Small ubiquitin-related modifier

Overview
NameSmall ubiquitin-related modifier
Smed IDSMED30018755
Length (bp)538
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small ubiquitin-related modifier (SMED30018755) t-SNE clustered cells

Violin plots show distribution of expression levels for Small ubiquitin-related modifier (SMED30018755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small ubiquitin-related modifier (SMED30018755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small ubiquitin-related modifier (SMED30018755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018755SMESG000018835.1 SmedASXL_018832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018755SMESG000018835.1 dd_Smed_v4_1253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018755SMESG000018835.1 Contig3185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018755SMESG000018835.1 Contig3185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018755SMESG000060821.1 Contig3185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018755SMESG000060821.1 Contig3185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30018755SMESG000018835.1 dd_Smed_v6_1253_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small ubiquitin-related modifier vs. Ensembl Human
Match: SUMO3 (small ubiquitin like modifier 3 [Source:HGNC Symbol;Acc:HGNC:11124])

HSP 1 Score: 107.842 bits (268), Expect = 2.506e-30
Identity = 48/78 (61.54%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of Small ubiquitin-related modifier vs. Ensembl Human
Match: SUMO2 (small ubiquitin like modifier 2 [Source:HGNC Symbol;Acc:HGNC:11125])

HSP 1 Score: 107.457 bits (267), Expect = 2.726e-30
Identity = 54/93 (58.06%), Postives = 66/93 (70.97%), Query Frame = 3
Query:   45 MAD---KEGTP----EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            MAD   KEG      +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:    1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Human
Match: SUMO4 (small ubiquitin like modifier 4 [Source:HGNC Symbol;Acc:HGNC:21181])

HSP 1 Score: 96.2857 bits (238), Expect = 6.932e-26
Identity = 44/77 (57.14%), Postives = 53/77 (68.83%), Query Frame = 3
Query:   72 HINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            HIN+KV GQDG+V+ FKIK+ T L KLM AYC+  GL    +RF F G  I  TD P  L+ME+ DTI+VFQ  TGG
Sbjct:   17 HINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Human
Match: SUMO1 (small ubiquitin like modifier 1 [Source:HGNC Symbol;Acc:HGNC:12502])

HSP 1 Score: 90.1225 bits (222), Expect = 2.531e-23
Identity = 43/99 (43.43%), Postives = 61/99 (61.62%), Query Frame = 3
Query:   45 MADKEGTP-----------EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            M+D+E  P           E+I +KV GQD + IHFK+K  T L+KL  +YC R G+  +++RF+F+G  I +  +P  L MEE D IEV+Q QTGG +
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHS 99          
BLAST of Small ubiquitin-related modifier vs. Ensembl Human
Match: SUMO1 (small ubiquitin like modifier 1 [Source:HGNC Symbol;Acc:HGNC:12502])

HSP 1 Score: 90.1225 bits (222), Expect = 2.531e-23
Identity = 43/99 (43.43%), Postives = 61/99 (61.62%), Query Frame = 3
Query:   45 MADKEGTP-----------EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            M+D+E  P           E+I +KV GQD + IHFK+K  T L+KL  +YC R G+  +++RF+F+G  I +  +P  L MEE D IEV+Q QTGG +
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHS 99          
BLAST of Small ubiquitin-related modifier vs. Ensembl Celegans
Match: smo-1 (Small ubiquitin-related modifier [Source:UniProtKB/Swiss-Prot;Acc:P55853])

HSP 1 Score: 87.0409 bits (214), Expect = 1.176e-22
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 3
Query:   66 PEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
             E+I +KV GQD   +HF++K  T++ KL  +Y DR G+  +++RF+FDG  I + D+P +L+ME++D IEV+Q Q GG
Sbjct:   12 AEYIKIKVVGQDSNEVHFRVKYGTSMAKLKKSYADRTGVAVNSLRFLFDGRRINDDDTPKTLEMEDDDVIEVYQEQLGG 90          
BLAST of Small ubiquitin-related modifier vs. Ensembl Fly
Match: smt3 (gene:FBgn0264922 transcript:FBtr0346716)

HSP 1 Score: 121.709 bits (304), Expect = 3.528e-36
Identity = 58/84 (69.05%), Postives = 65/84 (77.38%), Query Frame = 3
Query:   54 KEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            K G  EHIN+KV GQD AV+ FKIKK+T LRKLMNAYCDR GL    VRF FDG  I E D+PTSL+MEE DTIEV+Q QTGG+
Sbjct:    6 KGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGA 89          
BLAST of Small ubiquitin-related modifier vs. Ensembl Fly
Match: smt3 (gene:FBgn0264922 transcript:FBtr0079356)

HSP 1 Score: 121.709 bits (304), Expect = 3.528e-36
Identity = 58/84 (69.05%), Postives = 65/84 (77.38%), Query Frame = 3
Query:   54 KEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            K G  EHIN+KV GQD AV+ FKIKK+T LRKLMNAYCDR GL    VRF FDG  I E D+PTSL+MEE DTIEV+Q QTGG+
Sbjct:    6 KGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGA 89          
BLAST of Small ubiquitin-related modifier vs. Ensembl Zebrafish
Match: sumo3b (small ubiquitin like modifier 3b [Source:NCBI gene;Acc:436950])

HSP 1 Score: 109.383 bits (272), Expect = 3.059e-31
Identity = 49/80 (61.25%), Postives = 61/80 (76.25%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS 
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSC 94          
BLAST of Small ubiquitin-related modifier vs. Ensembl Zebrafish
Match: sumo3a (small ubiquitin like modifier 3a [Source:NCBI gene;Acc:406398])

HSP 1 Score: 109.383 bits (272), Expect = 3.562e-31
Identity = 49/80 (61.25%), Postives = 61/80 (76.25%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS 
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSC 94          
BLAST of Small ubiquitin-related modifier vs. Ensembl Zebrafish
Match: sumo2b (small ubiquitin like modifier 2b [Source:NCBI gene;Acc:445027])

HSP 1 Score: 107.071 bits (266), Expect = 2.817e-30
Identity = 48/78 (61.54%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:   16 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLTMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Zebrafish
Match: sumo2b (small ubiquitin like modifier 2b [Source:NCBI gene;Acc:445027])

HSP 1 Score: 107.071 bits (266), Expect = 2.817e-30
Identity = 48/78 (61.54%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:   16 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLTMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Zebrafish
Match: sumo2a (small ubiquitin like modifier 2a [Source:ZFIN;Acc:ZDB-GENE-120215-155])

HSP 1 Score: 103.219 bits (256), Expect = 8.841e-29
Identity = 45/77 (58.44%), Postives = 56/77 (72.73%), Query Frame = 3
Query:   72 HINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            HIN++V  QDG+V+ FKIKK+  L KLM  YCDR GL    +RF+FDG +IKETD+P  L+ME+ D IEVFQ Q  G
Sbjct:    9 HINLRVSSQDGSVVQFKIKKHAPLSKLMKVYCDRQGLTRKLIRFMFDGESIKETDTPALLEMEDEDAIEVFQEQLAG 85          
BLAST of Small ubiquitin-related modifier vs. Ensembl Xenopus
Match: sumo3 (small ubiquitin like modifier 3 [Source:NCBI gene;Acc:100125978])

HSP 1 Score: 109.383 bits (272), Expect = 4.763e-31
Identity = 49/78 (62.82%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYCDR GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:    9 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 86          
BLAST of Small ubiquitin-related modifier vs. Ensembl Xenopus
Match: sumo2 (small ubiquitin-like modifier 2 [Source:NCBI gene;Acc:549160])

HSP 1 Score: 109.383 bits (272), Expect = 5.699e-31
Identity = 55/94 (58.51%), Postives = 67/94 (71.28%), Query Frame = 3
Query:   45 MAD---KEGTP----EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            MAD   KEG      +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS
Sbjct:    1 MADDKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 94          
BLAST of Small ubiquitin-related modifier vs. Ensembl Xenopus
Match: sumo3 (small ubiquitin like modifier 3 [Source:NCBI gene;Acc:100125978])

HSP 1 Score: 108.997 bits (271), Expect = 6.002e-31
Identity = 49/78 (62.82%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYCDR GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:   11 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 88          
BLAST of Small ubiquitin-related modifier vs. Ensembl Xenopus
Match: sumo3 (small ubiquitin like modifier 3 [Source:NCBI gene;Acc:100125978])

HSP 1 Score: 108.997 bits (271), Expect = 6.173e-31
Identity = 49/78 (62.82%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYCDR GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of Small ubiquitin-related modifier vs. Ensembl Xenopus
Match: sumo2 (small ubiquitin-like modifier 2 [Source:NCBI gene;Acc:549160])

HSP 1 Score: 109.383 bits (272), Expect = 6.191e-31
Identity = 49/79 (62.03%), Postives = 61/79 (77.22%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS
Sbjct:   26 DHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 104          
BLAST of Small ubiquitin-related modifier vs. Ensembl Mouse
Match: Sumo3 (small ubiquitin-like modifier 3 [Source:MGI Symbol;Acc:MGI:1336201])

HSP 1 Score: 112.464 bits (280), Expect = 4.657e-32
Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGSA
Sbjct:   18 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSA 97          
BLAST of Small ubiquitin-related modifier vs. Ensembl Mouse
Match: Sumo3 (small ubiquitin-like modifier 3 [Source:MGI Symbol;Acc:MGI:1336201])

HSP 1 Score: 112.079 bits (279), Expect = 5.478e-32
Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGSA
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSA 94          
BLAST of Small ubiquitin-related modifier vs. Ensembl Mouse
Match: Sumo3 (small ubiquitin-like modifier 3 [Source:MGI Symbol;Acc:MGI:1336201])

HSP 1 Score: 111.694 bits (278), Expect = 6.808e-32
Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGSA
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSA 94          
BLAST of Small ubiquitin-related modifier vs. Ensembl Mouse
Match: Sumo2 (small ubiquitin-like modifier 2 [Source:MGI Symbol;Acc:MGI:2158813])

HSP 1 Score: 107.457 bits (267), Expect = 1.872e-30
Identity = 54/93 (58.06%), Postives = 66/93 (70.97%), Query Frame = 3
Query:   45 MAD---KEGTP----EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            MAD   KEG      +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:    1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Mouse
Match: Sumo1 (small ubiquitin-like modifier 1 [Source:MGI Symbol;Acc:MGI:1197010])

HSP 1 Score: 90.1225 bits (222), Expect = 1.737e-23
Identity = 43/99 (43.43%), Postives = 61/99 (61.62%), Query Frame = 3
Query:   45 MADKEGTP-----------EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            M+D+E  P           E+I +KV GQD + IHFK+K  T L+KL  +YC R G+  +++RF+F+G  I +  +P  L MEE D IEV+Q QTGG +
Sbjct:    1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHS 99          
BLAST of Small ubiquitin-related modifier vs. UniProt/SwissProt
Match: sp|Q9Z172|SUMO3_MOUSE (Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.762e-31
Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGSA
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSA 94          
BLAST of Small ubiquitin-related modifier vs. UniProt/SwissProt
Match: sp|Q5XIF4|SUMO3_RAT (Small ubiquitin-related modifier 3 OS=Rattus norvegicus OX=10116 GN=Sumo3 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.308e-30
Identity = 49/80 (61.25%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG+A
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGTA 94          
BLAST of Small ubiquitin-related modifier vs. UniProt/SwissProt
Match: sp|Q6DI05|SUMO3_DANRE (Small ubiquitin-related modifier 3 OS=Danio rerio OX=7955 GN=sumo3 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.899e-30
Identity = 49/80 (61.25%), Postives = 61/80 (76.25%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS 
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSC 94          
BLAST of Small ubiquitin-related modifier vs. UniProt/SwissProt
Match: sp|Q17QV3|SUMO3_BOVIN (Small ubiquitin-related modifier 3 OS=Bos taurus OX=9913 GN=SUMO3 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.620e-30
Identity = 50/86 (58.14%), Postives = 63/86 (73.26%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA*MTLLF 326
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS   + L 
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSRVASCLL 100          
BLAST of Small ubiquitin-related modifier vs. UniProt/SwissProt
Match: sp|Q6GPW2|SMO2B_XENLA (Small ubiquitin-related modifier 2-B OS=Xenopus laevis OX=8355 GN=sumo2-b PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.621e-30
Identity = 55/94 (58.51%), Postives = 67/94 (71.28%), Query Frame = 3
Query:   45 MAD---KEGTP----EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            MAD   KEG      +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS
Sbjct:    1 MADDKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 94          
BLAST of Small ubiquitin-related modifier vs. TrEMBL
Match: A0A267EYF5 (Small ubiquitin-related modifier (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002796g1 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 6.552e-41
Identity = 64/91 (70.33%), Postives = 75/91 (82.42%), Query Frame = 3
Query:   30 FEIFNMADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +   +M+    + EHIN+KVQGQDGAVIHFKIKKNT LRKLM  YCDRLGL+  TVRFIFDG N++E+D+P +LDMEENDTIEVFQSQ GG
Sbjct:    8 YSAASMSGTNASSEHINLKVQGQDGAVIHFKIKKNTPLRKLMTTYCDRLGLRAQTVRFIFDGNNVEESDTPATLDMEENDTIEVFQSQVGG 98          
BLAST of Small ubiquitin-related modifier vs. TrEMBL
Match: A0A267EXW6 (Small ubiquitin-related modifier (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002796g2 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 8.724e-41
Identity = 64/91 (70.33%), Postives = 75/91 (82.42%), Query Frame = 3
Query:   30 FEIFNMADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +   +M+    + EHIN+KVQGQDGAVIHFKIKKNT LRKLM  YCDRLGL+  TVRFIFDG N++E+D+P +LDMEENDTIEVFQSQ GG
Sbjct:    7 YSAASMSGTNASSEHINLKVQGQDGAVIHFKIKKNTPLRKLMTTYCDRLGLRAQTVRFIFDGNNVEESDTPATLDMEENDTIEVFQSQVGG 97          
BLAST of Small ubiquitin-related modifier vs. TrEMBL
Match: A0A267E716 (Small ubiquitin-related modifier OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021607g1 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.809e-40
Identity = 64/86 (74.42%), Postives = 73/86 (84.88%), Query Frame = 3
Query:   45 MADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            M+    + EHIN+KVQGQDGAVIHFKIKKNT LRKLM  YCDRLGL+  TVRFIFDG N++E+D+P +LDMEENDTIEVFQSQ GG
Sbjct:    1 MSGTNASSEHINLKVQGQDGAVIHFKIKKNTPLRKLMTTYCDRLGLRAQTVRFIFDGNNVEESDTPATLDMEENDTIEVFQSQVGG 86          
BLAST of Small ubiquitin-related modifier vs. TrEMBL
Match: A0A1I8IUK5 (Small ubiquitin-related modifier OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.285e-40
Identity = 64/86 (74.42%), Postives = 73/86 (84.88%), Query Frame = 3
Query:   45 MADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            M+    + EHIN+KVQGQDGAVIHFKIKKNT LRKLM  YCDRLGL+  TVRFIFDG N++E+D+P +LDMEENDTIEVFQSQ GG
Sbjct:    1 MSGTNASSEHINLKVQGQDGAVIHFKIKKNTPLRKLMTTYCDRLGLRAQTVRFIFDGNNVEESDTPATLDMEENDTIEVFQSQVGG 86          
BLAST of Small ubiquitin-related modifier vs. TrEMBL
Match: Q5BS96 (Small ubiquitin-related modifier OS=Schistosoma japonicum OX=6182 GN=SUMO-2 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.479e-39
Identity = 62/85 (72.94%), Postives = 75/85 (88.24%), Query Frame = 3
Query:   48 ADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            A+KE   EHIN+KVQGQ+G++IHFKI+KNT LRKLM AYC+RLGLK  +VRFIFDG ++ ETD+P SL+MEENDTIEVFQ+QTGG
Sbjct:    5 ANKEAPSEHINIKVQGQEGSIIHFKIRKNTPLRKLMLAYCERLGLKQPSVRFIFDGNSVHETDTPASLEMEENDTIEVFQTQTGG 89          
BLAST of Small ubiquitin-related modifier vs. Ensembl Cavefish
Match: ENSAMXT00000057127.1 (small ubiquitin-related modifier 2-like [Source:NCBI gene;Acc:103045390])

HSP 1 Score: 109.768 bits (273), Expect = 2.101e-31
Identity = 49/79 (62.03%), Postives = 61/79 (77.22%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            EHIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG+
Sbjct:   16 EHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLTMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGA 94          
BLAST of Small ubiquitin-related modifier vs. Ensembl Cavefish
Match: ENSAMXT00000035970.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000157.1:639445:644773:-1 gene:ENSAMXG00000037441.1 transcript:ENSAMXT00000035970.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 2.459e-31
Identity = 49/79 (62.03%), Postives = 61/79 (77.22%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS
Sbjct:    9 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 87          
BLAST of Small ubiquitin-related modifier vs. Ensembl Cavefish
Match: ENSAMXT00000038721.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000157.1:639445:644645:-1 gene:ENSAMXG00000037441.1 transcript:ENSAMXT00000038721.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 3.895e-31
Identity = 54/101 (53.47%), Postives = 70/101 (69.31%), Query Frame = 3
Query:   12 LHLSFKFEIFNMADKEGTP---EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            LH+S  +   +   +EG     +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGGS
Sbjct:   30 LHVSLCYISPSFLLQEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 130          
BLAST of Small ubiquitin-related modifier vs. Ensembl Cavefish
Match: sumo2b (small ubiquitin like modifier 2 [Source:NCBI gene;Acc:103044284])

HSP 1 Score: 107.071 bits (266), Expect = 2.586e-30
Identity = 48/78 (61.54%), Postives = 60/78 (76.92%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:   16 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLTMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Cavefish
Match: ENSAMXT00000052373.1 (small ubiquitin-related modifier 2-like [Source:NCBI gene;Acc:103045390])

HSP 1 Score: 72.7886 bits (177), Expect = 3.349e-17
Identity = 43/94 (45.74%), Postives = 53/94 (56.38%), Query Frame = 3
Query:   45 MAD---KEGTP----EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            MAD   KEG      EHIN+KV GQDG+V+ FKIK++T L KLM AYC+R                         L+ME+ DTI+VFQ QTGG+
Sbjct:    1 MADEKPKEGVKTENNEHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER------------------------QLEMEDEDTIDVFQQQTGGA 70          
BLAST of Small ubiquitin-related modifier vs. Ensembl Yeast
Match: SMT3 (Ubiquitin-like protein of the SUMO family; conjugated to lysine residues of target proteins; associates with transcriptionally active genes; regulates chromatid cohesion, chromosome segregation, APC-mediated proteolysis, DNA replication and septin ring dynamics; human homolog SUMO1 can complement yeast null mutant [Source:SGD;Acc:S000002918])

HSP 1 Score: 78.5666 bits (192), Expect = 5.415e-20
Identity = 43/97 (44.33%), Postives = 59/97 (60.82%), Query Frame = 3
Query:   33 EIFNMADKEGTPE-----HINVKVQGQDGAV-IHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGS 305
            E+   A  E  PE     HIN+KV   DG+  I FKIKK T LR+LM A+  R G +  ++RF++DG+ I+   +P  LDME+ND IE  + Q GG+
Sbjct:    5 EVNQEAKPEVKPEVKPETHINLKVS--DGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGA 99          
BLAST of Small ubiquitin-related modifier vs. Ensembl Nematostella
Match: EDO45837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRX5])

HSP 1 Score: 74.3294 bits (181), Expect = 3.487e-18
Identity = 38/69 (55.07%), Postives = 52/69 (75.36%), Query Frame = 3
Query:   96 QDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            QD + +HFKIKK T L+KL  AYCDR G++ ++VRF+FDG  I +  +P  L+ME++D IEV+Q QTGG
Sbjct:    7 QDNSEVHFKIKKTTQLKKLKAAYCDRQGVQMNSVRFLFDGQRINDDQTPKQLEMEDDDVIEVYQEQTGG 75          
BLAST of Small ubiquitin-related modifier vs. Ensembl Medaka
Match: sumo2 (small ubiquitin-related modifier 2 [Source:NCBI gene;Acc:100335140])

HSP 1 Score: 112.849 bits (281), Expect = 1.450e-32
Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            EHIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P+ L+ME+ DTI+VFQ QTGGS 
Sbjct:   13 EHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPSQLEMEDEDTIDVFQQQTGGSP 92          
BLAST of Small ubiquitin-related modifier vs. Ensembl Medaka
Match: sumo2 (small ubiquitin-related modifier 2 [Source:NCBI gene;Acc:100335140])

HSP 1 Score: 112.464 bits (280), Expect = 1.862e-32
Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            EHIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P+ L+ME+ DTI+VFQ QTGGS 
Sbjct:   16 EHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPSQLEMEDEDTIDVFQQQTGGSP 95          
BLAST of Small ubiquitin-related modifier vs. Ensembl Medaka
Match: sumo2 (small ubiquitin like modifier 2 [Source:NCBI gene;Acc:100335143])

HSP 1 Score: 108.227 bits (269), Expect = 8.670e-31
Identity = 55/93 (59.14%), Postives = 66/93 (70.97%), Query Frame = 3
Query:   45 MAD---KEGTP----EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            MAD   KEG      EHIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG
Sbjct:    1 MADEKPKEGVKTENNEHINLKVAGQDGSVVQFKIKRHTPLIKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of Small ubiquitin-related modifier vs. Ensembl Medaka
Match: sumo4 (small ubiquitin-related modifier 4 [Source:NCBI gene;Acc:100335145])

HSP 1 Score: 108.227 bits (269), Expect = 1.213e-30
Identity = 52/92 (56.52%), Postives = 63/92 (68.48%), Query Frame = 3
Query:   54 KEGTPE-------HINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            K  TPE       HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG  
Sbjct:   10 KSETPEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGKC 101          
BLAST of Small ubiquitin-related modifier vs. Ensembl Medaka
Match: sumo4 (small ubiquitin-related modifier 4 [Source:NCBI gene;Acc:100335145])

HSP 1 Score: 107.457 bits (267), Expect = 1.565e-30
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            +HIN+KV GQDG+V+ FKIK++T L KLM AYC+R GL    +RF FDG  I ETD+P  L+ME+ DTI+VFQ QTGG  
Sbjct:   15 DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGKC 94          
BLAST of Small ubiquitin-related modifier vs. Planmine SMEST
Match: SMESG000018835.1 (SMESG000018835.1)

HSP 1 Score: 184.111 bits (466), Expect = 6.015e-61
Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 3
Query:   45 MADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 308
            MADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA
Sbjct:    1 MADKEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGGSA 88          
BLAST of Small ubiquitin-related modifier vs. Planmine SMEST
Match: SMESG000056595.1 (SMESG000056595.1)

HSP 1 Score: 171.014 bits (432), Expect = 1.135e-55
Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 3
Query:   45 MAD--KEGTPEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDSPTSLDMEENDTIEVFQSQTGG 302
            MAD  KEGT EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETD+PTSLDMEENDTIEVFQSQTGG
Sbjct:    1 MADNNKEGTAEHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKTSTVRFIFDGVNIKETDTPTSLDMEENDTIEVFQSQTGG 88          
BLAST of Small ubiquitin-related modifier vs. Planmine SMEST
Match: SMESG000026971.1 (SMESG000026971.1)

HSP 1 Score: 48.1358 bits (113), Expect = 7.010e-7
Identity = 23/72 (31.94%), Postives = 42/72 (58.33%), Query Frame = 3
Query:   69 EHINVKVQGQDGAVIHFKIKKNTALRKLMNAYCDRLGLKT-STVRFIFDGVNIKETDSPTSLDMEENDTIEV 281
            E IN+  Q  DG  + FK ++   +R  M A+  R+G  +   ++FI++G +I   ++P+SL+M  +  I+V
Sbjct:  187 EWINLYFQFPDGHKMRFKTRRKAMMRHSMEAFSARMGYSSIHDLKFIYNGSDIYYNETPSSLNMASDALIQV 258          
The following BLAST results are available for this feature:
BLAST of Small ubiquitin-related modifier vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUMO32.506e-3061.54small ubiquitin like modifier 3 [Source:HGNC Symbo... [more]
SUMO22.726e-3058.06small ubiquitin like modifier 2 [Source:HGNC Symbo... [more]
SUMO46.932e-2657.14small ubiquitin like modifier 4 [Source:HGNC Symbo... [more]
SUMO12.531e-2343.43small ubiquitin like modifier 1 [Source:HGNC Symbo... [more]
SUMO12.531e-2343.43small ubiquitin like modifier 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smo-11.176e-2245.57Small ubiquitin-related modifier [Source:UniProtK... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smt33.528e-3669.05gene:FBgn0264922 transcript:FBtr0346716[more]
smt33.528e-3669.05gene:FBgn0264922 transcript:FBtr0079356[more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sumo3b3.059e-3161.25small ubiquitin like modifier 3b [Source:NCBI gene... [more]
sumo3a3.562e-3161.25small ubiquitin like modifier 3a [Source:NCBI gene... [more]
sumo2b2.817e-3061.54small ubiquitin like modifier 2b [Source:NCBI gene... [more]
sumo2b2.817e-3061.54small ubiquitin like modifier 2b [Source:NCBI gene... [more]
sumo2a8.841e-2958.44small ubiquitin like modifier 2a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sumo34.763e-3162.82small ubiquitin like modifier 3 [Source:NCBI gene;... [more]
sumo25.699e-3158.51small ubiquitin-like modifier 2 [Source:NCBI gene;... [more]
sumo36.002e-3162.82small ubiquitin like modifier 3 [Source:NCBI gene;... [more]
sumo36.173e-3162.82small ubiquitin like modifier 3 [Source:NCBI gene;... [more]
sumo26.191e-3162.03small ubiquitin-like modifier 2 [Source:NCBI gene;... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sumo34.657e-3262.50small ubiquitin-like modifier 3 [Source:MGI Symbol... [more]
Sumo35.478e-3262.50small ubiquitin-like modifier 3 [Source:MGI Symbol... [more]
Sumo36.808e-3262.50small ubiquitin-like modifier 3 [Source:MGI Symbol... [more]
Sumo21.872e-3058.06small ubiquitin-like modifier 2 [Source:MGI Symbol... [more]
Sumo11.737e-2343.43small ubiquitin-like modifier 1 [Source:MGI Symbol... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z172|SUMO3_MOUSE4.762e-3162.50Small ubiquitin-related modifier 3 OS=Mus musculus... [more]
sp|Q5XIF4|SUMO3_RAT1.308e-3061.25Small ubiquitin-related modifier 3 OS=Rattus norve... [more]
sp|Q6DI05|SUMO3_DANRE1.899e-3061.25Small ubiquitin-related modifier 3 OS=Danio rerio ... [more]
sp|Q17QV3|SUMO3_BOVIN2.620e-3058.14Small ubiquitin-related modifier 3 OS=Bos taurus O... [more]
sp|Q6GPW2|SMO2B_XENLA2.621e-3058.51Small ubiquitin-related modifier 2-B OS=Xenopus la... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EYF56.552e-4170.33Small ubiquitin-related modifier (Fragment) OS=Mac... [more]
A0A267EXW68.724e-4170.33Small ubiquitin-related modifier (Fragment) OS=Mac... [more]
A0A267E7161.809e-4074.42Small ubiquitin-related modifier OS=Macrostomum li... [more]
A0A1I8IUK52.285e-4074.42Small ubiquitin-related modifier OS=Macrostomum li... [more]
Q5BS961.479e-3972.94Small ubiquitin-related modifier OS=Schistosoma ja... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057127.12.101e-3162.03small ubiquitin-related modifier 2-like [Source:NC... [more]
ENSAMXT00000035970.12.459e-3162.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000038721.13.895e-3153.47pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
sumo2b2.586e-3061.54small ubiquitin like modifier 2 [Source:NCBI gene;... [more]
ENSAMXT00000052373.13.349e-1745.74small ubiquitin-related modifier 2-like [Source:NC... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SMT35.415e-2044.33Ubiquitin-like protein of the SUMO family; conjuga... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO458373.487e-1855.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sumo21.450e-3262.50small ubiquitin-related modifier 2 [Source:NCBI ge... [more]
sumo21.862e-3262.50small ubiquitin-related modifier 2 [Source:NCBI ge... [more]
sumo28.670e-3159.14small ubiquitin like modifier 2 [Source:NCBI gene;... [more]
sumo41.213e-3056.52small ubiquitin-related modifier 4 [Source:NCBI ge... [more]
sumo41.565e-3060.00small ubiquitin-related modifier 4 [Source:NCBI ge... [more]
back to top
BLAST of Small ubiquitin-related modifier vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018835.16.015e-61100.00SMESG000018835.1[more]
SMESG000056595.11.135e-5595.45SMESG000056595.1[more]
SMESG000026971.17.010e-731.94SMESG000026971.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018755 ID=SMED30018755|Name=Small ubiquitin-related modifier|organism=Schmidtea mediterranea sexual|type=transcript|length=538bp
AATTTGTTTAATTACACTTAAGTTTCAAATTTGAAATTTTTAACATGGCT
GATAAGGAAGGTACTCCAGAACATATTAATGTTAAAGTTCAGGGTCAAGA
CGGAGCAGTTATTCATTTCAAAATTAAAAAAAATACGGCTCTTCGTAAAT
TAATGAATGCTTATTGCGACCGACTAGGATTGAAAACTAGCACTGTTAGA
TTTATTTTTGATGGAGTTAATATTAAAGAAACTGATTCCCCTACATCACT
TGATATGGAAGAAAATGACACAATTGAAGTATTCCAAAGCCAGACCGGTG
GATCAGCTTAAATGACCCTTTTATTTTAGAAGTGCATTTATCCTAGATAT
GTATTAATAAATGTTAAAGTTTATTTTTATAAACTGTTTGTCCTGTATAT
TATTTATGTAATAAAAATATTGCTATTTAGACAGTGTTAATAAGATTGAT
AAATATAATGTTAGTTTTCTTTAAAATTCAGGCAATGCTGTTTCGACATT
TATTTACTTAAATAAATTATATTACGTTAAAGTTAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000626Ubiquitin-like_dom
IPR022617Rad60/SUMO-like_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0016925protein sumoylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000626Ubiquitin-like domainSMARTSM00213ubq_7coord: 11..82
e-value: 9.2E-6
score: 35.1
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 9..86
score: 14.208
IPR022617Rad60/SUMO-like domainPFAMPF11976Rad60-SLDcoord: 11..79
e-value: 2.2E-21
score: 75.5
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 8..87
e-value: 2.2E-31
score: 109.8
NoneNo IPR availablePANTHERPTHR10562SMALL UBIQUITIN-RELATED MODIFIERcoord: 8..87
NoneNo IPR availablePANTHERPTHR10562:SF74SMALL UBIQUITIN-RELATED MODIFIER 3-RELATEDcoord: 8..87
NoneNo IPR availableCDDcd16115Ubl_SUMO2_3_4coord: 10..81
e-value: 4.77201E-46
score: 139.81
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 6..86