-3030.39Potassium voltage-gated channel subfamily B member... [more]
sp|Q03717|KCNB1_MOUSE6.070e-3030.39Potassium voltage-gated channel subfamily B member... [more]
sp|Q9MZ19|KCNB1_RABIT7.996e-3030.39Potassium voltage-gated channel subfamily B member... [more]
back to top
BLAST of Voltage gated potassium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PK231.822e-4330.70BTB domain-containing protein OS=Pomacea canalicul... [more]
A0A2R2MQY63.592e-4030.44potassium voltage-gated channel subfamily C member... [more]
Q4S1G41.718e-3828.22Chromosome 13 SCAF14769, whole genome shotgun sequ... [more]
A0A3P8PJ582.750e-3828.44Potassium voltage-gated channel, Shaw-related subf... [more]
A0A3B4GQW12.750e-3828.44Potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1b2.046e-3727.38potassium voltage-gated channel subfamily C member... [more]
kcnc1b3.493e-3726.92potassium voltage-gated channel subfamily C member... [more]
kcnc24.535e-3629.09potassium voltage-gated channel, Shaw-related subf... [more]
kcnc23.498e-3528.93potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a1.079e-3426.44potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a3.459e-3429.20potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000004235.15.316e-2928.85pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
kcnf1b9.195e-2224.18potassium voltage-gated channel, subfamily F, memb... [more]
KCNA35.736e-1925.95potassium voltage-gated channel subfamily A member... [more]
kcna1b9.333e-1928.22potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398044.568e-4030.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382373.657e-3527.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480673.670e-3429.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480663.725e-3431.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427245.865e-3230.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc22.501e-3729.38potassium voltage-gated channel subfamily C member... [more]
kcnc1b3.381e-3726.64potassium voltage-gated channel subfamily C member... [more]
kcnc1b5.583e-3726.64potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000045623.19.272e-3627.78potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000007744.23.340e-3528.54potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075712.10.000e+0100.00SMESG000075712.1[more]
SMESG000075712.10.000e+086.15SMESG000075712.1[more]
SMESG000075712.10.000e+099.42SMESG000075712.1[more]
SMESG000075613.11.188e-12748.23SMESG000075613.1[more]
SMESG000075700.12.110e-11938.91SMESG000075700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018771 ID=SMED30018771|Name=Voltage gated potassium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=2096bp
CAATTATGTATTTAATAAAAATAAATATTAAAAAATAAAAATTATTCTAT
CAAAATGGACCCAACTAATAGACGAACCTCTAAATTATTTACATTTGAAA
ATCCAACTTTTGAGTTTAAAAATGCTACCAGCACCAAACCTCCCAGAAAA
CCTCAAAATTCTTTCGAAGAAAAGCTGACGAAATCAAAGAAACAGCCGTT
ATATAAAGACCAGAAAAACCCCTTTGGGACGATTAATTCCCAAAATGAGG
ATTTCTTACCAGTTGAGGAAGTAATTAGATTTGACACAAGCGAAAGTGAT
GACTTGTTTGCTCCTAGTCCGATCATGGATTTTCAAGACATTAAAAAGAG
GCGGATTTCGAAAAAGTTCATGAACAATCGAATAAACATGAATCGAAAAT
CATTCAATGATGTATTCAATGCGGACATTCTCTTCATTACTGACCAAGTA
AAAGAAAATCGTCTTCAAGACAAAGTGAAAAGAGAAAGCTTTGGATTGTT
TGATATTGAAGCTGATAGAAATACTTTCAAAAAAGTCAATATCTTACGAT
ACAGGGAAAATGTTTTTCGAGCTGCTGCTAGAATAACAAGAGATTTACCT
CCATTTCCGCATTGGATTTATCGAGATAAGCCTGAAGAAAAATTGGAACG
TGTGACCTTCATTGTTGGTGGGACTCAATTTCAAAGTTTCATTGAAACGA
TTGTCCACATTCCAAACTCCAAATTAGCCACATGCGTAATTGAAAAATCT
GGAGAACTGATTTTATTTTTTGATCGGGATCCGGATTGTTTTAATTACGT
TTTGAATTTTTATCGAACAGGACGATTACATGCTCCTTCAAATGGTTGCT
TGTCATTTTTTGAGGAAGAGTTGGAATTTTGGGGAATCAATGAAGAATTC
ATGGAACCCTGTTGTTATAGTCAATATATGGCTTACAAAGTGGCTTGTAA
CACATTGAAGAAATTTTCTGAGTCAAAGGAAAAGTGCGTATACTCAAACA
AAAACGCTACAGCGTTTGAAAAATGGAAAACGCATCTTTATTTGGCCTTT
GTAGTTGGCGATAAGACAATTATTTCGCAGTGGTATTCTATTATAACGGC
TGCTTGCATAATAGCTGCTATAATGATAATGTTCTTAGGAACATCGGCGT
TTGGAAGAATAGATTTAAAAAGGCAAAAGTTCCGTGAATTATACAAAAAT
GAGTCTATTTTGAATTATTTCGAAGACACTGGAATTTTGTACGAATTGAT
TATCGTAGAGCTTGCGCTGGCGGGATATTTCATGGCAGACATTATTCTTC
GGTGCTTCTTATCGCCCAATAGATTCGTATTTTTCACAGACACCATCAAT
TGGATAGACATTTTGGCGACAACGAGCTCCTTGATATCCACTCTGTTGTA
CAGTGAAATGGCGACCGGTTTCAATGAAGCTTACGTAATCATTTTGAAAA
TTCCCCGAATCTTTCGATTGTTTAAGTTGACAGCAAATTTAAAAAGTGGA
ATGGACGCCATAATCCTGACGATTCGTGCTTCTACGGACGATTTGCTTTT
GGTTTTTCTAATTGTAGTGATATTCATTTCGTTTTTCGGAGTTTTGATCT
TTGTAATTGAACTGGTCAACGAAATAGACGAGCCAAGCAAATTTAAAACA
ATTTATATAGGAATGTGGTGGGCTATTGTCACAATGGCAACAGTGGGATA
CGGTGATTATATTCCTGACACTCAAGGTGGATACGTTGTTGGCTGTATTT
GTATTTTATTTGGGATTATTATCTGTCAACTACCAGTTCCGATTTTTTTG
AGAAATTTCTCAATTTACTACAATCAAGCCCAATCGAGGCTCACGCATCA
ATCTAAAGTTTTGACAATTTCAATGGATCCCGAAAGTATGAAAGAATCCG
AAACGAATGAAGAAGATAGCAATCGGATTTCACTAGCAAAACATTTGACG
AAAGAATAGAAATTCTCGAATTTTCTTAGAGAGAGCAAGTTCTCTTTTAA
ATATTAAAATTAACTTTGAGTAAAATATTTCAAAATCATTCACTGTACTA
AATTGGATAAAAAATAAATATTATACAATATATATGTAAAAAAAAA
back to top

protein sequence of SMED30018771-orf-1

>SMED30018771-orf-1 ID=SMED30018771-orf-1|Name=SMED30018771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=635bp
MDPTNRRTSKLFTFENPTFEFKNATSTKPPRKPQNSFEEKLTKSKKQPLY
KDQKNPFGTINSQNEDFLPVEEVIRFDTSESDDLFAPSPIMDFQDIKKRR
ISKKFMNNRINMNRKSFNDVFNADILFITDQVKENRLQDKVKRESFGLFD
IEADRNTFKKVNILRYRENVFRAAARITRDLPPFPHWIYRDKPEEKLERV
TFIVGGTQFQSFIETIVHIPNSKLATCVIEKSGELILFFDRDPDCFNYVL
NFYRTGRLHAPSNGCLSFFEEELEFWGINEEFMEPCCYSQYMAYKVACNT
LKKFSESKEKCVYSNKNATAFEKWKTHLYLAFVVGDKTIISQWYSIITAA
CIIAAIMIMFLGTSAFGRIDLKRQKFRELYKNESILNYFEDTGILYELII
VELALAGYFMADIILRCFLSPNRFVFFTDTINWIDILATTSSLISTLLYS
EMATGFNEAYVIILKIPRIFRLFKLTANLKSGMDAIILTIRASTDDLLLV
FLIVVIFISFFGVLIFVIELVNEIDEPSKFKTIYIGMWWAIVTMATVGYG
DYIPDTQGGYVVGCICILFGIIICQLPVPIFLRNFSIYYNQAQSRLTHQS
KVLTISMDPESMKESETNEEDSNRISLAKHLTKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR003968K_chnl_volt-dep_Kv
IPR028325VG_K_chnl
IPR003974K_chnl_volt-dep_Kv3
IPR000210BTB/POZ_dom
IPR003131T1-type_BTB
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 270..291
score: 59.6
coord: 237..250
score: 55.95
coord: 252..267
score: 50.35
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 466..492
score: 24.21
coord: 559..585
score: 40.17
coord: 495..518
score: 20.7
coord: 530..552
score: 59.39
coord: 335..363
score: 16.1
coord: 400..423
score: 27.06
coord: 426..446
score: 30.29
coord: 236..255
score: 49.02
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 188..305
e-value: 7.7E-29
score: 101.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 480..593
e-value: 1.0E-22
score: 81.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 611..634
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 20..58
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 612..634
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 33..50
NoneNo IPR availablePANTHERPTHR11537:SF252SHAW-LIKE, ISOFORM Ccoord: 198..600
NoneNo IPR availableCDDcd18379BTB_POZ_Kv3_KCNCcoord: 204..301
e-value: 1.62258E-28
score: 107.866
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 341..586
NoneNo IPR availableTMHMMTMhelixcoord: 560..582
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
NoneNo IPR availableTMHMMTMhelixcoord: 497..519
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
NoneNo IPR availableTMHMMTMhelixcoord: 534..553
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 471..479
score: 40.46
coord: 494..508
score: 33.28
coord: 570..581
score: 40.42
coord: 236..246
score: 53.18
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 198..294
e-value: 0.0032
score: 26.7
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 203..286
e-value: 1.2E-18
score: 67.2
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 343..591
e-value: 1.1E-20
score: 73.9
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 312..477
e-value: 7.2E-18
score: 66.5
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 198..600
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 198..294