GAS2 protein 1

Overview
NameGAS2 protein 1
Smed IDSMED30018744
Length (bp)1927
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GAS2 protein 1 (SMED30018744) t-SNE clustered cells

Violin plots show distribution of expression levels for GAS2 protein 1 (SMED30018744) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GAS2 protein 1 (SMED30018744) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GAS2 protein 1 (SMED30018744) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018744

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018744SMESG000041563.1 dd_Smed_v4_8709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018744SMESG000041563.1 dd_Smed_v4_8709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018744SMESG000041563.1 dd_Smed_v4_8709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018744SMESG000041563.1 dd_Smed_v4_8709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018744SMESG000041563.1 dd_Smed_v4_8709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018744SMESG000041563.1 dd_Smed_v4_8709_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GAS2 protein 1 vs. Ensembl Human
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 114.005 bits (284), Expect = 5.167e-27
Identity = 51/82 (62.20%), Postives = 61/82 (74.39%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPP 1455
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR +     +PP
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSST-AHRPP 284          

HSP 2 Score: 98.9821 bits (245), Expect = 7.591e-22
Identity = 67/180 (37.22%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL +WLN LY L          F + L  G  L +HAN+V   A      +           G  F    + P             SF  RDNVA FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGG--DGFLTGLATGTTLCQHANAVTEAARALAAARPAR--------GVAFQAHSVVP------------GSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Human
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 114.005 bits (284), Expect = 2.558e-26
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 98.9821 bits (245), Expect = 2.696e-21
Identity = 67/180 (37.22%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL +WLN LY L          F + L  G  L +HAN+V   A      +           G  F    + P             SF  RDNVA FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGG--DGFLTGLATGTTLCQHANAVTEAARALAAARPAR--------GVAFQAHSVVP------------GSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Human
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 114.775 bits (286), Expect = 6.147e-26
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 100.523 bits (249), Expect = 2.317e-21
Identity = 67/180 (37.22%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL +WLN LY L          F + L  G  L +HAN+V   A      +           G  F    + P             SF  RDNVA FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGG--DGFLTGLATGTTLCQHANAVTEAARALAAARPAR--------GVAFQAHSVVP------------GSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Human
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 114.775 bits (286), Expect = 6.147e-26
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 100.523 bits (249), Expect = 2.317e-21
Identity = 67/180 (37.22%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL +WLN LY L          F + L  G  L +HAN+V   A      +           G  F    + P             SF  RDNVA FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGG--DGFLTGLATGTTLCQHANAVTEAARALAAARPAR--------GVAFQAHSVVP------------GSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Human
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 114.775 bits (286), Expect = 6.147e-26
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 100.523 bits (249), Expect = 2.317e-21
Identity = 67/180 (37.22%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL +WLN LY L          F + L  G  L +HAN+V   A      +           G  F    + P             SF  RDNVA FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGG--DGFLTGLATGTTLCQHANAVTEAARALAAARPAR--------GVAFQAHSVVP------------GSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 1.542e-14
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQKPP 1455
            C C   + +++ISE  Y++GD      VRILR+ VMVRVGGGW++L+EFL KHD CR K R++I   P
Sbjct: 4736 CSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNINMFP 4803          
BLAST of GAS2 protein 1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 1.620e-14
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQKPP 1455
            C C   + +++ISE  Y++GD      VRILR+ VMVRVGGGW++L+EFL KHD CR K R++I   P
Sbjct: 4609 CSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNINMFP 4676          
BLAST of GAS2 protein 1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 78.1814 bits (191), Expect = 1.682e-14
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQKPP 1455
            C C   + +++ISE  Y++GD      VRILR+ VMVRVGGGW++L+EFL KHD CR K R++I   P
Sbjct: 4849 CSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNINMFP 4916          
BLAST of GAS2 protein 1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 77.7962 bits (190), Expect = 1.783e-14
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQKPP 1455
            C C   + +++ISE  Y++GD      VRILR+ VMVRVGGGW++L+EFL KHD CR K R++I   P
Sbjct: 4734 CSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNINMFP 4801          
BLAST of GAS2 protein 1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 77.7962 bits (190), Expect = 1.783e-14
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQKPP 1455
            C C   + +++ISE  Y++GD      VRILR+ VMVRVGGGW++L+EFL KHD CR K R++I   P
Sbjct: 4745 CSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNINMFP 4812          
BLAST of GAS2 protein 1 vs. Ensembl Fly
Match: pigs (gene:FBgn0029881 transcript:FBtr0308653)

HSP 1 Score: 117.857 bits (294), Expect = 5.425e-27
Identity = 68/182 (37.36%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQV 690
            ++P   F   +EY++AM EDL +WL+ LY    E  +    F  +L  GV L KHAN V+  A  YL  +   ++ +   +    +  PI     V    +A   +F  RDNV+NFI WCR    I   L FE++DLI+ K  ++V++CLLEVAR G  FGM  P ++Q+E  ID E+   +
Sbjct:    6 ARPYRPFKSSEEYLEAMREDLAEWLSTLYP---ELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSM-TSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADI 183          

HSP 2 Score: 116.701 bits (291), Expect = 1.188e-26
Identity = 49/72 (68.06%), Postives = 59/72 (81.94%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DL+SLDE VR+++ +C C   FPM R+SEGKY+ GD K LIFVRILR+HVMVRVGGGWDTL+ +L KHD CR
Sbjct:  253 DLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRSHVMVRVGGGWDTLSHYLDKHDPCR 324          
BLAST of GAS2 protein 1 vs. Ensembl Fly
Match: pigs (gene:FBgn0029881 transcript:FBtr0343375)

HSP 1 Score: 117.857 bits (294), Expect = 5.425e-27
Identity = 68/182 (37.36%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQV 690
            ++P   F   +EY++AM EDL +WL+ LY    E  +    F  +L  GV L KHAN V+  A  YL  +   ++ +   +    +  PI     V    +A   +F  RDNV+NFI WCR    I   L FE++DLI+ K  ++V++CLLEVAR G  FGM  P ++Q+E  ID E+   +
Sbjct:    6 ARPYRPFKSSEEYLEAMREDLAEWLSTLYP---ELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSM-TSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADI 183          

HSP 2 Score: 116.701 bits (291), Expect = 1.188e-26
Identity = 49/72 (68.06%), Postives = 59/72 (81.94%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DL+SLDE VR+++ +C C   FPM R+SEGKY+ GD K LIFVRILR+HVMVRVGGGWDTL+ +L KHD CR
Sbjct:  253 DLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRSHVMVRVGGGWDTLSHYLDKHDPCR 324          
BLAST of GAS2 protein 1 vs. Ensembl Fly
Match: pigs (gene:FBgn0029881 transcript:FBtr0070948)

HSP 1 Score: 117.857 bits (294), Expect = 5.425e-27
Identity = 68/182 (37.36%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQV 690
            ++P   F   +EY++AM EDL +WL+ LY    E  +    F  +L  GV L KHAN V+  A  YL  +   ++ +   +    +  PI     V    +A   +F  RDNV+NFI WCR    I   L FE++DLI+ K  ++V++CLLEVAR G  FGM  P ++Q+E  ID E+   +
Sbjct:    6 ARPYRPFKSSEEYLEAMREDLAEWLSTLYP---ELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSM-TSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADI 183          

HSP 2 Score: 116.701 bits (291), Expect = 1.188e-26
Identity = 49/72 (68.06%), Postives = 59/72 (81.94%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DL+SLDE VR+++ +C C   FPM R+SEGKY+ GD K LIFVRILR+HVMVRVGGGWDTL+ +L KHD CR
Sbjct:  253 DLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRSHVMVRVGGGWDTLSHYLDKHDPCR 324          
BLAST of GAS2 protein 1 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0087621)

HSP 1 Score: 80.8777 bits (198), Expect = 3.045e-15
Identity = 36/76 (47.37%), Postives = 54/76 (71.05%), Query Frame = 1
Query: 1222 LDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQ 1446
            + + V+ ++  C C + F + ++ EGKY++GD + L  VRILR+ VMVRVGGGW  L+EFL+K+D CR K R +I+
Sbjct: 8452 IHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAKGRTNIE 8527          
BLAST of GAS2 protein 1 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304851)

HSP 1 Score: 79.7221 bits (195), Expect = 5.534e-15
Identity = 36/72 (50.00%), Postives = 52/72 (72.22%), Query Frame = 1
Query: 1234 VREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQ 1446
            V+ ++  C C + F + ++ EGKY++GD + L  VRILR+ VMVRVGGGW  L+EFL+K+D CR K R +I+
Sbjct: 3773 VKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAKGRTNIE 3844          
BLAST of GAS2 protein 1 vs. Ensembl Zebrafish
Match: gas2l1 (growth arrest-specific 2 like 1 [Source:ZFIN;Acc:ZDB-GENE-070705-38])

HSP 1 Score: 114.775 bits (286), Expect = 1.198e-27
Identity = 49/81 (60.49%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 1183 KEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            +E++ R   D+R+LDE VREIL +C C   FPM ++SEGKY+ GD   LIF+R+LR HVMVRVGGGWDTL  +L KHD CR
Sbjct:  216 REQQKRVLLDMRNLDELVREILGQCSCPSQFPMTKVSEGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCR 296          

HSP 2 Score: 101.679 bits (252), Expect = 2.999e-23
Identity = 64/172 (37.21%), Postives = 88/172 (51.16%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQL 654
            + SK +  F   +EY+ AM EDL +WLN LY LD    +T   F   L+ G  L +HAN+V           N ++ +      +  + + I     V +  +    SF  RDNV+NFI WCR +  I   L FE+ DL+     +N V+CLLEVAR G  FGM  P +IQL
Sbjct:   10 AASKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLD----ITADTFMEGLETGCALCRHANNV-----------NRAAHEFKANCPDAALSLRIPSKDVVFQSRNVIPGSFLARDNVSNFIGWCRQELWIKDVLMFETNDLVERCNEKNFVLCLLEVARRGAKFGMLAPMLIQL 166          
BLAST of GAS2 protein 1 vs. Ensembl Zebrafish
Match: gas2l1 (growth arrest-specific 2 like 1 [Source:ZFIN;Acc:ZDB-GENE-070705-38])

HSP 1 Score: 117.472 bits (293), Expect = 8.924e-27
Identity = 49/81 (60.49%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 1183 KEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            +E++ R   D+R+LDE VREIL +C C   FPM ++SEGKY+ GD   LIF+R+LR HVMVRVGGGWDTL  +L KHD CR
Sbjct:  216 REQQKRVLLDMRNLDELVREILGQCSCPSQFPMTKVSEGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCR 296          

HSP 2 Score: 101.293 bits (251), Expect = 1.150e-21
Identity = 67/170 (39.41%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQL 654
            SK +  F   +EY+ AM EDL +WLN LY LD    +T   F   L+ G  L +HAN+V   A  +    N     L L+I ++ +         V +  +    SF  RDNV+NFI WCR +  I   L FE+ DL+     +N V+CLLEVAR G  FGM  P +IQL
Sbjct:   12 SKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLD----ITADTFMEGLETGCALCRHANNVNRAAHEFKA--NCPDAALSLRIPSKDV---------VFQSRNVIPGSFLARDNVSNFIGWCRQELWIKDVLMFETNDLVERCNEKNFVLCLLEVARRGAKFGMLAPMLIQL 166          
BLAST of GAS2 protein 1 vs. Ensembl Zebrafish
Match: gas2l2 (growth arrest specific 2 like 2 [Source:ZFIN;Acc:ZDB-GENE-170206-1])

HSP 1 Score: 100.138 bits (248), Expect = 1.742e-23
Identity = 68/180 (37.78%), Postives = 96/180 (53.33%), Query Frame = 1
Query:  112 MSGNSVYEFISHS--KPVSNFNCKDEYVDAMVEDLCDWLNFLYKLD-DENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVP 639
            MSG      I H+  + +  F   +EY+ AM EDL +WL  LY ++ D N +        L+ G +L  HAN+V  +A+ +LK           ++G   I +P +   +V    SA   +F  RDNV NFI WCR + +IP  L FE++DL+L K  +N V+CLLEVAR    FGM  P
Sbjct:    1 MSG------IQHASNQSIKPFKSSEEYLYAMKEDLAEWLGDLYNINIDVNTI-----LEMLETGALLCAHANNVTRVADDFLK-----------RLGATEIPLPASGVTFVS---SAHPATFLARDNVTNFINWCRKEMSIPDVLMFETDDLVLRKNEKNFVLCLLEVARRASRFGMASP 155          
BLAST of GAS2 protein 1 vs. Ensembl Zebrafish
Match: macf1b (microtubule actin crosslinking factor 1b [Source:ZFIN;Acc:ZDB-GENE-100922-36])

HSP 1 Score: 82.0333 bits (201), Expect = 5.460e-17
Identity = 38/85 (44.71%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 1195 YREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQ 1446
            YR   D+  ++E V   +S+C C + F +++IS  +Y++GD + L  VRILR+ +MVRVGGGW  L+EFL K+D CR K R +++
Sbjct:   95 YRRTVDIDQINEEVSRQVSQCNCPKRFQVEQISANRYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCRVKGRTNLK 179          
BLAST of GAS2 protein 1 vs. Ensembl Zebrafish
Match: gas2b (growth arrest-specific 2b [Source:ZFIN;Acc:ZDB-GENE-030616-552])

HSP 1 Score: 83.9593 bits (206), Expect = 7.279e-17
Identity = 59/185 (31.89%), Postives = 89/185 (48.11%), Query Frame = 1
Query:  136 FISHSKPVSNFNCKDEY-----------VDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIR-DFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQL 654
            F    +P  + +C  +Y           +  M +DL  WLN +  LD    +T   F  +L +GV+L + A ++Q      + L +N         G   I+        VIR    A   SF  RDN ANF+ WCR   +  S  FESEDL+L K PR+V +CL+++ RI   +G+E P +++L
Sbjct:    5 FSPRREPGPDLSCLHQYNEWLACRHESSLLPMKDDLALWLNRILGLD----ITVDTFMDRLDNGVVLCQLAEALQE----KMILASN---------GKPIIR-------RVIRWRPDAASGSFFARDNTANFLYWCRKIGVEQSHLFESEDLVLQKHPRDVCLCLMQLGRIASRYGIEPPALVKL 165          

HSP 2 Score: 63.5438 bits (153), Expect = 2.976e-10
Identity = 32/80 (40.00%), Postives = 49/80 (61.25%), Query Frame = 1
Query: 1222 LDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKP 1452
            LD+ VR+I  +  C+C   F +++  +G Y+ GDK  +++VR+L + H MVRVGGGW+    +L KHD CR   +    P
Sbjct:  284 LDDIVRQISEDPPCKCPVKFCIEKQPKGHYRVGDK--VLYVRMLNDKHAMVRVGGGWEPFGTYLLKHDPCRMTMIARPGP 361          
BLAST of GAS2 protein 1 vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:Xenbase;Acc:XB-GENE-962512])

HSP 1 Score: 119.783 bits (299), Expect = 1.405e-27
Identity = 51/73 (69.86%), Postives = 59/73 (80.82%), Query Frame = 1
Query: 1207 CDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            CDL++LDE VREIL  C+C   FPM ++SEGKYQ GD  TLIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  200 CDLKNLDELVREILGCCRCPSQFPMVKVSEGKYQVGDSNTLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 272          

HSP 2 Score: 117.857 bits (294), Expect = 5.579e-27
Identity = 70/173 (40.46%), Postives = 93/173 (53.76%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDF-SAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQL 654
            S SK +  F   +EY++AM EDL DWLN LY LD    M    F   L+ G IL +HAN++ +LA  + +          +  G R       P K V+     A   SF  RDNV+NFI WCR +  IP  L FE+ D++L K  ++ V+CLLEVAR G   GM  P +IQ+
Sbjct:   10 SASKSIRPFRSSEEYLEAMKEDLTDWLNMLYDLD----MEAGTFLESLETGYILCQHANNLNHLARDFRQQHPE------IAAGMRM------PQKEVVFQVKGAVPGSFVARDNVSNFIAWCRQELGIPEVLMFETNDIVLRKGEKSFVLCLLEVARRGARLGMPAPTLIQM 166          
BLAST of GAS2 protein 1 vs. Ensembl Xenopus
Match: bcorl1 (BCL6 corepressor like 1 [Source:Xenbase;Acc:XB-GENE-983529])

HSP 1 Score: 112.849 bits (281), Expect = 3.574e-25
Identity = 60/137 (43.80%), Postives = 83/137 (60.58%), Query Frame = 1
Query: 1189 KKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPL-VASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYE 1596
            K  R+ CD ++LD+ V+ ++S C C   F M ++SEGKY+ G+  TLIFVRILRNHVMVRVGGGWDTL  +L KHD CR   +   KP + + S  + + A+ EV+     + D+  K L++    SR  S     E
Sbjct:  185 KPQRKLCDFKNLDQMVQHLVSRCTCPVQFSMIKVSEGKYKVGESSTLIFVRILRNHVMVRVGGGWDTLEHYLDKHDPCRCTSLS-HKPAIKLGSLQKQLSAVHEVKTRLTPRLDNPSK-LETTLIVSRSQSPLPPVE 319          

HSP 2 Score: 96.2857 bits (238), Expect = 6.648e-20
Identity = 59/159 (37.11%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  166 FNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVP 639
            F   +EY+ AM EDL +WL  +Y L+    +    F   L +G +L +HAN+V  +A           R+  ++  +   K+ + P   V  +  A   +F  RDNV+NFIQWCR + +I   L FE+EDL+L K  +N V+CLLE+AR    FGM  P
Sbjct:   15 FKSSEEYLYAMKEDLAEWLKDMYNLE----VFVDNFIEILGNGSVLCQHANNVTEVA-----------REFAVQYPHLAEKLQL-PKSGVKLNMMAQPGTFLARDNVSNFIQWCRKEMDIKDVLMFETEDLVLRKNEKNFVLCLLELARRASRFGMSAP 157          
BLAST of GAS2 protein 1 vs. Ensembl Xenopus
Match: foxo1 (forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528])

HSP 1 Score: 98.9821 bits (245), Expect = 4.679e-22
Identity = 61/164 (37.20%), Postives = 87/164 (53.05%), Query Frame = 1
Query:  196 MVEDLCDWL-NFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQ-YLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELI 681
            M EDL  WL +FL K     ++T   F  +L +G +L + A ++Q    E +        + LP K      K+P           +AP  SF  RDN ANF+ WCR+  +  +  FESE L+L K PR V +CLLE+ RI   FG+E P +I+LE++I+ E I
Sbjct:   36 MKEDLALWLTSFLGK-----EITAETFMEKLDNGALLCQLAETLQDKFRENHTDANRKLDKSLPTK------KIPYRA--------NAPSGSFFARDNTANFLAWCRNIGVGETCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEIEQEEI 180          

HSP 2 Score: 73.559 bits (179), Expect = 1.329e-13
Identity = 38/85 (44.71%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 1222 LDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCRK---NRVDIQKPPL 1458
            LD+ V+ I  +  C+C   F ++R+S+G+Y+ G+K  ++F+R+L N HVMVRVGGGW+T   +L KHD CR    +RVD +  P+
Sbjct:  205 LDDAVQHISEDPPCKCPNKFCVERLSQGRYKVGEK--ILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPV 287          
BLAST of GAS2 protein 1 vs. Ensembl Xenopus
Match: foxo1 (forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528])

HSP 1 Score: 95.9005 bits (237), Expect = 3.817e-21
Identity = 61/164 (37.20%), Postives = 88/164 (53.66%), Query Frame = 1
Query:  196 MVEDLCDWL-NFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFI-KVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELI 681
            M EDL  WL +FL K     ++T   F  +L +G +L + A ++Q       K + N +        NR + K+P           +AP  SF  RDN ANF+ WCR+  +  +  FESE L+L K PR V +CLLE+ RI   FG+E P +I+LE++I+ E I
Sbjct:   36 MKEDLALWLTSFLGK-----EITAETFMEKLDNGALLCQLAETLQD------KFRENHTD------ANRKLDKIPYRA--------NAPSGSFFARDNTANFLAWCRNIGVGETCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEIEQEEI 174          

HSP 2 Score: 73.559 bits (179), Expect = 1.341e-13
Identity = 38/85 (44.71%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 1222 LDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCRK---NRVDIQKPPL 1458
            LD+ V+ I  +  C+C   F ++R+S+G+Y+ G+K  ++F+R+L N HVMVRVGGGW+T   +L KHD CR    +RVD +  P+
Sbjct:  199 LDDAVQHISEDPPCKCPNKFCVERLSQGRYKVGEK--ILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPV 281          
BLAST of GAS2 protein 1 vs. Ensembl Xenopus
Match: GAS2L3 (growth arrest specific 2 like 3 [Source:NCBI gene;Acc:100489160])

HSP 1 Score: 82.8037 bits (203), Expect = 8.326e-16
Identity = 54/155 (34.84%), Postives = 79/155 (50.97%), Query Frame = 1
Query:  196 MVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSS----RDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDII 648
            M EDL  WL  L  +    K++  +F  +L +G +L       Q ++ I   +K   +    R +P++      KVP        RD  AP  SF  RDN ANF++WCR   +  +  FESE L+L K PR V +CLL+V RI   +G+E P ++
Sbjct:   50 MQEDLSIWLTGLLGV----KVSGDKFMEELDNGFLL------CQLISVIQSTMKQCCTAEELRCVPMR------KVPCR------RD--APSGSFFARDNTANFLRWCRGIGVDETYLFESEGLVLHKDPRQVCLCLLDVGRIVSRYGVEPPVLV 180          

HSP 2 Score: 79.337 bits (194), Expect = 1.007e-14
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 1
Query: 1162 FDQSNLVKEKKYREKCDLRSLDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCR 1425
             ++  LV     +  C    L E V+ I  +  C C+  F ++ +SEG+Y+ GDK  ++F+R+L   HVMVRVGGGWDTL  FL K+D CR
Sbjct:  194 IEKGPLVPTNIQKSCCHREELHEAVKHIAEDPPCNCSHRFSIEYLSEGRYRLGDK--ILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCR 282          
BLAST of GAS2 protein 1 vs. Ensembl Mouse
Match: Gas2l1 (growth arrest-specific 2 like 1 [Source:MGI Symbol;Acc:MGI:1926176])

HSP 1 Score: 115.161 bits (287), Expect = 5.525e-29
Identity = 68/180 (37.78%), Postives = 93/180 (51.67%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL DWLN LY L      +   F + L  G  L +HAN+V        +     +   P + G  F    + P             SF  RDNVA+FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGLPG--SGDGFLTGLATGTTLCQHANAVT-------EAARALAAARPTR-GVAFQAHSVAP------------GSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Mouse
Match: Gas2l2 (growth arrest-specific 2 like 2 [Source:MGI Symbol;Acc:MGI:3652048])

HSP 1 Score: 114.775 bits (286), Expect = 1.174e-28
Identity = 66/182 (36.26%), Postives = 101/182 (55.49%), Query Frame = 1
Query:  157 VSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVP 699
            +  F   ++Y++AM EDL +WL  LY LD    +    F   L+ G++L +HAN+V   A  +L      ++ +P+            P   V  + +A   +F  RDN++NFIQWCR +  I   L FE+EDL+L K  ++VV+CLLE+ R    FG+  P ++ LEE+ID EL   +A+P
Sbjct:   21 IRPFKSSEQYLEAMKEDLAEWLRDLYGLD----IDADNFLRVLETGLVLCRHANTVTEAALAFLAEAPERAQKIPM------------PQAGVFCNGAAQPGTFQARDNISNFIQWCRKEMGIQEVLMFETEDLVLRKNVKSVVLCLLELGRRAWRFGVAAPALVHLEEEIDEELRRDLALP 186          
BLAST of GAS2 protein 1 vs. Ensembl Mouse
Match: Gas2l1 (growth arrest-specific 2 like 1 [Source:MGI Symbol;Acc:MGI:1926176])

HSP 1 Score: 114.005 bits (284), Expect = 4.370e-27
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 113.235 bits (282), Expect = 7.786e-27
Identity = 68/180 (37.78%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL DWLN LY L          F + L  G  L +HAN+V        +     +   P + G  F    + P             SF  RDNVA+FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGLPGSG--DGFLTGLATGTTLCQHANAVT-------EAARALAAARPTR-GVAFQAHSVAP------------GSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. Ensembl Mouse
Match: Gas2l2 (growth arrest-specific 2 like 2 [Source:MGI Symbol;Acc:MGI:3652048])

HSP 1 Score: 116.316 bits (290), Expect = 1.753e-26
Identity = 64/181 (35.36%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  157 VSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAV 696
            +  F   ++Y++AM EDL +WL  LY LD +       F   L+ G++L +HAN+V   A  +L      ++ +P+     F             + +A   +F  RDN++NFIQWCR +  I   L FE+EDL+L K  ++VV+CLLE+ R    FG+  P ++ LEE+ID EL   +A+
Sbjct:   21 IRPFKSSEQYLEAMKEDLAEWLRDLYGLDIDA----DNFLRVLETGLVLCRHANTVTEAALAFLAEAPERAQKIPMPQAGVFC------------NGAAQPGTFQARDNISNFIQWCRKEMGIQEVLMFETEDLVLRKNVKSVVLCLLELGRRAWRFGVAAPALVHLEEEIDEELRRDLAL 185          

HSP 2 Score: 103.99 bits (258), Expect = 1.431e-22
Identity = 48/104 (46.15%), Postives = 65/104 (62.50%), Query Frame = 1
Query: 1207 CDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQ 1518
            C   +LD+ V+ ++S C C   F M +ISEGKY+ GD  TLIF+RILR+HVMVRVGGGWDTL  +L KHD CR   +  +    +      V+  ++VQ+   Q
Sbjct:  201 CHFHNLDQMVQSLVSHCTCPVQFSMVKISEGKYRVGDSNTLIFIRILRSHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHKPGSFLKPPGPPVQHEVKVQDGPSQ 304          
BLAST of GAS2 protein 1 vs. Ensembl Mouse
Match: Gas2l1 (growth arrest-specific 2 like 1 [Source:MGI Symbol;Acc:MGI:1926176])

HSP 1 Score: 115.546 bits (288), Expect = 2.434e-26
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 114.775 bits (286), Expect = 3.662e-26
Identity = 68/180 (37.78%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL DWLN LY L          F + L  G  L +HAN+V        +     +   P + G  F    + P             SF  RDNVA+FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGLPGSG--DGFLTGLATGTTLCQHANAV-------TEAARALAAARPTR-GVAFQAHSVAP------------GSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. UniProt/SwissProt
Match: sp|Q9W3Y4|GA2PE_DROME (GAS2-like protein pickled eggs OS=Drosophila melanogaster OX=7227 GN=pigs PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 5.438e-26
Identity = 68/182 (37.36%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQV 690
            ++P   F   +EY++AM EDL +WL+ LY    E  +    F  +L  GV L KHAN V+  A  YL  +   ++ +   +    +  PI     V    +A   +F  RDNV+NFI WCR    I   L FE++DLI+ K  ++V++CLLEVAR G  FGM  P ++Q+E  ID E+   +
Sbjct:    6 ARPYRPFKSSEEYLEAMREDLAEWLSTLYP---ELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSM-TSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIAADI 183          

HSP 2 Score: 116.701 bits (291), Expect = 1.191e-25
Identity = 49/72 (68.06%), Postives = 59/72 (81.94%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DL+SLDE VR+++ +C C   FPM R+SEGKY+ GD K LIFVRILR+HVMVRVGGGWDTL+ +L KHD CR
Sbjct:  253 DLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRSHVMVRVGGGWDTLSHYLDKHDPCR 324          
BLAST of GAS2 protein 1 vs. UniProt/SwissProt
Match: sp|Q5SSG4|GA2L2_MOUSE (GAS2-like protein 2 OS=Mus musculus OX=10090 GN=Gas2l2 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.226e-25
Identity = 64/181 (35.36%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  157 VSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAV 696
            +  F   ++Y++AM EDL +WL  LY LD +       F   L+ G++L +HAN+V   A  +L      ++ +P+     F             + +A   +F  RDN++NFIQWCR +  I   L FE+EDL+L K  ++VV+CLLE+ R    FG+  P ++ LEE+ID EL   +A+
Sbjct:   21 IRPFKSSEQYLEAMKEDLAEWLRDLYGLDIDA----DNFLRVLETGLVLCRHANTVTEAALAFLAEAPERAQKIPMPQAGVFC------------NGAAQPGTFQARDNISNFIQWCRKEMGIQEVLMFETEDLVLRKNVKSVVLCLLELGRRAWRFGVAAPALVHLEEEIDEELRRDLAL 185          

HSP 2 Score: 103.99 bits (258), Expect = 1.001e-21
Identity = 48/104 (46.15%), Postives = 65/104 (62.50%), Query Frame = 1
Query: 1207 CDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQ 1518
            C   +LD+ V+ ++S C C   F M +ISEGKY+ GD  TLIF+RILR+HVMVRVGGGWDTL  +L KHD CR   +  +    +      V+  ++VQ+   Q
Sbjct:  201 CHFHNLDQMVQSLVSHCTCPVQFSMVKISEGKYRVGDSNTLIFIRILRSHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHKPGSFLKPPGPPVQHEVKVQDGPSQ 304          
BLAST of GAS2 protein 1 vs. UniProt/SwissProt
Match: sp|Q8JZP9|GA2L1_MOUSE (GAS2-like protein 1 OS=Mus musculus OX=10090 GN=Gas2l1 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.703e-25
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 114.775 bits (286), Expect = 2.562e-25
Identity = 68/180 (37.78%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL DWLN LY L          F + L  G  L +HAN+V        +     +   P + G  F    + P             SF  RDNVA+FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGLPGSG--DGFLTGLATGTTLCQHANAV-------TEAARALAAARPTR-GVAFQAHSVAP------------GSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. UniProt/SwissProt
Match: sp|Q99501|GA2L1_HUMAN (GAS2-like protein 1 OS=Homo sapiens OX=9606 GN=GAS2L1 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 2.874e-25
Identity = 49/72 (68.06%), Postives = 57/72 (79.17%), Query Frame = 1
Query: 1210 DLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            DLR+LDE VREIL  C C + FPM ++SEGKY+ GD   LIFVR+LR+HVMVRVGGGWDTL  +L KHD CR
Sbjct:  204 DLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCR 275          

HSP 2 Score: 100.138 bits (248), Expect = 1.225e-20
Identity = 67/180 (37.22%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S +K V  F   + YV+AM EDL +WLN LY L          F + L  G  L +HAN+V   A      +           G  F    + P             SF  RDNVA FI WCR +  +P  L FE+EDL+L K  ++VV+CLLEVAR G   G+  P ++Q E++I+ EL
Sbjct:   11 SAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGG--DGFLTGLATGTTLCQHANAVTEAARALAAARPAR--------GVAFQAHSVVP------------GSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEREL 168          
BLAST of GAS2 protein 1 vs. UniProt/SwissProt
Match: sp|A0A1L8HFX9|G2L2L_XENLA (GAS2-like protein 2A OS=Xenopus laevis OX=8355 GN=gas2l2.L PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 6.328e-24
Identity = 52/103 (50.49%), Postives = 70/103 (67.96%), Query Frame = 1
Query: 1198 REKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPL-VASANRNVKAILEVQ 1503
            R+ CD ++LD+ V+ ++S C C   F M ++SEGKY+ G+  TLIFVRILR HVMVRVGGGWDTL  +L KHD CR   +   KP + + S  + V A+ EV+
Sbjct:  204 RKLCDFKNLDQMVQHLVSRCTCPVQFSMIKVSEGKYKVGESSTLIFVRILRKHVMVRVGGGWDTLEHYLDKHDPCRCTSLS-HKPAIKLGSLQKQVSAVHEVK 305          

HSP 2 Score: 97.0561 bits (240), Expect = 1.632e-19
Identity = 59/159 (37.11%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  166 FNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVP 639
            F   +EY+ AM EDL +WL  +Y L+    +    F   L++G +L +HAN+V  +A           R+  ++      K+ + P   V  +  A   +F  RDNV+NFIQWCR + +I   L FE+EDL+L K  +N V+CLLE+AR    FGM  P
Sbjct:   31 FKSSEEYLYAMKEDLAEWLKDMYHLE----IIVDNFTEILENGSVLCQHANNVTEVA-----------REFSVQYPQLAEKLQL-PKSGVKLNMMAQPGTFLARDNVSNFIQWCRKEMDIKDVLMFETEDLVLRKNEKNFVLCLLELARRASRFGMSAP 173          
BLAST of GAS2 protein 1 vs. TrEMBL
Match: A0A0X3NUS9 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR146061 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.081e-66
Identity = 155/434 (35.71%), Postives = 222/434 (51.15%), Query Frame = 1
Query:  166 FNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSV-QYLAEIY-LKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSA---PMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPXXXXXXXXXXXXXXXXXXVPVDLLNVTMRKKPKHDVKKSKEEG-------LEEIVMETIDYSKVTMRKKPRQCDIESSKVVEDNEELMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKY-REKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRK 1428
            F  +DE++ AM EDL +W++ LY  D    +    FF ++ DG +L  HA  + + L E Y + ++    R   ++IG     +P  PP Y  R  S+      SF  RDN+ANFI+WCR   +P S+ FE+EDL   K  R+V+VCLLE+AR+G  FGMEVP+I+ LE++ID EL  + A+P                   P D    T       D +    EG        E + +    +    + K     D++    VE ++E   K++ Y N   +  +          N A  +   S+ +  Y+ +       A     K K+  P  + +     ++     + KY R   D+RSLDE VR+ L+EC C +TFPM RI EG+Y +GDK T IFVRILR+HVMVRVGGGWDTLN FL+K+D CRK
Sbjct:  138 FGTRDEFLAAMTEDLAEWMSRLYP-DLAGDLEADNFFDRISDGTLLCHHAAQLHRLLLENYPVSVQRGELRLHGVRIGGVEPLLPREPPNYHSRGLSSQNLAGGSFWARDNIANFIKWCRSMRLPDSILFETEDLASRKCLRSVIVCLLELARLGGRFGMEVPEIVYLEKEIDAELAAESALP----------------FSFPSDHGTET------DDFRLDPPEGGCDFQGSTENLALRDASFGPEVIAK----LDVK----VETSDEATAKVESYSNTTNDPPA----------NAASSHTAASMPRHMYNKA-------AMLRAAKIKSEHPAQKHRDLSKREEEAKPSKPKYNRPVVDMRSLDEIVRDTLAECTCEQTFPMVRIGEGRYLFGDKSTQIFVRILRSHVMVRVGGGWDTLNHFLQKYDECRK 523          
BLAST of GAS2 protein 1 vs. TrEMBL
Match: A0A0R3WR13 (Calponin-homology (CH) domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3188 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.096e-37
Identity = 86/187 (45.99%), Postives = 113/187 (60.43%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYK-----LDDENKMTPSRFFSQLQDGVILNKHANSVQYL--AEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAP---MNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S  V  FN KDE++ AM EDL DW++ LY      LD EN      FF ++ DGV+L  HA  +  L   E  + L+N   R   + IG     +P NPP +  R F+A     +SF  RDNVANFI WCR   +P  + FE+EDL+  K PR+V+VCLLE+AR+G   GMEVP+II LE++IDNE+
Sbjct:  135 SPSVQPFNNKDEFLAAMTEDLADWMSRLYPDIAKDLDAEN------FFDRISDGVLLCHHATELHRLLEQEFPVNLQNGERRLEGVHIGGVRPVLPPNPPTFQSRGFNAANLAGSSFWARDNVANFIHWCRAMRLPDCILFETEDLVSRKNPRSVIVCLLELARLGGRVGMEVPEIIYLEKEIDNEI 315          
BLAST of GAS2 protein 1 vs. TrEMBL
Match: A0A0R3TE53 (Calponin-homology (CH) domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5340 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.505e-36
Identity = 83/182 (45.60%), Postives = 115/182 (63.19%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQ-YLAEIYLKLKNNSSRDL-PLKIGNRFIKVPINPPKYVIRDFSA---PMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S  V +F  +DE++ AM EDL DWL+ LY  +  N + P +FF ++ DGV+L  HA  +   LAE +    +N  R L  L+IG     +P NPPK+  R FS+      SF  RDNVANFI WCR   +P  + FE+EDL+  K  R+V++CLLE+ARIG   GMEVP+I+ LE++ID+E+
Sbjct:  132 SPSVQSFQNRDEFLAAMTEDLADWLSRLYP-EIANDIDPEKFFDRISDGVLLCHHATKLHGLLAEEFPINSDNGERRLEGLQIGGVKPILPPNPPKFQSRSFSSVNLAGGSFWARDNVANFIHWCRAMRLPDCILFETEDLVSKKNLRSVIICLLELARIGGRVGMEVPEIVYLEKEIDDEI 312          
BLAST of GAS2 protein 1 vs. TrEMBL
Match: A0A3P7LM28 (Calponin-homology (CH) domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS7794 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.239e-35
Identity = 75/189 (39.68%), Postives = 112/189 (59.26%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLA-EIY-LKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSA---PMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVP 699
            ++    F  +DE++ AM EDL +W++ LY  D    +    FF ++ DG +L  HA  + +L  E Y + ++    R   ++IG     +P  PP +  R  SA      SF  RDN+ANFI+WCR   +P S+ FE+EDL   K  R+V+VCLLE+AR+G  FGMEVP+I+ LE++ID EL  + ++P
Sbjct:   12 ARSTQAFGTRDEFLAAMTEDLAEWMSRLYP-DLAGDLDADNFFDRISDGTLLCHHATQLHHLLIESYPVSMQRGELRLQGVRIGGVEPLLPSEPPNFHSRGLSAQNLAGGSFWARDNIANFIKWCRSMRLPDSILFETEDLASRKCLRSVIVCLLELARLGGRFGMEVPEIVYLEKEIDAELAAEASLP 199          
BLAST of GAS2 protein 1 vs. TrEMBL
Match: A0A158R9J4 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7354 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.281e-35
Identity = 84/187 (44.92%), Postives = 111/187 (59.36%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYK-----LDDENKMTPSRFFSQLQDGVILNKHANSVQYL--AEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSA---PMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            S  V  F+ +DE++ AM EDL DW++ LY      LD EN      FF ++ DGV+L  HA  +  L   E  + L+N   R   + IG     +P NPP Y  R F+A      SF  RDNVANFI WCR   +P  + FE+EDL+  K  R+V+VCLLE+AR+G   GMEVP+II LE++IDNE+
Sbjct:  135 SPSVQPFSNRDEFIAAMTEDLADWMSRLYPDIAKDLDAEN------FFDRISDGVLLCHHATELHRLLEQEFSVSLQNGERRLEGVHIGGVKPVLPPNPPSYQSRGFNAVNLAGGSFWARDNVANFIHWCRAMRLPDCILFETEDLVSRKNLRSVIVCLLELARLGGRVGMEVPEIIYLEKEIDNEI 315          

HSP 2 Score: 120.939 bits (302), Expect = 1.436e-24
Identity = 56/99 (56.57%), Postives = 76/99 (76.77%), Query Frame = 1
Query: 1183 KEKKY-REKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANR 1476
            K+ +Y R   D+R+LDE VRE L++C C +TFPM R+SEG+Y +GDK   IFVRILR+HVMVRVGGGWDTL+ FL+K+D CRK    +Q+P   ++A++
Sbjct:  422 KKSQYKRPVIDMRTLDEIVREKLAQCTCEQTFPMIRLSEGRYLFGDKSMQIFVRILRSHVMVRVGGGWDTLDHFLQKYDECRK----VQQPNSPSTADK 516          
BLAST of GAS2 protein 1 vs. Ensembl Cavefish
Match: gas2l1 (growth arrest specific 2 like 1 [Source:NCBI gene;Acc:103028235])

HSP 1 Score: 117.857 bits (294), Expect = 5.225e-27
Identity = 48/75 (64.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1207 CDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKN 1431
            CD+R+LDE VREIL +C C   FPM ++S+GKY+ GD   LIF+R+LR HVMVRVGGGWDTL  +L KHD CR N
Sbjct:  218 CDMRNLDELVREILGQCSCPSQFPMTKVSDGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCRCN 292          

HSP 2 Score: 99.7525 bits (247), Expect = 3.315e-21
Identity = 63/174 (36.21%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  151 KPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPM-NSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDI 666
            K +  F   +EY+ AM EDL +WL+ LY LD    +T   F   L+ G +L  HAN+V   A  +                      P  P + V       M  SF  RDNV+NFI WCR +  +   L FE+ DL+     +N V+CLLEVAR G  FG+  P ++QLE++I
Sbjct:   14 KSIRPFKSSEEYLYAMKEDLAEWLHGLYGLD----ITVETFMESLETGCVLCNHANNVNRAARPF---------------------QPHRPWQDVAYQSRGAMPGSFVARDNVSNFIGWCRSELRVKDVLMFETNDLVERGSEKNFVLCLLEVARRGARFGVPAPVLVQLEQEI 162          
BLAST of GAS2 protein 1 vs. Ensembl Cavefish
Match: gas2l2 (growth arrest specific 2 like 2 [Source:ZFIN;Acc:ZDB-GENE-170206-1])

HSP 1 Score: 105.145 bits (261), Expect = 3.480e-25
Identity = 64/165 (38.79%), Postives = 91/165 (55.15%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRD-FNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVP 639
            S+ +  F   +EY+ AM EDL +WL  LY+LD    +T +     ++ GV+L  HAN+V  +AE           D   K G+  +++P +   +V    SA   +F  RDNV+NFI WCR+   I   L FE++DL+L K  +N V+CLLEVAR    FGM  P
Sbjct:    9 SQSIKPFRSSEEYLYAMKEDLAEWLKDLYRLD----LTVNNLLELMETGVLLCDHANNVTRVAE-----------DFGHKHGHTHLQLPTSGVTFV---RSAQPATFLARDNVSNFINWCRNQMYIKDVLMFETDDLVLRKNEKNFVLCLLEVARRASRFGMAAP 155          
BLAST of GAS2 protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000038065.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:11675492:11682368:1 gene:ENSAMXG00000041735.1 transcript:ENSAMXT00000038065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 9.697e-24
Identity = 44/65 (67.69%), Postives = 51/65 (78.46%), Query Frame = 1
Query: 1231 RVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            +V+ ++S C C   FPM +ISEGKY+ GD  TLIFVRILRNHVMVRVGGGWDTL  +L KHD CR
Sbjct:   17 QVQHLISRCTCPTQFPMVKISEGKYRVGDSSTLIFVRILRNHVMVRVGGGWDTLEHYLDKHDPCR 81          
BLAST of GAS2 protein 1 vs. Ensembl Cavefish
Match: gas2a (growth arrest specific 2 [Source:NCBI gene;Acc:103043407])

HSP 1 Score: 93.9745 bits (232), Expect = 1.171e-20
Identity = 58/161 (36.02%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  196 MVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLK-IGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNE 675
            M EDL  WL  +  ++    +T   F  +L +G +L + A ++Q         ++N     P K I NR  ++P           SAP  SF  RDN ANF+ WCR+  +  +  FESE L+L K PR V +CLLE+ RI   F +E P +I+LE++I+ E
Sbjct:   37 MKEDLALWLTSMLGVE----ITADSFMDRLDNGFLLCQLAETLQEKFR-----QSNGELSPPGKPIPNR--RIPCRA--------SAPSGSFFARDNTANFLSWCREVGVGETCLFESEGLVLHKQPREVCLCLLELGRIASRFKVEPPGLIKLEKEIEQE 178          

HSP 2 Score: 72.0182 bits (175), Expect = 3.253e-13
Identity = 34/71 (47.89%), Postives = 50/71 (70.42%), Query Frame = 1
Query: 1222 LDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCR 1425
            LD+ V+ I  +  C+C   F ++R S+G+Y+ G+K  ++F+R+L N HVMVRVGGGW+T   +L KHD CR
Sbjct:  211 LDDAVKHIAEDPPCKCPNKFCVERQSQGRYRVGEK--ILFIRMLHNKHVMVRVGGGWETFESYLLKHDPCR 279          
BLAST of GAS2 protein 1 vs. Ensembl Cavefish
Match: macf1b (microtubule actin crosslinking factor 1b [Source:ZFIN;Acc:ZDB-GENE-100922-36])

HSP 1 Score: 85.1149 bits (209), Expect = 3.298e-18
Identity = 38/84 (45.24%), Postives = 57/84 (67.86%), Query Frame = 1
Query: 1195 YREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQ 1446
            YR   D   ++E V   +S+C C + F +++IS  +Y++GD + L  VRILR+ +MVRVGGGW  L+EFL K+D CRK R +++
Sbjct:   95 YRRTIDADQINEEVSRQVSQCNCPKRFQVEQISANRYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCRKGRTNLK 178          
BLAST of GAS2 protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002497.1 (pep scaffold:Pmarinus_7.0:GL476638:223513:267757:1 gene:ENSPMAG00000002275.1 transcript:ENSPMAT00000002497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 5.863e-22
Identity = 55/166 (33.13%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  196 MVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVA 693
            M EDL  WL  +  L +  ++    F  Q+ +GV+L +  + +Q                 P     RF      P + +    +AP  +F  RDN ANF+ WCR+  +  S  FESE L+L K PR V +CLLE+ RI   FG++ P +I+LE++I+ E    +A
Sbjct:   34 MKEDLAMWLTEI--LGECTEIRAETFMEQIDNGVLLCRLGSILQA--------------KXPFSAHQRF------PRRKIPCRANAPAGTFFARDNTANFLAWCREAGVDESCMFESEGLVLHKQPREVCLCLLELGRIAARFGIDPPGLIKLEKEIEQEEARAIA 177          

HSP 2 Score: 73.559 bits (179), Expect = 1.314e-14
Identity = 39/78 (50.00%), Postives = 53/78 (67.95%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCRK---NRVD--IQKPPLVASA 1470
            CQC  +F ++  S+G+Y++GDK  ++FVR+L N HVMVRVGGGW+T   +L KHD CR    +RVD  I   P+ A A
Sbjct:  209 CQCQASFQVEYYSDGRYRFGDK--IVFVRMLHNKHVMVRVGGGWETFEGYLLKHDPCRMLHISRVDGRISGLPVPACA 284          
BLAST of GAS2 protein 1 vs. Ensembl Sea Lamprey
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 98.9821 bits (245), Expect = 8.090e-22
Identity = 46/81 (56.79%), Postives = 54/81 (66.67%), Query Frame = 1
Query: 1234 VREILSECQCAETFPMKRISEGKYQWGDKKTLIFVR-ILRNHVMVRVGGGWDTLNEFLRKHDHCR----KNRVDIQKPPLV 1461
            VR +LS C C   FPM R+SEGKY+ GD  +LI+VR ILR HVMVRVGGGWDTL  +L KHD CR       + +  PPL 
Sbjct:  191 VRFLLSRCTCPVQFPMVRVSEGKYRVGDSSSLIYVRQILRKHVMVRVGGGWDTLEHYLDKHDPCRCLAPSESLPLTNPPLA 271          
BLAST of GAS2 protein 1 vs. Ensembl Sea Lamprey
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 94.3597 bits (233), Expect = 8.841e-22
Identity = 44/72 (61.11%), Postives = 51/72 (70.83%), Query Frame = 1
Query: 1222 LDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFV----RILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            L E VR +LS C C   FPM R+SEGKY+ GD  +LI+V    +ILR HVMVRVGGGWDTL  +L KHD CR
Sbjct:  199 LREGVRFLLSRCTCPVQFPMVRVSEGKYRVGDSSSLIYVVARGQILRKHVMVRVGGGWDTLEHYLDKHDPCR 270          

HSP 2 Score: 47.7506 bits (112), Expect = 4.079e-6
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSV 324
            + +K +  F   +EY+ AM EDL +WL+ L+ LD    +T   F  +L+ G +L  HAN+V
Sbjct:    9 AATKSIRPFRSSEEYLYAMKEDLAEWLSALHSLD----ITVDNFLEELETGTVLCHHANTV 65          
BLAST of GAS2 protein 1 vs. Ensembl Sea Lamprey
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 97.0561 bits (240), Expect = 3.025e-21
Identity = 46/81 (56.79%), Postives = 54/81 (66.67%), Query Frame = 1
Query: 1234 VREILSECQCAETFPMKRISEGKYQWGDKKTLIFVR-ILRNHVMVRVGGGWDTLNEFLRKHDHCR----KNRVDIQKPPLV 1461
            VR +LS C C   FPM R+SEGKY+ GD  +LI+VR ILR HVMVRVGGGWDTL  +L KHD CR       + +  PPL 
Sbjct:  189 VRFLLSRCTCPVQFPMVRVSEGKYRVGDSSSLIYVRQILRKHVMVRVGGGWDTLEHYLDKHDPCRCLAPSESLPLTNPPLA 269          

HSP 2 Score: 49.6766 bits (117), Expect = 1.931e-6
Identity = 26/84 (30.95%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  151 KPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRF 402
            K +  F   +EY+ AM EDL +WL+ L+ LD    +T   F  +L+ G +L  HAN+V   A  + + +  ++  + +K+   F
Sbjct:    1 KSIRPFRSSEEYLYAMKEDLAEWLSALHSLD----ITVDNFLEELETGTVLCHHANTVNRQAAEFAEAQPQAAATMQVKMRRVF 80          
BLAST of GAS2 protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002308.1 (pep scaffold:Pmarinus_7.0:GL477003:24840:25679:-1 gene:ENSPMAG00000002103.1 transcript:ENSPMAT00000002308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 3.201e-19
Identity = 58/184 (31.52%), Postives = 84/184 (45.65%), Query Frame = 1
Query:  142 SHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLP-------RNVVVCLLEVARIGKLFGMEVPDIIQLEEDID 669
            +  + V  +  +  Y+ AM EDL  WLN ++  D    ++   F + L  G  L + AN+V   A     L  + +RD            P       +     P  +F  RD VA F+ WCR +  IP  LTFE+ DL+ +          R VV+CLLEVAR G   G   P+++ LE DI+
Sbjct:   11 AAGRSVRPYRSELAYLHAMKEDLAQWLNVIFS-DVAFDVSADNFTATLSAGWPLCRLANAVSRWA-----LDCSRARD------------PGQGSNPGLGAHGLPRATFAARDRVATFLGWCRSELGIPEHLTFETNDLMEVGRQERRGGGERQVVLCLLEVARRGARMGGPAPELVMLERDIE 176          
BLAST of GAS2 protein 1 vs. Ensembl Nematostella
Match: EDO41193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S571])

HSP 1 Score: 100.908 bits (250), Expect = 1.491e-23
Identity = 57/170 (33.53%), Postives = 97/170 (57.06%), Query Frame = 1
Query:  181 EYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQV 690
            E ++ + EDL +WL+ + +++    +    F   L +GV+L K A  +Q  A  ++K+    S  LP  +G+RF +             +A   +F  RDN A F++WC+   I  S+ FES+ L+L K PR V++CLL+VAR    FG++ P++++LE++ID E+  +V
Sbjct:   36 EDLNPLKEDLAEWLSRVLEVE----VQADNFMDYLDNGVLLCKLAQLIQKAATEWIKIDKAMSVTLP-SLGSRFHQ-------------NAKSGTFFARDNAAYFLKWCKGVGIQDSVMFESDGLVLQKQPREVLLCLLDVARFAANFGIDPPNLVKLEKEIDEEIEQEV 187          

HSP 2 Score: 63.929 bits (154), Expect = 3.462e-11
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 1
Query: 1279 MKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKP 1452
            ++RI EG+Y   + K  IFVRI+RNHVMVRVGGGWDTL  F+ +HD  +  ++    P
Sbjct:  217 IERIKEGRYIV-ENKINIFVRIVRNHVMVRVGGGWDTLEHFISRHDPKKLGKILTSTP 273          
BLAST of GAS2 protein 1 vs. Ensembl Nematostella
Match: EDO32825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STY7])

HSP 1 Score: 95.9005 bits (237), Expect = 9.799e-23
Identity = 74/215 (34.42%), Postives = 112/215 (52.09%), Query Frame = 1
Query:   64 SKNTKDLSSLNQSRA---QMSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILM----KLPRNVVVCLLEVA-RIGKLFGMEVPDIIQLEEDIDNELIN 684
            S+ T D++   ++RA   ++  NSV  F    K       ++E + AM+ED   WL    KL  E  +TP  FF  L+DG +L K AN +Q +A+ Y +  N     +P K      K+     K   R+       FH R+NV  F+ WCR  +IP ++ FES D++L+       R +V+CL+E+A R+ K    +VP +IQLE++ID E  N
Sbjct:    9 SELTLDVTCTPRNRANLRRLKTNSVQSFQRWEK-------ENELLYAMIEDETAWLA---KLFTEIIITPDFFFYALEDGTLLCKLANYIQEMADTYGQKHNTH---VPGK------KIKFKESKRGHRESKL----FHSRENVQKFLTWCRWHDIPEAILFESNDVVLVDECRTGGREIVICLMEIARRVIKYEIKQVPKLIQLEQEIDEEEAN 200          
BLAST of GAS2 protein 1 vs. Ensembl Nematostella
Match: EDO27804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T889])

HSP 1 Score: 89.3521 bits (220), Expect = 4.228e-22
Identity = 35/61 (57.38%), Postives = 47/61 (77.05%), Query Frame = 1
Query: 1255 CQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRV 1437
            C C   +P++RI++GKY+ GD K LIFVR++R HVMVRVGGGWDTL+ +  KHD CR + +
Sbjct:    1 CTCPTRYPVQRIADGKYKMGDSKNLIFVRVMRKHVMVRVGGGWDTLDRYFDKHDPCRNHGI 61          
BLAST of GAS2 protein 1 vs. Ensembl Nematostella
Match: EDO33092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST60])

HSP 1 Score: 95.1301 bits (235), Expect = 7.432e-22
Identity = 42/76 (55.26%), Postives = 56/76 (73.68%), Query Frame = 1
Query: 1219 SLDERVRE---ILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRV 1437
            SLD+ V E   IL +C C   +P++RI++GKY+ GD K LIFVR++R HVMVRVGGGWDTL+ +  KHD CR + +
Sbjct:  181 SLDDLVSECSTILDKCTCPTRYPVQRIADGKYKMGDSKNLIFVRVMRKHVMVRVGGGWDTLDRYFDKHDPCRNHGI 256          

HSP 2 Score: 92.8189 bits (229), Expect = 3.807e-21
Identity = 56/168 (33.33%), Postives = 91/168 (54.17%), Query Frame = 1
Query:  178 DEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAE-IYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
            ++++  + EDL  W++   +L  E ++    F S L  GV+L + AN +Q + E  +++      R L    G  +            +   A   SF  RDNV+NFI+WCR+  +P  + FE+EDL+L K  + V++ LLEVAR     G+E P++++LE +ID EL
Sbjct:    2 EKWLIPLKEDLASWIS---RLLGEEELNTDTFTSMLDTGVVLCRLANFIQTVGEEFFVRNPKFPRRGLFPACGVTY------------KQRGATHGSFVARDNVSNFIRWCRELRVPDVIMFETEDLVLNKNEKTVLLTLLEVARKAFKVGVEPPELVRLENEIDQEL 154          
BLAST of GAS2 protein 1 vs. Ensembl Nematostella
Match: EDO37706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF35])

HSP 1 Score: 68.9366 bits (167), Expect = 4.283e-12
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 1
Query: 1174 NLVKEKKYREK--CDLRSLDERVREILSECQCAETFPMKRISEGKYQ---------WGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            N +K+K   EK   D + +   +   +  C CA+ F   ++ E KY+         +GD + L  +RILR+ VMVRVGGGW+TL EFL K+D CR
Sbjct: 1267 NALKDKPSPEKPKTDAQKIHNEIDRQVEHCCCAKQFSYFKVGENKYRVSHAKKERYFGDSQKLRLLRILRSTVMVRVGGGWETLQEFLEKNDPCR 1361          
BLAST of GAS2 protein 1 vs. Ensembl Medaka
Match: gas2l1 (growth arrest specific 2 like 1 [Source:NCBI gene;Acc:101154873])

HSP 1 Score: 116.701 bits (291), Expect = 1.211e-26
Identity = 48/73 (65.75%), Postives = 57/73 (78.08%), Query Frame = 1
Query: 1207 CDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR 1425
            CD+R+LDE VREIL +C C   FPM ++SEGKY+ GD   LIF+R+LR HVMVRVGGGWDTL  +L KHD CR
Sbjct:  226 CDMRNLDELVREILGKCSCPAQFPMIKVSEGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCR 298          

HSP 2 Score: 103.219 bits (256), Expect = 2.605e-22
Identity = 64/170 (37.65%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  148 SKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCR-DFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQL 654
            SK +  F   +EY+ AM EDL +WLN LY LD    +T   F   L+ G  L +HAN+V   A  + +    +++ +         KVP      V +  +    SF  RDN++NFI WCR +  I   L FE+ DL+     +N ++CLLEVAR G  FGM  P +IQL
Sbjct:   12 SKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLD----VTADTFMDGLETGCALCRHANNVNRAAHDFQQKHPEATQTM---------KVPSK--DVVFQSRNVVPGSFLARDNISNFITWCRQELWIKDVLMFETNDLVERSNEKNFILCLLEVARRGSKFGMLAPMLIQL 166          
BLAST of GAS2 protein 1 vs. Ensembl Medaka
Match: gas2a (growth arrest specific 2 [Source:NCBI gene;Acc:101174828])

HSP 1 Score: 93.9745 bits (232), Expect = 1.186e-20
Identity = 58/161 (36.02%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  196 MVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLP-LKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNE 675
            M EDL  WL  +  L+    +T   F  +L +G +L +       LAE   +    S  D P L  G R       P + +    SAP  SF  RDN ANF+ WCR+  +  +  FESE L+L + PR V +CLLE+ RI   + +E P +I+LE++I+ E
Sbjct:   36 MKEDLALWLTNILGLE----ITAENFMDRLDNGFLLCR-------LAETLQEKFRQSIEDFPNLGNGKRI------PNRRIPCRQSAPSGSFFARDNTANFLAWCREVGVGETCLFESEGLVLHREPREVCLCLLELGRIASRYNIEPPGLIKLEKEIEQE 179          

HSP 2 Score: 76.2554 bits (186), Expect = 9.017e-15
Identity = 43/94 (45.74%), Postives = 62/94 (65.96%), Query Frame = 1
Query: 1222 LDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCRK---NRVDIQKPPLVASANRNVK 1485
            LD+ VR I  +  C+C   F ++R S+G+Y+ G+K  ++F+R+L N HVMVRVGGGW+T   +L KHD CR    +RVD  K  L++S   N+K
Sbjct:  202 LDDAVRHIADDPPCRCENKFCVERQSQGRYRVGEK--MLFIRMLHNKHVMVRVGGGWETFESYLLKHDPCRMLQFSRVD-GKTSLISSKTPNIK 292          
BLAST of GAS2 protein 1 vs. Ensembl Medaka
Match: gas2a (growth arrest specific 2 [Source:NCBI gene;Acc:101174828])

HSP 1 Score: 93.9745 bits (232), Expect = 1.692e-20
Identity = 58/161 (36.02%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  196 MVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLP-LKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNE 675
            M EDL  WL  +  L+    +T   F  +L +G +L + A ++Q   E +      S  D P L  G R       P + +    SAP  SF  RDN ANF+ WCR+  +  +  FESE L+L + PR V +CLLE+ RI   + +E P +I+LE++I+ E
Sbjct:   36 MKEDLALWLTNILGLE----ITAENFMDRLDNGFLLCRLAETLQ---EKF----RQSIEDFPNLGNGKRI------PNRRIPCRQSAPSGSFFARDNTANFLAWCREVGVGETCLFESEGLVLHREPREVCLCLLELGRIASRYNIEPPGLIKLEKEIEQE 179          

HSP 2 Score: 76.6406 bits (187), Expect = 1.050e-14
Identity = 43/94 (45.74%), Postives = 62/94 (65.96%), Query Frame = 1
Query: 1222 LDERVREILSE--CQCAETFPMKRISEGKYQWGDKKTLIFVRILRN-HVMVRVGGGWDTLNEFLRKHDHCRK---NRVDIQKPPLVASANRNVK 1485
            LD+ VR I  +  C+C   F ++R S+G+Y+ G+K  ++F+R+L N HVMVRVGGGW+T   +L KHD CR    +RVD  K  L++S   N+K
Sbjct:  227 LDDAVRHIADDPPCRCENKFCVERQSQGRYRVGEK--MLFIRMLHNKHVMVRVGGGWETFESYLLKHDPCRMLQFSRVD-GKTSLISSKTPNIK 317          
BLAST of GAS2 protein 1 vs. Ensembl Medaka
Match: gas2b (growth arrest-specific protein 2-like [Source:NCBI gene;Acc:101166700])

HSP 1 Score: 83.5741 bits (205), Expect = 4.398e-17
Identity = 54/160 (33.75%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  178 DEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKN-NSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQL 654
            D  +  M EDL  WLN +  ++    +T      QL +GV+L + A  +Q       K+ N N+++  P      F++      + +     A   SF  RDN ANF+ WCR   +  S  FESEDL+L K PR V +CL++V RI   +G+E P +++L
Sbjct:   31 DASLLPMKEDLALWLNNIMGVN----LTADCLMEQLDNGVVLCQLAKLLQE------KMTNVNTAKSQP------FVR------RVIHWRADATSGSFFARDNTANFLYWCRKIGVDESYLFESEDLVLHKQPREVCLCLMDVGRIAARYGVEPPGLVKL 168          

HSP 2 Score: 63.929 bits (154), Expect = 1.438e-10
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 1
Query: 1234 VREIL--SECQCAETFPMKRISEGKYQWGDKKTLIFVRIL-RNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKP 1452
            VR I+    C C   F +++  +G Y+ GDK  ++++R+L   HVMVRVGGGW+T   +L+KHD CR       +P
Sbjct:  226 VRGIIENPPCSCPTRFSVEKQPKGSYRVGDK--VLYIRMLNERHVMVRVGGGWETFMGYLQKHDPCRGGGGSAGRP 299          
BLAST of GAS2 protein 1 vs. Ensembl Medaka
Match: macf1b (microtubule actin crosslinking factor 1b [Source:ZFIN;Acc:ZDB-GENE-100922-36])

HSP 1 Score: 81.2629 bits (199), Expect = 5.105e-17
Identity = 41/101 (40.59%), Postives = 64/101 (63.37%), Query Frame = 1
Query: 1195 YREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCR-KNRVDIQ-KPPLVASANRNVKAI 1491
            YR+  D   ++E V   +S+C C + F +++IS  +Y++GD + L  VRILR+ +MVRVGGGW  L+EFL K+D CR K R +++ K   ++ A    K +
Sbjct:   95 YRKTLDADQINEEVSRQVSQCSCPKRFQVEQISANRYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCRVKGRTNLKIKEKYLSPAGSTTKGL 195          
BLAST of GAS2 protein 1 vs. Planmine SMEST
Match: SMESG000041563.1 (SMESG000041563.1)

HSP 1 Score: 1144.41 bits (2959), Expect = 0.000e+0
Identity = 602/609 (98.85%), Postives = 607/609 (99.67%), Query Frame = 1
Query:   46 MFNHPHSKNTKDLSSLNQSRAQMSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPXXXXXXXXXXXXXXXXXXVPVDLLNVTMRKKPKHDVKKSKEEGLEEIVMETIDYSKVTMRKKPRQCDIESSKVVEDNEELMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNXXXXXXXXXXXXXXXLTNKTSDTDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR 1872
            MFNHPHSKNTKDLSSLNQSRA MSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPDKI+NIIVNDINENII+DVPVDLLNVTMRKKPKHDVKKSKEEGLEEIV+ETIDYSKVTMRKKPRQCDIESSKVVEDNE+LMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNSQPISSDC DSSSFSLTNKTS+TDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR
Sbjct:    1 MFNHPHSKNTKDLSSLNQSRAHMSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPDKIENIIVNDINENIISDVPVDLLNVTMRKKPKHDVKKSKEEGLEEIVIETIDYSKVTMRKKPRQCDIESSKVVEDNEDLMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNSQPISSDCSDSSSFSLTNKTSNTDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR 609          
BLAST of GAS2 protein 1 vs. Planmine SMEST
Match: SMESG000041563.1 (SMESG000041563.1)

HSP 1 Score: 1100.89 bits (2846), Expect = 0.000e+0
Identity = 581/587 (98.98%), Postives = 586/587 (99.83%), Query Frame = 1
Query:  112 MSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPXXXXXXXXXXXXXXXXXXVPVDLLNVTMRKKPKHDVKKSKEEGLEEIVMETIDYSKVTMRKKPRQCDIESSKVVEDNEELMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNXXXXXXXXXXXXXXXLTNKTSDTDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR 1872
            MSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPDKI+NIIVNDINENII+DVPVDLLNVTMRKKPKHDVKKSKEEGLEEIV+ETIDYSKVTMRKKPRQCDIESSKVVEDNE+LMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNSQPISSDC DSSSFSLTNKTS+TDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR
Sbjct:    1 MSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPDKIENIIVNDINENIISDVPVDLLNVTMRKKPKHDVKKSKEEGLEEIVIETIDYSKVTMRKKPRQCDIESSKVVEDNEDLMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNSQPISSDCSDSSSFSLTNKTSNTDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR 587          
BLAST of GAS2 protein 1 vs. Planmine SMEST
Match: SMESG000041563.1 (SMESG000041563.1)

HSP 1 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 582/609 (95.57%), Postives = 587/609 (96.39%), Query Frame = 1
Query:   46 MFNHPHSKNTKDLSSLNQSRAQMSGNSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPXXXXXXXXXXXXXXXXXXVPVDLLNVTMRKKPKHDVKKSKEEGLEEIVMETIDYSKVTMRKKPRQCDIESSKVVEDNEELMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNXXXXXXXXXXXXXXXLTNKTSDTDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR 1872
            MFNHPHSKNTKDLSSLNQSRA MS                    DEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPDKI+NIIVNDINENII+DVPVDLLNVTMRKKPKHDVKKSKEEGLEEIV+ETIDYSKVTMRKKPRQCDIESSKVVEDNE+LMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNSQPISSDC DSSSFSLTNKTS+TDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR
Sbjct:    1 MFNHPHSKNTKDLSSLNQSRAHMS--------------------DEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNELINQVAVPDKIENIIVNDINENIISDVPVDLLNVTMRKKPKHDVKKSKEEGLEEIVIETIDYSKVTMRKKPRQCDIESSKVVEDNEDLMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSVSSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSELKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGLLESNSQPISSDCSDSSSFSLTNKTSNTDMTRSNSQFLMCNSDRIPNIQSNQKHFSRIPILKKR 589          
BLAST of GAS2 protein 1 vs. Planmine SMEST
Match: SMESG000061252.1 (SMESG000061252.1)

HSP 1 Score: 144.821 bits (364), Expect = 7.877e-37
Identity = 82/206 (39.81%), Postives = 126/206 (61.17%), Query Frame = 1
Query:   64 SKNTKDLSSLNQSRAQMSG-NSVYEFISHSKPVSNFNCKDEYVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDIDNEL 678
             KN +  SS++    + SG +S++  ++    +  ++ KDEY+ AM+EDL  W+   + +     +T   FF  L+ GVIL K A  VQ   E ++  +NN +R LP K  N ++++P   PKY  R+    M +F  RDN+ANFI W R+F    S+ FE+EDLI  K  R+VV+ LLE+AR+G LFG+ VP++I+LE++ID E+
Sbjct:   14 GKNLERRSSISSIATEDSGYSSIFRIVNS---IRVYSSKDEYLVAMIEDLAVWIQSNHSIS----ITIDNFFDVLESGVILCKQAGMVQEAGEQFVVNRNNFNRTLPGKWSNCYLQLPSRSPKYRHREI---MQTFLSRDNIANFIGWLREFRFSDSIMFETEDLISRKNIRHVVLALLELARVGGLFGLNVPNLIELEQEIDAEM 209          

HSP 2 Score: 131.339 bits (329), Expect = 2.577e-32
Identity = 57/87 (65.52%), Postives = 69/87 (79.31%), Query Frame = 1
Query: 1174 NLVKEKKYREKCDLRSLDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRKNR 1434
            ++++ K Y  +CD+RSLDE VREIL EC+C   FPM R++EGKY +G+K  LIFVRILRNHVMVRVGGGWDTLN  L KHD CRK +
Sbjct:  270 HVIQPKPYFPECDIRSLDEMVREILLECECEPMFPMTRLAEGKYLFGEKDLLIFVRILRNHVMVRVGGGWDTLNHLLYKHDPCRKEK 356          
BLAST of GAS2 protein 1 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.087e-15
Identity = 32/69 (46.38%), Postives = 51/69 (73.91%), Query Frame = 1
Query: 1222 LDERVREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGWDTLNEFLRKHDHCRK 1428
            + + V++ +S+C C+  + + +  +GKY++GD + L  VRILR++VMVR+GGGW  L+EFL KHD CR+
Sbjct: 8074 IHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRE 8142          
The following BLAST results are available for this feature:
BLAST of GAS2 protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAS2L15.167e-2762.20growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L12.558e-2668.06growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L16.147e-2668.06growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L16.147e-2668.06growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L16.147e-2668.06growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-101.542e-1451.47VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-101.620e-1451.47VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-101.682e-1451.47VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-101.783e-1451.47VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-101.783e-1451.47VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pigs5.425e-2737.36gene:FBgn0029881 transcript:FBtr0308653[more]
pigs5.425e-2737.36gene:FBgn0029881 transcript:FBtr0343375[more]
pigs5.425e-2737.36gene:FBgn0029881 transcript:FBtr0070948[more]
shot3.045e-1547.37gene:FBgn0013733 transcript:FBtr0087621[more]
shot5.534e-1550.00gene:FBgn0013733 transcript:FBtr0304851[more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2l11.198e-2760.49growth arrest-specific 2 like 1 [Source:ZFIN;Acc:Z... [more]
gas2l18.924e-2760.49growth arrest-specific 2 like 1 [Source:ZFIN;Acc:Z... [more]
gas2l21.742e-2337.78growth arrest specific 2 like 2 [Source:ZFIN;Acc:Z... [more]
macf1b5.460e-1744.71microtubule actin crosslinking factor 1b [Source:Z... [more]
gas2b7.279e-1731.89growth arrest-specific 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek71.405e-2769.86NIMA-related kinase 7 [Source:Xenbase;Acc:XB-GENE-... [more]
bcorl13.574e-2543.80BCL6 corepressor like 1 [Source:Xenbase;Acc:XB-GEN... [more]
foxo14.679e-2237.20forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528... [more]
foxo13.817e-2137.20forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528... [more]
GAS2L38.326e-1634.84growth arrest specific 2 like 3 [Source:NCBI gene;... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gas2l15.525e-2937.78growth arrest-specific 2 like 1 [Source:MGI Symbol... [more]
Gas2l21.174e-2836.26growth arrest-specific 2 like 2 [Source:MGI Symbol... [more]
Gas2l14.370e-2768.06growth arrest-specific 2 like 1 [Source:MGI Symbol... [more]
Gas2l21.753e-2635.36growth arrest-specific 2 like 2 [Source:MGI Symbol... [more]
Gas2l12.434e-2668.06growth arrest-specific 2 like 1 [Source:MGI Symbol... [more]
back to top
BLAST of GAS2 protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W3Y4|GA2PE_DROME5.438e-2637.36GAS2-like protein pickled eggs OS=Drosophila melan... [more]
sp|Q5SSG4|GA2L2_MOUSE1.226e-2535.36GAS2-like protein 2 OS=Mus musculus OX=10090 GN=Ga... [more]
sp|Q8JZP9|GA2L1_MOUSE1.703e-2568.06GAS2-like protein 1 OS=Mus musculus OX=10090 GN=Ga... [more]
sp|Q99501|GA2L1_HUMAN2.874e-2568.06GAS2-like protein 1 OS=Homo sapiens OX=9606 GN=GAS... [more]
sp|A0A1L8HFX9|G2L2L_XENLA6.328e-2450.49GAS2-like protein 2A OS=Xenopus laevis OX=8355 GN=... [more]
back to top
BLAST of GAS2 protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NUS91.081e-6635.71Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A0R3WR133.096e-3745.99Calponin-homology (CH) domain-containing protein O... [more]
A0A0R3TE532.505e-3645.60Calponin-homology (CH) domain-containing protein O... [more]
A0A3P7LM282.239e-3539.68Calponin-homology (CH) domain-containing protein O... [more]
A0A158R9J42.281e-3544.92Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2l15.225e-2764.00growth arrest specific 2 like 1 [Source:NCBI gene;... [more]
gas2l23.480e-2538.79growth arrest specific 2 like 2 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000038065.19.697e-2467.69pep primary_assembly:Astyanax_mexicanus-2.0:3:1167... [more]
gas2a1.171e-2036.02growth arrest specific 2 [Source:NCBI gene;Acc:103... [more]
macf1b3.298e-1845.24microtubule actin crosslinking factor 1b [Source:Z... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002497.15.863e-2233.13pep scaffold:Pmarinus_7.0:GL476638:223513:267757:1... [more]
GAS2L18.090e-2256.79growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L18.841e-2261.11growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L13.025e-2156.79growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
ENSPMAT00000002308.13.201e-1931.52pep scaffold:Pmarinus_7.0:GL477003:24840:25679:-1 ... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GAS2 protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411931.491e-2333.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328259.799e-2334.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278044.228e-2257.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330927.432e-2255.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377064.283e-1240.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GAS2 protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2l11.211e-2665.75growth arrest specific 2 like 1 [Source:NCBI gene;... [more]
gas2a1.186e-2036.02growth arrest specific 2 [Source:NCBI gene;Acc:101... [more]
gas2a1.692e-2036.02growth arrest specific 2 [Source:NCBI gene;Acc:101... [more]
gas2b4.398e-1733.75growth arrest-specific protein 2-like [Source:NCBI... [more]
macf1b5.105e-1740.59microtubule actin crosslinking factor 1b [Source:Z... [more]
back to top
BLAST of GAS2 protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041563.10.000e+098.85SMESG000041563.1[more]
SMESG000041563.10.000e+098.98SMESG000041563.1[more]
SMESG000041563.10.000e+095.57SMESG000041563.1[more]
SMESG000061252.17.877e-3739.81SMESG000061252.1[more]
SMESG000043809.14.087e-1546.38SMESG000043809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018744 ID=SMED30018744|Name=GAS2 protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1927bp
TGTATATATACATATTTCTAGGAGAAAACCAACATGCCAGTCTTGATGTT
TAATCATCCTCATTCAAAAAATACTAAGGATTTATCATCACTGAATCAAT
CAAGAGCTCAAATGTCCGGTAATTCAGTTTATGAATTTATTTCCCATTCT
AAACCGGTTTCAAATTTCAATTGTAAAGATGAATATGTCGATGCAATGGT
TGAAGATCTTTGTGATTGGTTAAACTTTTTGTATAAACTGGACGATGAGA
ACAAAATGACCCCATCTAGATTTTTCTCTCAGTTACAAGATGGTGTAATT
CTCAATAAACATGCTAATTCTGTGCAATATTTGGCCGAGATTTATTTGAA
ATTAAAGAATAATTCATCTCGAGATTTACCTTTAAAAATTGGAAATCGAT
TTATTAAAGTCCCTATTAATCCACCAAAGTATGTGATTAGAGATTTTAGT
GCTCCAATGAATTCTTTTCACAAACGAGATAATGTTGCAAATTTTATACA
GTGGTGTAGAGACTTCAATATTCCTCCAAGTTTGACTTTTGAATCTGAGG
ATTTGATATTAATGAAACTTCCAAGGAACGTTGTTGTCTGTTTGTTAGAA
GTAGCTCGGATTGGAAAATTGTTCGGAATGGAAGTTCCAGATATTATACA
ATTGGAAGAAGATATAGACAATGAACTTATAAACCAAGTAGCCGTTCCTG
ATAAGATTGATAACATTATCGTAAATGATATAAATGAAAATATAATTACT
GACGTTCCTGTTGATCTATTAAATGTGACCATGCGTAAAAAACCGAAACA
TGATGTAAAAAAATCAAAAGAAGAAGGATTGGAAGAAATTGTAATGGAAA
CAATTGATTATTCAAAGGTAACAATGCGTAAAAAACCAAGACAATGTGAC
ATCGAAAGTTCAAAAGTCGTGGAAGATAATGAAGAGTTAATGAAAAAACT
CGATTATTATGACAATATTGTAAGAAATGTGAAGTCTACTAATGTTGAGT
TAAGTTCTCATTTTGATAATTGCGCTCAAGAAAATGAATTTCAGTCAATT
GGGCAAAAAGAATATTCGGATTCTGATTCCGTAAGTTCATATGGAGCTCC
ATTTTCAATACCTAAATACAAAGCTTTTAAACCAGTCGGTAGAGTAAAAA
TATACGATTGTTTTGATCAAAGCAATTTAGTTAAAGAAAAAAAATATCGA
GAAAAGTGCGATTTGAGATCTCTTGATGAACGAGTCAGAGAAATTCTAAG
CGAGTGCCAGTGCGCCGAAACATTTCCCATGAAAAGAATAAGTGAAGGAA
AATATCAATGGGGAGATAAGAAAACTCTAATATTCGTTAGGATCCTAAGG
AATCATGTTATGGTTCGTGTTGGGGGAGGTTGGGATACATTAAATGAATT
TCTTAGAAAACATGACCACTGTAGAAAAAATAGAGTTGATATCCAGAAGC
CTCCTTTAGTTGCTTCAGCAAATAGAAATGTGAAAGCTATTTTAGAAGTA
CAAAATAATAAAAAGCAGAAACCCGATAGTGAACTTAAATCTCTTAAGTC
AAATTATGATTTCAGTCGACGTCACAGTATGTTCTCAGATTATGAAAAAT
CAGCCAACCCACAAAGTAGCAATGAAAGACCCCTTACAGTTTCTCATTCA
AATAATAATTTTAAAACTTGTTCGAAGGGATTGTTAGAATCAAATAGTCA
ACCAATTTCATCAGATTGTATCGATAGTTCATCGTTTTCGTTGACAAATA
AAACCAGTGATACAGATATGACTAGAAGTAATAGTCAGTTTCTAATGTGT
AACTCAGATAGAATCCCAAATATTCAGTCAAATCAGAAACATTTTTCTAG
AATTCCCATTTTAAAAAAGAGATGAGCCAAGATTTTTATTCTTTTATCTG
CTTGAAGCCATATCATTTATTTCAGAA
back to top

protein sequence of SMED30018744-orf-1

>SMED30018744-orf-1 ID=SMED30018744-orf-1|Name=SMED30018744-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MPVLMFNHPHSKNTKDLSSLNQSRAQMSGNSVYEFISHSKPVSNFNCKDE
YVDAMVEDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYL
AEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDN
VANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGME
VPDIIQLEEDIDNELINQVAVPDKIDNIIVNDINENIITDVPVDLLNVTM
RKKPKHDVKKSKEEGLEEIVMETIDYSKVTMRKKPRQCDIESSKVVEDNE
ELMKKLDYYDNIVRNVKSTNVELSSHFDNCAQENEFQSIGQKEYSDSDSV
SSYGAPFSIPKYKAFKPVGRVKIYDCFDQSNLVKEKKYREKCDLRSLDER
VREILSECQCAETFPMKRISEGKYQWGDKKTLIFVRILRNHVMVRVGGGW
DTLNEFLRKHDHCRKNRVDIQKPPLVASANRNVKAILEVQNNKKQKPDSE
LKSLKSNYDFSRRHSMFSDYEKSANPQSSNERPLTVSHSNNNFKTCSKGL
LESNSQPISSDCIDSSSFSLTNKTSDTDMTRSNSQFLMCNSDRIPNIQSN
QKHFSRIPILKKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036534GAR_dom_sf
IPR036872CH_dom_sf
IPR003108GAR_dom
IPR001715CH-domain
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0005515protein binding
GO:0008093cytoskeletal adaptor activity
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003108GAR domainSMARTSM00243GAS2coord: 395..467
e-value: 3.8E-35
score: 132.8
IPR003108GAR domainPFAMPF02187GAS2coord: 397..464
e-value: 2.0E-30
score: 104.7
IPR003108GAR domainPROSITEPS51460GARcoord: 392..464
score: 35.305
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 55..190
e-value: 1.3E-6
score: 38.0
IPR001715Calponin homology domainPFAMPF00307CHcoord: 56..193
e-value: 2.8E-11
score: 43.5
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 53..195
score: 15.521
IPR036534GAR domain superfamilyGENE3DG3DSA:3.30.920.20coord: 389..481
e-value: 6.0E-29
score: 101.7
IPR036534GAR domain superfamilySUPERFAMILYSSF143575GAS2 domain-likecoord: 396..466
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 520..539
NoneNo IPR availablePANTHERPTHR46756FAMILY NOT NAMEDcoord: 38..583
NoneNo IPR availablePANTHERPTHR46756:SF8GAS2-LIKE PROTEIN PICKLED EGGScoord: 38..583
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 49..208