SMED30018739

Overview
NameSMED30018739
Smed IDSMED30018739
Length (bp)3073
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018739 (SMED30018739) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018739 (SMED30018739) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018739 (SMED30018739) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018739 (SMED30018739) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018739

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30018739SMESG000025343.1 SMESG000025332.1 dd_Smed_v4_6330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018739SMESG000025343.1 SMESG000025332.1 dd_Smed_v4_6330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30018739SMESG000025343.1 SMESG000025332.1 dd_Smed_v4_6330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018739SMESG000025343.1 SMESG000025332.1 dd_Smed_v4_6330_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30018739SMESG000025343.1 SMESG000025332.1 dd_Smed_v4_6330_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30018739SMESG000025343.1 SMESG000025332.1 dd_Smed_v4_6330_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018739 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001872:32449..43775 +13991
v31.001872:54716..61015 +12110
Homology
BLAST of SMED30018739 vs. TrEMBL
Match: A0A4S2LSL2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006687 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.142e-11
Identity = 71/370 (19.19%), Postives = 166/370 (44.86%), Query Frame = 3
Query: 1182 INQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWST--------------SVIPLVTQFFNSTSSVNATTTD---VINKFSMAENVXXXXXXXXXXXSTVLIIV--SFFRQFLYQKKWNKCAN---------FSIHICIFVSTVLAAIVSIALVLGASYVNVA------VCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPIT-LSQPTNIISGITVQCRNTS----IGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNM 2174
            I+ ++G++  Y+ +     ++LCPK+ T+P     C    + + Q+ T    S I  D S+ +  L  +  +N+T +   + ++  + +     ++       ++++    +  +W                 + P+V    +ST    A       +I   ++   +I I+L+        L+I+      +  Y+   +  A+           I   I +S +L + + + +++G + + +A       C+  +  +G+ ++D+ +N  I  +WPD+IAN    P+ + +  L  P +++ G+ V+C+ T      GLL  +G+  L+NV+ ++    ++ +++ ++NT   E +K   + +IP N+
Sbjct:  320 ISYLQGKVVGYKNALSRAFETLCPKV-TSPGAATQCTRLKADLEQWNTDFSASTILVDPSITLSELTAIFGVNVTQLLGEFDKLEAELDRKANEVVAQIEGNFNLTEQFQALNQLWDEINTNIGEPAVRSVNQISPIVISIVHSTGMAVAGLGYLFLIICTLALLVIIIYIILLATEAYERDLLIIRKDLMEEHCYENTMSAYASIPHTFPPSTHHIKCGIILSAILCSTIPLVVLVGGATILLASVGRNEACRYSSDPSGLKMTDEALNLYIRYIWPDLIANQSIDPSILDLLNLPTPKDVVDGLLVKCKQTGSSPQPGLLPSVGVDQLVNVTAVIEQPRLQESIDEAENTLVTELLKFDFASLIPGNV 688          
BLAST of SMED30018739 vs. TrEMBL
Match: A0A158QU66 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5809 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 6.857e-11
Identity = 112/552 (20.29%), Postives = 237/552 (42.93%), Query Frame = 3
Query: 1182 INQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMA-ENVXXXXXXXXXXXSTVLIIV-------------SFFRQFLYQKKW---NKCANFSIH--IC---------IFVST--VLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKIS-TVWPDVIANI---LSSPNAIPITLSQPTNIISGITVQC----RNTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNVXXXXXXXXXXXXXXXXXXXXGVP--DFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVKDDIQKVNASLANDTNVAAVFFSYYNQTIITNMMAXXXXXXXXXXXXXXNQIIPCNNLSFIFEALTTSLCTTNN 2717
            I+ + GQ  V       +LQ++C K    P L  TC S            + + I  D   ++ FL   L I++ ++ +   +V  +       ++    S +D+S +   +  IW T          N T +VN T  ++IN+ S   ++  +I   +    + +LI++               ++  L+ K++   ++  + S+   +C         IF +   +L ++V I ++ G + V  + C     T G+  SD ++N  I+  VWP V+  I   L+SP    ++L  P N+I+  TV C    R +  GL++ +G T+ I+VS++L +  I++ +   +    +E  K   +  IP ++ + L   + N++        +           +P  +   Y  +L  FV+  ++ +G+ NE   L R++ ++  +L      +     +   +  +Q  RN +  ++ + + ++ V   ++N T +       Y++ ++    + +   ++  + + T  ++PC +L    +AL    C  N 
Sbjct:  314 ISSLVGQFKVIHDLVHPELQNVC-KTDYGPQLNATCSSLKDRSSILIIQFNATAIKVDPPAVLHFLFNELGIDLDALLSQITQVSDKVVEVKGQVLDKIFSFLDLSSFFSPVIQIWET--------VSNETKNVNETFGNLINQTSKGVDSARVIFDAVVYTPAAILILILVVDVAVTIVYAIEAWKMGLFVKRYVESDRAVDSSMDTGVCNNTAYCVSAIFFALFLLLTSLVVIVVLPGTTVVASSGCVYLTETKGVAQSDYVLNSYIANEVWPGVLGQIEAILNSPTLDFLSLPAPRNVINATTVSCQPLQRASQGGLISAVGWTSFIDVSKLLNSQEIDSKIKEGEKVMKDEVTKLNLASYIPKDL-DKLAGTTKNLTQYFDKVDYTDSINELSHDR-LPTTELTRYADDLIAFVE-GLRLLGL-NENPILKRSAELIYSSLKTSQVVEEEAMKLRDAFVAVQMRRNLTNGIDYLLESVETVRVIVSNQTALLEPISGVYSK-LVVQFKSDLSLSLSPVIQTFTQDLLPCADLYRAVDALLVMTCKQNG 851          
BLAST of SMED30018739 vs. TrEMBL
Match: A0A075A250 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10213 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.261e-10
Identity = 75/370 (20.27%), Postives = 166/370 (44.86%), Query Frame = 3
Query: 1182 INQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMA-------------------ENVXXXXXXXXXXXSTVLIIVSFFRQFLYQKKWNKCANF-------SIHI-C--IFVSTVLAAIVSIALVLGASYVNVAV-----CQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIP-ITLSQPTNIISGITVQCR----NTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNM 2174
            I+ ++GQ+  Y+       ++LCPKL T+P     C +  + + Q++T  + S +  + S+ +  + ++  +N+T + + + ++  + +     ++       ++++    +  +W      +      S + ++ T T +I+   MA                      II+L         ++I      +  Y+   +  A+        + HI C  IF + + + I  + LV GA+ +  +V     C+   + +G+ ++D+ +N  I  VWP+ IAN    P  +  + L  P +++ G+ V+C+    N   GLL  +G+  L+NV+ +L    ++ +++ ++NT   E ++   S  IP N+
Sbjct:  320 ISYLQGQVVGYKNVLNRAFETLCPKL-TSPATATECTTLKADVEQWKTNFNASNLLVNPSITLSEVTELFGVNITQLLSEFDKLEAELDRKSNEMVAQIEGQFNLTEQFQALNQLWDEINTSIGEPAVRSVNQISPTVTSIIHSTGMAVAGVGYFFLIICTLALLVIIIYIILLATEAYERDLLIIRKDLMEEHCYENTMSAYASIPHTFPPSTHHIKCGIIFSAVLCSTIPLVVLVGGATILLTSVGSNEACRYSTNPSGLKITDEALNLYIRYVWPEFIANQSIDPGILDLLNLPTPKDVVDGLLVKCKQTGSNPEPGLLPSVGVDQLVNVTAVLEQPRLQESIDKAENTLVTEIVQFDFSSFIPGNV 688          
BLAST of SMED30018739 vs. TrEMBL
Match: A0A1S8WJ76 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_09713 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.577e-10
Identity = 75/370 (20.27%), Postives = 166/370 (44.86%), Query Frame = 3
Query: 1182 INQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMA-------------------ENVXXXXXXXXXXXSTVLIIVSFFRQFLYQKKWNKCANF-------SIHI-C--IFVSTVLAAIVSIALVLGASYVNVAV-----CQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPIT-LSQPTNIISGITVQCR----NTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNM 2174
            I+ ++GQ+  Y+       ++LCPKL T+P     C +  + + Q++T  + S +  + S+ +  + ++  +N+T + + + ++  + +     ++       ++++    +  +W      +      S + ++ T T +I+   MA                      II+L         ++I      +  Y+   +  A+        + HI C  IF + + + I  + LV GA+ +  +V     C+   + +G+ ++D+ +N  I  VWP+ IAN    P  + +  L  P +++ G+ V+C+    N   GLL  +G+  L+NV+ +L    ++ +++ ++NT   E ++   S  IP N+
Sbjct:  371 ISYLQGQVVGYKNVLNRAFETLCPKL-TSPATATECTTLKADVEQWKTNFNASNLLVNPSITLSEVTELFGVNITQLLSEFDKLEAELDRKSNEMVAQIEGQFNLTEQFQALNQLWDEINTSIGEPAVRSVNQISPTVTSIIHSTGMAVAGVGYFFLIICTLALLVIIIYIILLATEAYERDLLIIRKDLMEEHCYENTMSAYASIPHTFPPSTHHIKCGIIFSAVLCSTIPLVVLVGGATILLTSVGSNEACRYSTNPSGLKITDEALNLYIRYVWPEFIANQSIDPGILDLLNLPTPKDVVDGLLVKCKQTGSNPEPGLLPSVGVDQLVNVTAVLEQPRLQESIDKAENTLVTEIVQFDFSSFIPGNV 739          
BLAST of SMED30018739 vs. TrEMBL
Match: A0A4S2KWY6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010573 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 4.056e-9
Identity = 81/407 (19.90%), Postives = 183/407 (44.96%), Query Frame = 3
Query: 1044 KQFMDQILNAFHVNNLFNHVSALINGLNLLLDAMGYIK-ANKNLLNVINQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIW---STSV-IPLVTQFFNSTSSVNATTTDVINKFSMAENVXXXXXXXXXXXSTVLIIVSFFR-----QFLYQKKWNKCAN-----FSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPN-AIPITLSQPTNIISGITVQCRN---TSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNV 2207
            K    ++L  ++V  L N  + L N +N L + + ++K A    +N   Q+K ++   QQ+   D++ LC +L  +P L   C + L+ + + +   D +QI       +L +I     N+T V      + T+ +  +   I+   ++ ++++ L  +  +W    T V  P++ Q      +V+   T      + A+   +   I+ +  + VL+I+  F      Q        +C         +  C F+  +L  I  + ++L     N   C+   + +G+ ++D  +N  +  +WP +++     P+ ++ + +  P N++ GI +QC++   T  GLL  LG+ + +N + +     ++  +  ++     +  +   + ++P N+ N +N+L  ++
Sbjct:  224 KDIKKELLVRYNVRTLINEATTLSNDVNRLQEVIDHVKNAKTEAVNGTKQLKDKMDPLQQTLQSDVKQLCNRLQASP-LSAQCNNLLAQIDKVKFDFDDAQITVSDD--LLRVISTFGSNLTIVLDKLANLETKLDEQIEGTISQIENSFNLTQQLQPMLQLWDNLGTEVSDPVIQQLNQMEPTVDEALT------TAAKFTKMGGFIVLVLFTIVLVIILVFGIIASIQAARDSHGPRCCLCCGLILPVVFC-FLIPLLVLICGVIVLLSGIITNEG-CRYVGNPSGVVVTDGTLNLYLRYLWPQLMSEKFVDPSISLMLDIPVPKNVLDGILIQCKSSETTDPGLLPSLGVDHFLNATAMTDQPDLKKAVKEAEEALVTKIREFDFASVLPDNL-NEINKLIEDL 618          
BLAST of SMED30018739 vs. Planmine SMEST
Match: SMESG000027338.1 (SMESG000027338.1)

HSP 1 Score: 1124.38 bits (2907), Expect = 0.000e+0
Identity = 745/838 (88.90%), Postives = 770/838 (91.89%), Query Frame = 3
Query:  339 MDGLFNTITSMGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFGXXXXXXXXXXXXXXXXXXXYQCIKEYQIKSI----METGKIIIKKRKSTQKKSFVINHWKTXXXXXXXXXXXXXXXXXXXXSIEQYVVXXXXXXXXXXXXXXXXXXXXXXXXXXXAIGLSLKYFYNMYSIVAVDSLNFLXXXXXXXXXXXXXXXXXXXKQFMDQILNAFHVNNLFNHVSALINGLNLLLDAMGYIKANKNLLNVINQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVXXXXXXXXXXXSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNVXXXXXXXXXXXXXXXXXXXXGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVKDDIQKVNASLANDTNVAAVFFSYYNQTIITNMMAXXXXXXXXXXXXXXNQIIPCNNLSFIFEALTTSLCTTNNLKDXXXXXXXXXIMVTVMSQLISLLMVICTLLRLKCIQNSS 2840
            MDG+F+ ITSMG RFL NQSSVNNGDII II NDN  NLSTYFIEILFNISLYVPIYSNGSYQLNNL  TSNPYL TT FGI+WLLIF+  FILLVV  IYQCIKE QI S+     ++ +  I+ R+   K       WKT  + +MI  + LWII L LLSIEQYVVSTKISENSTNSTNSTSSNTNQYNSLTNAIGLSLKYFYNMYSIV VDSLNFLNSSVSTMSSSVSNQIQSSIKQFMDQILNAFHVNNLFNHVSALINGLN+LL+AM  I A ++LLNVINQ+KGQI VYQ +   DLQSLCPKLA   NL  TC SF ST+GQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQ VYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVN TTTDVINKFSMAENVIIILLIIFICLSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNL+NVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSL+RT S L+QNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLV +DIQKVNASLANDTNVA VFFS+Y QTIITNMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAALALLLIMVTVMSQLISLLMVICTLLRLKCIQNSS
Sbjct:    1 MDGVFDLITSMGNRFLTNQSSVNNGDIINIIANDNRVNLSTYFIEILFNISLYVPIYSNGSYQLNNLKPTSNPYLTTTSFGIYWLLIFIVLFILLVVVSIYQCIKENQINSMKNIDAKSTENPIRNRRKLMKT-----RWKTYLLILMIALVFLWIISLALLSIEQYVVSTKISENSTNSTNSTSSNTNQYNSLTNAIGLSLKYFYNMYSIVTVDSLNFLNSSVSTMSSSVSNQIQSSIKQFMDQILNAFHVNNLFNHVSALINGLNILLNAMEDINAKRDLLNVINQIKGQIKVYQSNMASDLQSLCPKLAAVSNLQQTCLSFQSTIGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQHVYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNVTTTDVINKFSMAENVIIILLIIFICLSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNLVNVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLSRTLSYLIQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVINDIQKVNASLANDTNVAVVFFSFYKQTIITNMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAALALLLIMVTVMSQLISLLMVICTLLRLKCIQNSS 833          
BLAST of SMED30018739 vs. Planmine SMEST
Match: SMESG000025332.1 (SMESG000025332.1)

HSP 1 Score: 998.038 bits (2579), Expect = 0.000e+0
Identity = 619/633 (97.79%), Postives = 624/633 (98.58%), Query Frame = 3
Query:  948 MYSIVAVDSLNFLXXXXXXXXXXXXXXXXXXXKQFMDQILNAFHVNNLFNHVSALINGLNLLLDAMGYIKANKNLLNVINQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVXXXXXXXXXXXSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNVXXXXXXXXXXXXXXXXXXXXGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVKDDIQKVNASLANDTNVAAVFFSYYNQTIITNMMAXXXXXXXXXXXXXXNQIIPCNNLSFIFEALTTSLCTTNNLKDXXXXXXXXXIMVTVMSQLISLLMVICTLLRLKCIQNSS*C 2846
            MYSIVAVDSLNFLNSSVSTMSSSVSNQIQSSIKQFMDQILNAF +N L NH+S L+NGLNLLLDAMGYIKANKNLLNVINQVKGQI VYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTM QFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVIIILLIIFICLSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNL+NVSQILRNTGIETTLNTSQ TSYNEFMKNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLV +DIQKVNASLANDTNVAAVFFSYYNQTIITNMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAALALLLIMVTVMSQLISLLMVICTLLRLKCIQNSS C
Sbjct:    1 MYSIVAVDSLNFLNSSVSTMSSSVSNQIQSSIKQFMDQILNAFLINGLLNHISTLLNGLNLLLDAMGYIKANKNLLNVINQVKGQISVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMAQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVIIILLIIFICLSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNLVNVSQILRNTGIETTLNTSQITSYNEFMKNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVINDIQKVNASLANDTNVAAVFFSYYNQTIITNMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAALALLLIMVTVMSQLISLLMVICTLLRLKCIQNSSKC 633          
BLAST of SMED30018739 vs. Planmine SMEST
Match: SMESG000025332.1 (SMESG000025332.1)

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 587/601 (97.67%), Postives = 592/601 (98.50%), Query Frame = 3
Query: 1044 KQFMDQILNAFHVNNLFNHVSALINGLNLLLDAMGYIKANKNLLNVINQVKGQIFVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLXXXXXXXXXXXDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVXXXXXXXXXXXSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFMKNKPSQIIPPNMVNTLNQLSSNVXXXXXXXXXXXXXXXXXXXXGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVKDDIQKVNASLANDTNVAAVFFSYYNQTIITNMMAXXXXXXXXXXXXXXNQIIPCNNLSFIFEALTTSLCTTNNLKDXXXXXXXXXIMVTVMSQLISLLMVICTLLRLKCIQNSS*C 2846
            KQFMDQILNAF +N L NH+S L+NGLNLLLDAMGYIKANKNLLNVINQVKGQI VYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTM QFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVIIILLIIFICLSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNL+NVSQILRNTGIETTLNTSQ TSYNEFMKNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLV +DIQKVNASLANDTNVAAVFFSYYNQTIITNMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAALALLLIMVTVMSQLISLLMVICTLLRLKCIQNSS C
Sbjct:   14 KQFMDQILNAFLINGLLNHISTLLNGLNLLLDAMGYIKANKNLLNVINQVKGQISVYQQSCIYDLQSLCPKLATNPNLYPTCQSFLSTMAQFQTTIDTSQINTDSSVIMLFLIQMLQINMTSVTTNYQEVYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTSVIPLVTQFFNSTSSVNATTTDVINKFSMAENVIIILLIIFICLSTVLIIVSFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVCQQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIISGITVQCRNTSIGLLNVLGMTNLVNVSQILRNTGIETTLNTSQITSYNEFMKNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVSYIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIMLTKYQILQNNRNNSLYVNLVINDIQKVNASLANDTNVAAVFFSYYNQTIITNMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAALALLLIMVTVMSQLISLLMVICTLLRLKCIQNSSKC 614          
BLAST of SMED30018739 vs. Planmine SMEST
Match: SMESG000025343.1 (SMESG000025343.1)

HSP 1 Score: 158.688 bits (400), Expect = 1.516e-45
Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 3
Query:  339 MDGLFNTITSMGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFG 581
            MDGLFNTITSMGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFG
Sbjct:    1 MDGLFNTITSMGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFG 81          
BLAST of SMED30018739 vs. Planmine SMEST
Match: SMESG000025343.1 (SMESG000025343.1)

HSP 1 Score: 139.428 bits (350), Expect = 7.469e-39
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 3
Query:  369 MGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFG 581
            MGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFG
Sbjct:    1 MGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNISLYVPIYSNGSYQLNNLNSTSNPYLITTGFG 71          
The following BLAST results are available for this feature:
BLAST of SMED30018739 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LSL22.142e-1119.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A158QU666.857e-1120.29Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A075A2501.261e-1020.27Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8WJ761.577e-1020.27Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2KWY64.056e-919.90Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of SMED30018739 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018739 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027338.10.000e+088.90SMESG000027338.1[more]
SMESG000025332.10.000e+097.79SMESG000025332.1[more]
SMESG000025332.10.000e+097.67SMESG000025332.1[more]
SMESG000025343.11.516e-45100.00SMESG000025343.1[more]
SMESG000025343.17.469e-39100.00SMESG000025343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018739 ID=SMED30018739|Name=SMED30018739|organism=Schmidtea mediterranea sexual|type=transcript|length=3073bp
TGGTTTTTTGTTCTATTTCAAAAAATATGGTGACAACTCAGATCTCATTT
GATGAATCAATTTCTTTTAAATGCATTTTCGGCCAATCACTGACTCAGGC
CGTGATGTAGAAGGCTTTAATAACTTTCAGAAAATCAAATTCATCATTAG
TAAGTACAATGCACGATTATTATTATTGTTATAATTATTATTTTGGTCTG
TGAATGACAAAGGAATCAAAGAATGCTCATCTATGCTCAAATTTTGAGAT
TTTATAGTTCGAATTAATCAGTTGAAAATAAAGTCGAATCCGATTTGTCG
GAATAATCCTAAACGATTACCATAGAAACACCAATACAATGGATGGATTA
TTCAATACAATCACGAGTATGGGCTATCGATTCCTCATCAACCAATCATC
TGTCAATAATGGCGACATTATAAAGATCATAACCAATGATAATTCTTTCA
ACTTATCGACATATTTTATCGAAATCCTATTCAACATCTCTCTCTATGTA
CCGATTTACAGCAATGGATCATATCAATTAAACAATTTAAATTCAACTTC
AAATCCTTATTTGATTACGACAGGATTTGGAATATTCTGGTTGTTGATAT
TTTTATTTTTTTTTATCTTGCTTGTTGTGGCAATAATTTATCAATGCATT
AAGGAATATCAAATCAAATCAATAATGGAAACCGGCAAAATCATAATTAA
GAAAAGGAAATCAACTCAAAAAAAGTCTTTTGTGATAAACCATTGGAAAA
CCATTTTTATAGGAATAATGATTCTGTTTCTTTTGTTGTGGATTATCTTT
CTAATATTACTGTCGATTGAACAATATGTTGTCAGTACTAAGATATCTGA
GAATTCTACAAATTCTACAAATTCCACCAGTTCCAATACCAACCAATACA
ATTCGTTAACCAATGCGATTGGATTATCATTGAAATACTTTTATAATATG
TACTCCATTGTTGCGGTGGACTCGTTGAACTTTCTGAACTCTTCAGTGTC
TACAATGAGCTCATCAGTGTCTAATCAAATACAATCATCAATAAAGCAGT
TCATGGATCAAATTCTGAATGCATTTCACGTTAACAACTTATTCAATCAC
GTCTCAGCATTAATCAACGGTCTAAATCTCCTCCTTGACGCTATGGGATA
TATAAAAGCCAACAAAAATCTACTCAATGTTATAAATCAAGTAAAAGGTC
AAATATTCGTGTATCAGCAGAGTTGTATTTATGATTTACAAAGTCTCTGT
CCCAAGTTAGCCACTAATCCAAACTTGTATCCGACATGCCAAAGTTTTCT
ATCAACGATGGGACAATTTCAAACGACTATCGACACTTCCCAAATTAATA
CAGATTCAAGCGTCATAATGTTGTTCCTCATACAAATGCTGCAGATCAAC
ATGACAAGTGTCACTACGAATTATCAAGAAGTATACACTCAGTTTAACAA
CACCCTCACCTCTATCATCACATCTTCCACCTCCACAATTGACGTATCGA
AATACCTTGGTGTCATCACGAACATTTGGTCTACCTCAGTCATTCCACTG
GTTACTCAATTCTTCAATTCAACATCCAGCGTCAATGCCACCACAACAGA
TGTTATTAATAAATTTTCCATGGCGGAAAATGTCATCATAATATTGTTGA
TTATATTTATCTGTTTATCAACAGTTTTGATAATTGTTTCTTTCTTCCGC
CAATTTTTATATCAAAAAAAATGGAATAAATGTGCAAATTTCTCTATTCA
TATTTGCATCTTTGTTTCCACGGTATTGGCAGCTATTGTCTCAATAGCTC
TAGTATTGGGGGCAAGTTACGTCAATGTCGCCGTTTGTCAGCAATTCAAT
TCGACAAATGGAATAACTTTATCAGATCAAATGATTAATAAAAAGATTTC
AACAGTATGGCCAGATGTTATTGCAAATATTCTAAGCTCCCCCAACGCTA
TTCCAATAACTTTAAGTCAACCGACAAATATTATTTCCGGAATCACTGTT
CAATGCCGCAATACAAGCATTGGATTACTGAATGTGCTGGGGATGACCAA
TCTTATCAATGTCAGTCAAATTCTGCGCAATACTGGCATTGAGACTACTC
TCAATACCTCGCAGAATACTTCATATAATGAATTTATGAAAAATAAGCCA
TCACAAATAATACCTCCCAATATGGTCAATACCCTCAATCAACTTAGCTC
AAATGTTTCAATTCTTGATAGCTATGATTATTCATCTAGCATTCAGCAGC
TGTCTATTCCATTACTAGGAGTTCCGGATTTCGTTTCATACATTCAAAAT
CTGTCGACATTTGTACAAAGCTCAATAAAACAAATCGGAATGACAAACGA
ATTATCGTCGCTCAACAGAACTTCATCCATTCTCGTTCAGAATCTTCCAA
ATTATAGTGATACCCAAAACTCAGTGGCTATCATGCTTACAAAGTACCAA
ATCCTACAAAACAATCGAAACAATTCCTTATACGTCAATCTGGTTAAAGA
TGACATTCAAAAGGTTAATGCCAGCTTGGCCAATGATACGAATGTAGCTG
CGGTTTTCTTTTCTTATTACAACCAAACAATTATCACAAATATGATGGCT
TCGATCATCCAAATTATTACTTCGAGTCTCACTTCTGTCACCAATCAAAT
AATACCTTGTAACAATTTGTCTTTCATTTTCGAAGCTTTGACGACATCAT
TGTGCACCACGAATAACCTGAAAGATGCTCTGGCAGCACTTGCACTGCTT
TTAATAATGGTCACAGTCATGAGTCAGCTCATTTCACTTTTAATGGTGAT
CTGTACATTGTTGAGACTGAAATGTATTCAGAATTCATCATAATGCTGGA
GAACATATCTGAAGATCTGTTACGTCAGGGTTGCATGTTGGAACTAGACG
GCTTCAACTTAAACTGATTTGATTATCTCAATATTAATATAAAATTTTCA
ATATACAAATCTCGAATAACAGAACTTTATCTCAACAGTTGTCGTAACTT
GATAAAAATTATAAGTTGTCCATTCCTTTCCTTTATTCCTTGGTCAGTAT
TATGAGAATATCATTGTTTGCCA
back to top

protein sequence of SMED30018739-orf-1

>SMED30018739-orf-1 ID=SMED30018739-orf-1|Name=SMED30018739-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=835bp
MDGLFNTITSMGYRFLINQSSVNNGDIIKIITNDNSFNLSTYFIEILFNI
SLYVPIYSNGSYQLNNLNSTSNPYLITTGFGIFWLLIFLFFFILLVVAII
YQCIKEYQIKSIMETGKIIIKKRKSTQKKSFVINHWKTIFIGIMILFLLL
WIIFLILLSIEQYVVSTKISENSTNSTNSTSSNTNQYNSLTNAIGLSLKY
FYNMYSIVAVDSLNFLNSSVSTMSSSVSNQIQSSIKQFMDQILNAFHVNN
LFNHVSALINGLNLLLDAMGYIKANKNLLNVINQVKGQIFVYQQSCIYDL
QSLCPKLATNPNLYPTCQSFLSTMGQFQTTIDTSQINTDSSVIMLFLIQM
LQINMTSVTTNYQEVYTQFNNTLTSIITSSTSTIDVSKYLGVITNIWSTS
VIPLVTQFFNSTSSVNATTTDVINKFSMAENVIIILLIIFICLSTVLIIV
SFFRQFLYQKKWNKCANFSIHICIFVSTVLAAIVSIALVLGASYVNVAVC
QQFNSTNGITLSDQMINKKISTVWPDVIANILSSPNAIPITLSQPTNIIS
GITVQCRNTSIGLLNVLGMTNLINVSQILRNTGIETTLNTSQNTSYNEFM
KNKPSQIIPPNMVNTLNQLSSNVSILDSYDYSSSIQQLSIPLLGVPDFVS
YIQNLSTFVQSSIKQIGMTNELSSLNRTSSILVQNLPNYSDTQNSVAIML
TKYQILQNNRNNSLYVNLVKDDIQKVNASLANDTNVAAVFFSYYNQTIIT
NMMASIIQIITSSLTSVTNQIIPCNNLSFIFEALTTSLCTTNNLKDALAA
LALLLIMVTVMSQLISLLMVICTLLRLKCIQNSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000141dorsal region of the whole animal
PLANA:0003117parapharyngeal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 803..825
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 473..495