T-complex protein subunit epsilon

Overview
NameT-complex protein subunit epsilon
Smed IDSMED30018729
Length (bp)1797
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-complex protein subunit epsilon (SMED30018729) t-SNE clustered cells

Violin plots show distribution of expression levels for T-complex protein subunit epsilon (SMED30018729) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-complex protein subunit epsilon (SMED30018729) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-complex protein subunit epsilon (SMED30018729) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018729

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018729h1SMcG0002601 Contig7433newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018729h1SMcG0002601 Contig7433uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30018729h1SMcG0002601 dd_Smed_v4_544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018729h1SMcG0002601 dd_Smed_v4_544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018729h1SMcG0002601 dd_Smed_v4_544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
testisSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogonial stem cellSMED30018729h1SMcG0002601 MF669567.1smed_ncbi_20240424PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
epidermisSMED30018729h1SMcG0002601 dd_Smed_v6_544_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018729h1SMcG0002601 dd_Smed_v6_544_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein subunit epsilon vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 387/535 (72.34%), Postives = 462/535 (86.36%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 MGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 372/503 (73.96%), Postives = 436/503 (86.68%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            SHIMAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:   15 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 517          
BLAST of T-complex protein subunit epsilon vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 776.548 bits (2004), Expect = 0.000e+0
Identity = 369/500 (73.80%), Postives = 433/500 (86.60%), Query Frame = 2
Query:  149 MAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            MAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    1 MAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 500          
BLAST of T-complex protein subunit epsilon vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 339/535 (63.36%), Postives = 408/535 (76.26%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+                          N  RT                             + G  VLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 MGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVA--------------------------NTMRT-----------------------------SLGPNVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 483          
BLAST of T-complex protein subunit epsilon vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 312/429 (72.73%), Postives = 369/429 (86.01%), Query Frame = 2
Query:  350 TTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIR 1636
            + G  VLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR
Sbjct:   13 SLGPNVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIR 441          
BLAST of T-complex protein subunit epsilon vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 345/531 (64.97%), Postives = 441/531 (83.05%), Query Frame = 2
Query:   47 AQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            AQ+  DE G+P +++R++E +KR+ G++A KSHI+AA+ V+N LRTSLGP+GLDK++V+PD D+T+TNDG TIME MDV+H +AKLMVELSKSQD EIGDGTTGVVVLAG+LLE+AE+L++RGIHPI+I+DG+++A K  LE LD ISD+F    EN+E L++TA T+LGSKIVN+  RQFAE+AV A+LSVADIE KDV+FE+IK++GKVGG L D+ILVKG+++DK  SHPQMPK +K+AK+AILTC FEPPKPKTKH L + + +DF+ L  YE + F  M+ QVK SGA L ICQWGFDDEANHLL   +LPAVRWVGGPEIEL+AIAT  RIVPRF EL+ EKLG AG+VRE++FG  KD+ML IE+C N+KAVT F+RGG++MI+DEAKR+LHDALCV+RNLVRD R+VYGGG++E+A ++ V+  AD+I G+EQYA RAFA+ALE+IP+AL+ENSGL  I  +++LKA+Q++     LG+D    GT DMKEQ V+ETL SK+ QI LA QV +MILKIDD+RV
Sbjct:    6 AQLLFDESGQPFIVMREQENQKRITGVEAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDSISDKFPV--ENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKDVNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDVRV 534          
BLAST of T-complex protein subunit epsilon vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 345/531 (64.97%), Postives = 441/531 (83.05%), Query Frame = 2
Query:   47 AQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            AQ+  DE G+P +++R++E +KR+ G++A KSHI+AA+ V+N LRTSLGP+GLDK++V+PD D+T+TNDG TIME MDV+H +AKLMVELSKSQD EIGDGTTGVVVLAG+LLE+AE+L++RGIHPI+I+DG+++A K  LE LD ISD+F    EN+E L++TA T+LGSKIVN+  RQFAE+AV A+LSVADIE KDV+FE+IK++GKVGG L D+ILVKG+++DK  SHPQMPK +K+AK+AILTC FEPPKPKTKH L + + +DF+ L  YE + F  M+ QVK SGA L ICQWGFDDEANHLL   +LPAVRWVGGPEIEL+AIAT  RIVPRF EL+ EKLG AG+VRE++FG  KD+ML IE+C N+KAVT F+RGG++MI+DEAKR+LHDALCV+RNLVRD R+VYGGG++E+A ++ V+  AD+I G+EQYA RAFA+ALE+IP+AL+ENSGL  I  +++LKA+Q++     LG+D    GT DMKEQ V+ETL SK+ QI LA QV +MILKIDD+RV
Sbjct:    6 AQLLFDESGQPFIVMREQENQKRITGVEAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDSISDKFPV--ENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKDVNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDVRV 534          
BLAST of T-complex protein subunit epsilon vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 462.225 bits (1188), Expect = 2.533e-160
Identity = 212/328 (64.63%), Postives = 267/328 (81.40%), Query Frame = 2
Query:  656 LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            +IK++GKVGG L D+ILVKG+++DK  SHPQMPK +K+AK+AILTC FEPPKPKTKH L + + +DF+ L  YE + F  M+ QVK SGA L ICQWGFDDEANHLL   +LPAVRWVGGPEIEL+AIAT  RIVPRF EL+ EKLG AG+VRE++FG  KD+ML IE+C N+KAVT F+RGG++MI+DEAKR+LHDALCV+RNLVRD R+VYGGG++E+A ++ V+  AD+I G+EQYA RAFA+ALE+IP+AL+ENSGL  I  +++LKA+Q++     LG+D    GT DMKEQ V+ETL SK+ QI LA QV +MILKIDD+RV
Sbjct:    1 MIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDVRV 328          
BLAST of T-complex protein subunit epsilon vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 462.225 bits (1188), Expect = 2.533e-160
Identity = 212/328 (64.63%), Postives = 267/328 (81.40%), Query Frame = 2
Query:  656 LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            +IK++GKVGG L D+ILVKG+++DK  SHPQMPK +K+AK+AILTC FEPPKPKTKH L + + +DF+ L  YE + F  M+ QVK SGA L ICQWGFDDEANHLL   +LPAVRWVGGPEIEL+AIAT  RIVPRF EL+ EKLG AG+VRE++FG  KD+ML IE+C N+KAVT F+RGG++MI+DEAKR+LHDALCV+RNLVRD R+VYGGG++E+A ++ V+  AD+I G+EQYA RAFA+ALE+IP+AL+ENSGL  I  +++LKA+Q++     LG+D    GT DMKEQ V+ETL SK+ QI LA QV +MILKIDD+RV
Sbjct:    1 MIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDVRV 328          
BLAST of T-complex protein subunit epsilon vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 462.225 bits (1188), Expect = 2.533e-160
Identity = 212/328 (64.63%), Postives = 267/328 (81.40%), Query Frame = 2
Query:  656 LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            +IK++GKVGG L D+ILVKG+++DK  SHPQMPK +K+AK+AILTC FEPPKPKTKH L + + +DF+ L  YE + F  M+ QVK SGA L ICQWGFDDEANHLL   +LPAVRWVGGPEIEL+AIAT  RIVPRF EL+ EKLG AG+VRE++FG  KD+ML IE+C N+KAVT F+RGG++MI+DEAKR+LHDALCV+RNLVRD R+VYGGG++E+A ++ V+  AD+I G+EQYA RAFA+ALE+IP+AL+ENSGL  I  +++LKA+Q++     LG+D    GT DMKEQ V+ETL SK+ QI LA QV +MILKIDD+RV
Sbjct:    1 MIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDVRV 328          
BLAST of T-complex protein subunit epsilon vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087987)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 371/532 (69.74%), Postives = 451/532 (84.77%), Query Frame = 2
Query:   53 IAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
             A DEYGRP +ILRD+E++KR+ G DA K+HIMAA+ +++ L+TSLGPKGLDKIMV+PD D+TVTNDG TIM++M+V+HEIAKLMV+LS+SQDDEIGDGTTGVVVLAG+LLEQAE L++RGIHPIRI+DG+E+AA+  +++LD I+  F    +NKEPLIQ AMTTLGSKIVNKCHRQ AEMAV A+L+VADIE+KDV+FELIK++ KVGG + DS+LVKGVIVDK  SH QMPK +++ K+AILTC FEPPKPKTKH L V + +D+  L +YE +KF +MV QVK +GA L ICQWGFDDEANHLL Q+ LPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLG AG+VRE++FGT+KDKMLVIEECKNSKAVT F+RGG+ MI+ EAKRS+HDA+CVVR+LV+D R+VYGGGA+EI+CSLAV+  ADQ+  LEQYA RAF+ ALE+IP+AL+ENSGL  I T++ELKARQ+ E    LGVDC   G  DMK   V+E+L SKK QI+L+ Q+ KMILKIDD+R   E
Sbjct:    8 FAFDEYGRPFIILRDQERQKRITGTDAIKTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKDVNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQWGFDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKNSKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDVRSKNE 539          
BLAST of T-complex protein subunit epsilon vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087988)

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 353/503 (70.18%), Postives = 428/503 (85.09%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +HIMAA+ +++ L+TSLGPKGLDKIMV+PD D+TVTNDG TIM++M+V+HEIAKLMV+LS+SQDDEIGDGTTGVVVLAG+LLEQAE L++RGIHPIRI+DG+E+AA+  +++LD I+  F    +NKEPLIQ AMTTLGSKIVNKCHRQ AEMAV A+L+VADIE+KDV+FELIK++ KVGG + DS+LVKGVIVDK  SH QMPK +++ K+AILTC FEPPKPKTKH L V + +D+  L +YE +KF +MV QVK +GA L ICQWGFDDEANHLL Q+ LPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLG AG+VRE++FGT+KDKMLVIEECKNSKAVT F+RGG+ MI+ EAKRS+HDA+CVVR+LV+D R+VYGGGA+EI+CSLAV+  ADQ+  LEQYA RAF+ ALE+IP+AL+ENSGL  I T++ELKARQ+ E    LGVDC   G  DMK   V+E+L SKK QI+L+ Q+ KMILKIDD+R   E
Sbjct:    7 THIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKDVNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQWGFDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKNSKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDVRSKNE 509          
BLAST of T-complex protein subunit epsilon vs. Ensembl Fly
Match: CCT4 (gene:FBgn0032444 transcript:FBtr0080411)

HSP 1 Score: 316.62 bits (810), Expect = 8.951e-101
Identity = 189/509 (37.13%), Postives = 298/509 (58.55%), Query Frame = 2
Query:  128 DAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERK-DVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGF-----DDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            D   S+I AAK VS+ +RTSLGP+G+DK++   + ++++TNDG TI++ M+V H  AK++VELS++QD   GDGTT VVV+AG+LLE  E+LL++G+HP  ISD ++  +   +E L ++S       +++E LI++A T+L SK+V++     A +AV A+L V D  ++  VD + IKV   +GGT+ D+ LV G++     +    PK I+ AKI ++      PK    HN+ V      + + K E    + +V Q+K SG N+++ Q         D A H L +     V+ V   +IE +      R +   +  T E L +A +V E++ GT  +K + I   +N  + V+   RG ++++++EA RSLHDALCVVR LV+    + GGGA EI  +L ++  A  + G++ Y  RAFA+ALE IP  L+EN+GL  I+TV EL+ R   +     G++ ++    D+  + V++ L    + I LA +  + ILKIDDI
Sbjct:   25 DVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCSNKAVEILKQMSTPIEL--DDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAVLKVTDPGKETSVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVIVSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGT--NKFVKITGIQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRH-AQGEKNAGINVRKGAITDIFAENVVQPLLVSISSITLATETIRSILKIDDI 528          
BLAST of T-complex protein subunit epsilon vs. Ensembl Fly
Match: CCT2 (gene:FBgn0030086 transcript:FBtr0071289)

HSP 1 Score: 270.396 bits (690), Expect = 5.116e-83
Identity = 177/526 (33.65%), Postives = 296/526 (56.27%), Query Frame = 2
Query:   77 PLVILRDE--EKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDND---ITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKEN-KEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKT-KHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            P+ +L++E  E+K  +    A  S  + A  + ++++++LGPKG+DKI+V    +   + VTNDG TI+  + V++  AK++V++S+ QD+E+GDGTT V VLA  LL +AE+L+E+ +HP  I  G+  A ++ LE L   +     S E  +  L+  A TTL SKI+++    FA +AV A++ +    +   + + I++  K GGTL DS L +G ++DK     Q P+ I++A+I I     +  K K    ++ V+++    +L   E +K  E VD++     N+ I +    +    L     + ++       IE +A  TGG IV  FE  +  KLG   ++ ++  G  +D +L     K  +A T  IRG ++ I+DEA RSLHDALCV+   V++ R+++GGG SE   + AV   A + PG E  A+ AFA AL ++P A+++N+G  S   V+EL+A    +    LG+D +     D++E  + E+ + K+  +M A +  +MIL++D+I
Sbjct:    7 PVRVLKNEAQEEKAEM----ARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRL----KGSGELKSIQIIKKSGGTLGDSFLDEGFLLDKKPGVHQ-PQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIVSTFENPSLVKLGECDVIEQVMIG--EDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGH-AQGKQTLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNI 520          
BLAST of T-complex protein subunit epsilon vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0302371)

HSP 1 Score: 255.758 bits (652), Expect = 2.527e-77
Identity = 172/528 (32.58%), Postives = 288/528 (54.55%), Query Frame = 2
Query:   74 RPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEEL-DKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIE--RKDVDFE-LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRL---GVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            +P+++L   +  KR  G      +I A K +++++RT LGP+ + K++++P   I +TNDG  I+  + V+H  AK M+E++++QD+E+GDGTT V+VLAG +L  AE  L++ IHP  I   Y  A +  +  L  ++S Q     ++K  +       +G+K + K      ++A+ A+ +V   E  R +VD +   KV+   GG + +S ++KGV+++KD +HP+M + I++ +I +L C+ E  K +++ N+ +   +DF  + + E +    +   + A   +LV  + G  D A H L +  + A+R +   +   IA A G  IV R EELT + +G  AG+      G   +    + ECK  KA T  +RG S+ I++E +R+L DAL V RNLV +PR+V GGGA E+A S  ++    Q+ G       A A ALE IP  L++N G  +I  +  L+A+        +   G+D +     DM  + + E L+ K      AV+   ++L+IDDI
Sbjct:    6 QPILVL--SQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQ--LDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIG--DEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTR--KQVKG----PYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDI 521          
BLAST of T-complex protein subunit epsilon vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 388/531 (73.07%), Postives = 458/531 (86.25%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIR 1636
            +  +A DEYGRP +I++D++KK RL G++A KSHI+AAK V+N LRTSLGP GLDK+MV+ D ++TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLEQAEQLL+RGIHPIRI+DGY+ AAK+ +E+LDKI D F     N E L+QTAMTTLGSK++N+CHRQ AE+AV AIL+VAD+ERKDVDFELIKV+GKVGG L D+ L+KGVIVDK+FSHPQMPK +KD KIAILTC FEPPKPKTKH L V +V+D++ L KYE DKF EM+ QVK +GANL ICQWGFDDEANHLL Q  LPA+RWVGGPEIELIAIATGGRIVPRF ELTPEKLG AG+V+E+ FGTTKD+MLVIEECKNS+AVT FIRGG++MI++EAKR+LHDALCV+RNLVRD R+VYGGGASEIAC+LAV+ AAD+ P LEQYAMRAFA+ALE IP+AL+ENSGL  I T+ E++ARQ+KE N  LG+DC  + T DMK+Q V+ETL  KK QI LA QV KMILKIDDIR
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDKKSRLTGLEALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQWGFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGTAGLVKEICFGTTKDRMLVIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSALGIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIR 534          
BLAST of T-complex protein subunit epsilon vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 320.472 bits (820), Expect = 3.983e-102
Identity = 186/505 (36.83%), Postives = 302/505 (59.80%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD-IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I A K V++ +RTSLGPKG+DK++ +   D+T+TNDG TI++ M V H  AK+MVELSK+QD E GDGTT VVV+AG+LL+   +LL++GIHP  IS+ ++ A    +E L  IS   + S  ++E L+ +A T+L SK+V++     A M+V A++ V D      VD   I V  K+GGT+ D  LV G+++ +  +   + + ++ AKI ++     PPK    + + V      + + + E    + +V QVK +G  +++ Q         D A H L +  +  ++ +   EIE I    G + +   ++ TPE LG+A +V E+S   +  K++ I  C +  K V+  +RG ++++++EA+RS+HDALCV+R LV+   ++ GGGA EI  +L ++  A  + G+E Y +RA+A+ALE IP  L+EN+GL  ISTV EL+ R   +     G++ ++ G  ++ E+LV++ L    + + LA +  + ILKIDD+
Sbjct:   30 SNINAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTSISTPLLLS--DRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVMKVIDPATATSVDLRDINVVKKLGGTIDDCELVDGMVLTQRVASTGVSR-VEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREEIEFICKTIGTKPIAHIDQFTPEMLGSAELVEEVSLDGS-GKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRH-AQGETTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDL 529          
BLAST of T-complex protein subunit epsilon vs. Ensembl Zebrafish
Match: cct3 (chaperonin containing TCP1, subunit 3 (gamma) [Source:ZFIN;Acc:ZDB-GENE-020419-5])

HSP 1 Score: 296.59 bits (758), Expect = 1.049e-92
Identity = 174/525 (33.14%), Postives = 301/525 (57.33%), Query Frame = 2
Query:   71 GRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIE--RKDVDF-ELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            GRP+++L   +  KR  G      +I AAKT+++I+RT LGP+ + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG +L  AEQ LE+ +HP  +   Y  A    L  L  IS     S  N++ +++   + + +K +++       +A+ A+ +V   E  RK++D  +  KV+   GG + DS +++GV+V+KD +HP+M + IK+ +I +L C+ E  K +++ ++ +   +DF  + + E +   ++ + +     +L+  + G  D A H L + N+ A+R +   +   IA A G RI  R +ELT + +G  AG+      G   +    + ECK+ KA T  +RG S+ I+ E +R+L DA+ V RN++ DP ++ GGGA E+  S  ++  +  + G+EQ+  RA A+ALE +P  L +N G  +I  +  L+A+  +E N   GV+ +     DM++  + E L+ K      AV+   ++L+IDDI
Sbjct:    3 GRPVLVL--SQNIKRESGRKVQIGNISAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVIGAYRQALDDMLNILKDISTPVDVS--NRDMMLKIINSAINTKALSRWSTLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLRGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEIAREEDFARILQMEEEYVQQICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELTEDDVGTGAGLFEVKKIG--DEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMEVSHRLTERSRAMTGVEQWPYRAVAQALEVVPRTLIQNCGASAIRVLTSLRAKHTQEGNSSWGVNGETGTLADMEQLGIWEPLAVKAQTYKTAVETAILLLRIDDI 521          
BLAST of T-complex protein subunit epsilon vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 251.136 bits (640), Expect = 2.282e-75
Identity = 173/530 (32.64%), Postives = 278/530 (52.45%), Query Frame = 2
Query:  110 KRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKEN--KEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDV------DFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRF------EELTPEKLGNA-GIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKA-RQLKEANP------RLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            +R  G      ++MAA +++NI+++SLGP GLDK++V+   D+T+TNDG TI+++++VEH  AK++ EL++ QD E+GDGTT VV++A  LL+ A++L+++ IHP  I  GY +A   C E +  I++      ++  +E L+  A T++ SKI+      FA M V A ++V  ++ K V         ++K  G+   +  +S LV G  ++       M K + +AKIA L  + +  K K    + +   +  + + + E D   E V ++ ASGAN+V+   G DD            AVR V   +++ IA ATG  +          E   P  LG A  +V+E       D++++I+  K   + +  +RG +  + DE +RSLHDALCVV+ ++    VV GGGA E A S+ + N A  +   EQ A+  FA +L  IP  L+ N+   S   VA+L+A     + NP       +G+D       D K+  V E    K   +  A +    IL+IDD+
Sbjct:   11 QRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLA---CKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGR---SQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQER---VCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDL 531          
BLAST of T-complex protein subunit epsilon vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 251.136 bits (640), Expect = 2.629e-75
Identity = 173/530 (32.64%), Postives = 278/530 (52.45%), Query Frame = 2
Query:  110 KRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKEN--KEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDV------DFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRF------EELTPEKLGNA-GIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKA-RQLKEANP------RLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            +R  G      ++MAA +++NI+++SLGP GLDK++V+   D+T+TNDG TI+++++VEH  AK++ EL++ QD E+GDGTT VV++A  LL+ A++L+++ IHP  I  GY +A   C E +  I++      ++  +E L+  A T++ SKI+      FA M V A ++V  ++ K V         ++K  G+   +  +S LV G  ++       M K + +AKIA L  + +  K K    + +   +  + + + E D   E V ++ ASGAN+V+   G DD            AVR V   +++ IA ATG  +          E   P  LG A  +V+E       D++++I+  K   + +  +RG +  + DE +RSLHDALCVV+ ++    VV GGGA E A S+ + N A  +   EQ A+  FA +L  IP  L+ N+   S   VA+L+A     + NP       +G+D       D K+  V E    K   +  A +    IL+IDD+
Sbjct:   13 QRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLA---CKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGR---SQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQER---VCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDL 533          
BLAST of T-complex protein subunit epsilon vs. Ensembl Xenopus
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:394966])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 392/535 (73.27%), Postives = 465/535 (86.92%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL G+DA KSHIMAAK V+N LRTSLGP GLDK+MV+ D  +TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLEQAEQLL+RGIHPIRI+DGYE AA++ +E LDKISD F    EN EPLI+TAMTTLGSK++N+CHRQ AE+AV +IL+VAD++RKDVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK +KDAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF+EMV Q+K +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AGIV+E+SFGTTKD+MLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNLVRD R+VYGGGA+EI+C+LAVS AAD+ P LEQYAMRAFA+ALE IP++L+ENSG+  I T+ E++++Q+KE+NP LG+DC   GT DMK+Q V+ETL  KK QI LA QV KMILKIDDIR   E
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDRKSRLSGLDALKSHIMAAKAVANTLRTSLGPNGLDKMMVDKDGQVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYEQAARIAVEHLDKISDSFPVDPENLEPLIRTAMTTLGSKVINRCHRQMAEIAVNSILTVADMDRKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKDFSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFLEMVKQIKDTGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGYAGIVKEISFGTTKDRMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNRIVYGGGAAEISCALAVSEAADKCPSLEQYAMRAFADALEIIPMSLAENSGMNPIQTMTEVRSKQVKESNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRRPGE 538          
BLAST of T-complex protein subunit epsilon vs. Ensembl Xenopus
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:394966])

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 375/499 (75.15%), Postives = 439/499 (87.98%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIR 1636
            SHIMAAK V+N LRTSLGP GLDK+MV+ D  +TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLEQAEQLL+RGIHPIRI+DGYE AA++ +E LDKISD F    EN EPLI+TAMTTLGSK++N+CHRQ AE+AV +IL+VAD++RKDVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK +KDAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF+EMV Q+K +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AGIV+E+SFGTTKD+MLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNLVRD R+VYGGGA+EI+C+LAVS AAD+ P LEQYAMRAFA+ALE IP++L+ENSG+  I T+ E++++Q+KE+NP LG+DC   GT DMK+Q V+ETL  KK QI LA QV KMILKIDDIR
Sbjct:   14 SHIMAAKAVANTLRTSLGPNGLDKMMVDKDGQVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYEQAARIAVEHLDKISDSFPVDPENLEPLIRTAMTTLGSKVINRCHRQMAEIAVNSILTVADMDRKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKDFSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFLEMVKQIKDTGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGYAGIVKEISFGTTKDRMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNRIVYGGGAAEISCALAVSEAADKCPSLEQYAMRAFADALEIIPMSLAENSGMNPIQTMTEVRSKQVKESNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIR 512          
BLAST of T-complex protein subunit epsilon vs. Ensembl Xenopus
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:394966])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 344/535 (64.30%), Postives = 412/535 (77.01%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL G+DA KSHIMAAK V+                          N  RT                             + G  VLAG+LLEQAEQLL+RGIHPIRI+DGYE AA++ +E LDKISD F    EN EPLI+TAMTTLGSK++N+CHRQ AE+AV +IL+VAD++RKDVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK +KDAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF+EMV Q+K +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AGIV+E+SFGTTKD+MLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNLVRD R+VYGGGA+EI+C+LAVS AAD+ P LEQYAMRAFA+ALE IP++L+ENSG+  I T+ E++++Q+KE+NP LG+DC   GT DMK+Q V+ETL  KK QI LA QV KMILKIDDIR   E
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDRKSRLSGLDALKSHIMAAKAVA--------------------------NTLRT-----------------------------SLGPNVLAGALLEQAEQLLDRGIHPIRIADGYEQAARIAVEHLDKISDSFPVDPENLEPLIRTAMTTLGSKVINRCHRQMAEIAVNSILTVADMDRKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKDFSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFLEMVKQIKDTGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGYAGIVKEISFGTTKDRMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNRIVYGGGAAEISCALAVSEAADKCPSLEQYAMRAFADALEIIPMSLAENSGMNPIQTMTEVRSKQVKESNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRRPGE 483          
BLAST of T-complex protein subunit epsilon vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 322.398 bits (825), Expect = 8.998e-103
Identity = 183/505 (36.24%), Postives = 305/505 (60.40%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKD-VDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I A K V++ +RTSLGPKG+DK++ +   D+T+TNDG TI+++M V H  AK++VELSK+QD E GDGTT VVV+AG+LL+   +LL++GIHP  IS+ +++A+   +E L  +S     S  ++E L+ +A T+L SK+V++     A M+V A++ V D +  + VD   IK+  K+GGT+ D  +V G+++ +  ++  + + ++ AKI ++      PK    + + V      + + + E    + +V Q+K +G N+++ Q         D A H L +  +  V+ +   +IE I    G + V   ++ T + L +A +  E+S   +  K++ I  C N  K VT  +RG ++++++EA+RS+HDALCV+R LV+   ++ GGGA EI  SL ++  A  + G+E Y +RAFA+ALE IP  L+EN+GL  ISTV EL+ R   +     G++ ++ G  ++ E+LV++ L    + + LA +  + ILKIDD+
Sbjct:   25 SNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELS--DRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAANTGVTR-VEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGS-GKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRH-AQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDV 524          
BLAST of T-complex protein subunit epsilon vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 322.783 bits (826), Expect = 1.012e-102
Identity = 183/505 (36.24%), Postives = 305/505 (60.40%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKD-VDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I A K V++ +RTSLGPKG+DK++ +   D+T+TNDG TI+++M V H  AK++VELSK+QD E GDGTT VVV+AG+LL+   +LL++GIHP  IS+ +++A+   +E L  +S     S  ++E L+ +A T+L SK+V++     A M+V A++ V D +  + VD   IK+  K+GGT+ D  +V G+++ +  ++  + + ++ AKI ++      PK    + + V      + + + E    + +V Q+K +G N+++ Q         D A H L +  +  V+ +   +IE I    G + V   ++ T + L +A +  E+S   +  K++ I  C N  K VT  +RG ++++++EA+RS+HDALCV+R LV+   ++ GGGA EI  SL ++  A  + G+E Y +RAFA+ALE IP  L+EN+GL  ISTV EL+ R   +     G++ ++ G  ++ E+LV++ L    + + LA +  + ILKIDD+
Sbjct:   34 SNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELS--DRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAANTGVTR-VEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGS-GKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRH-AQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDV 533          
BLAST of T-complex protein subunit epsilon vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 382/535 (71.40%), Postives = 460/535 (85.98%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+T+TNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ ++ LDKISD+ +    N EPLIQTA TTLGSK++N CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK + DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE+NP LG+DC   G+ DM+ Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 VGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKTKHKLDVMSVEDYKALQKYEKEKFEEMIKQIKETGANLAICQWGFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 311.612 bits (797), Expect = 2.532e-103
Identity = 147/199 (73.87%), Postives = 176/199 (88.44%), Query Frame = 2
Query:  149 MAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHP 745
            MAAK V+N +RTSLGP GLDK+MV+ D D+T+TNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ ++ LDKISD+ +    N EPLIQTA TTLGSK++N CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHP
Sbjct:    1 MAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHP 199          
BLAST of T-complex protein subunit epsilon vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 316.62 bits (810), Expect = 1.983e-100
Identity = 181/505 (35.84%), Postives = 303/505 (60.00%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD-IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I AAK V++ +RTSLGPKG+DK++ +   D+T+TNDG TI++ M V H  A+++VELSK+QD E GDGTT VV++AGSLL+   +LL++GIHP  IS+ ++ A +  LE L  +S     S  ++E L+ +A T+L SK+V++     + M+V A++ V D      VD   IK+  K+GGT+ D  LV+G+++ +  ++  + + ++ AKI ++      PK    + + V      + + + E    + +V Q+K +G N+++ Q         D A H L +  +  V+ V   +IE I    G + V   ++ T + LG+A +  E+S   +  K+  I  C +  K VT  +RG ++++++EA+RS+HDALCV+R LV+   ++ GGGA EI  +L ++  +  + G+E Y +RAFA+A+E IP  L+EN+GL  ISTV EL+ R   +     G++ ++ G  ++ E++V++ L    + + LA +  + ILKIDD+
Sbjct:   36 SNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLS--DRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVANSGITR-VEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGS-GKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRH-AQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDV 535          
BLAST of T-complex protein subunit epsilon vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 305.834 bits (782), Expect = 3.254e-96
Identity = 179/524 (34.16%), Postives = 307/524 (58.59%), Query Frame = 2
Query:   74 RPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIE--RKDVDF-ELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            RP+++L   +  KR  G      +I AAKT+++I+RT LGPK + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG +L  AE  LE+ +HP  +   Y MA    +  L KIS     +  N+E ++    +++ +K++++       +A+ A+ +V   E  RK++D  +  +V+   GG + DS +++GV+++KD +HP+M + IK+ +I +L  + E  K +++ ++ +   +DF  + + E +   ++ + +     ++VI + G  D A H L + N+ A+R V   +   IA A G RIV R EEL  + +G  AG++     G   +    I +CK+ KA T  +RG S+ I+ E +R+L DA+ V RN++ DP++V GGGASE+A + A++  +  + G+EQ+  RA A+ALE IP  L +N G  +I  +  L+A+  +E+    GV+ +     DMKE  + E L+ K      AV+   ++L+IDDI
Sbjct:    5 RPVLVL--SQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVN--NREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIG--DEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDI 522          
BLAST of T-complex protein subunit epsilon vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 297.36 bits (760), Expect = 2.982e-93
Identity = 175/514 (34.05%), Postives = 300/514 (58.37%), Query Frame = 2
Query:   74 RPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIE--RKDVDF-ELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQV 1603
            RP+++L   +  KR  G      +I AAKT+++I+RT LGPK + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG +L  AE  LE+ +HP  +   Y MA    +  L KIS     +  N+E ++    +++ +K++++       +A+ A+ +V   E  RK++D  +  +V+   GG + DS +++GV+++KD +HP+M + IK+ +I +L  + E  K +++ ++ +   +DF  + + E +   ++ + +     ++VI + G  D A H L + N+ A+R V   +   IA A G RIV R EEL  + +G  AG++     G   +    I +CK+ KA T  +RG S+ I+ E +R+L DA+ V RN++ DP++V GGGASE+A + A++  +  + G+EQ+  RA A+ALE IP  L +N G  +I  +  L+A+  +E+    GV+ +     DMKE  + E L+ K      AV+V
Sbjct:    5 RPVLVL--SQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVN--NREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIG--DEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVEV 512          
BLAST of T-complex protein subunit epsilon vs. UniProt/SwissProt
Match: sp|Q4R6V2|TCPE_MACFA (T-complex protein 1 subunit epsilon OS=Macaca fascicularis OX=9541 GN=CCT5 PE=2 SV=1)

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 387/535 (72.34%), Postives = 462/535 (86.36%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 MGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. UniProt/SwissProt
Match: sp|P48643|TCPE_HUMAN (T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1)

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 387/535 (72.34%), Postives = 462/535 (86.36%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 MGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. UniProt/SwissProt
Match: sp|Q5RF02|TCPE_PONAB (T-complex protein 1 subunit epsilon OS=Pongo abelii OX=9601 GN=CCT5 PE=2 SV=1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 385/535 (71.96%), Postives = 461/535 (86.17%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ +E LDKISD  +   ++ EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHP+MPK ++DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q NLPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+E +C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE NP LG+DC   GT DMK+Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 MGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPRMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAETSCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. UniProt/SwissProt
Match: sp|Q68FQ0|TCPE_RAT (T-complex protein 1 subunit epsilon OS=Rattus norvegicus OX=10116 GN=Cct5 PE=1 SV=1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 384/535 (71.78%), Postives = 459/535 (85.79%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ ++ LDKISD  +    N EPLIQTA TTLGSK+VN CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK + +AKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+VRE+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE+NP LG+DC   G+ DM+ Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 VGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDNVLVDINNPEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKEVLNAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIAQIKETGANLAICQWGFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVREISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. UniProt/SwissProt
Match: sp|P80316|TCPE_MOUSE (T-complex protein 1 subunit epsilon OS=Mus musculus OX=10090 GN=Cct5 PE=1 SV=1)

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 382/535 (71.40%), Postives = 460/535 (85.98%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D+++K RL+G++A KSHIMAAK V+N +RTSLGP GLDK+MV+ D D+T+TNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AEQLL+RGIHPIRI+DGYE AA++ ++ LDKISD+ +    N EPLIQTA TTLGSK++N CHRQ AE+AV A+L+VAD+ER+DVDFELIKV+GKVGG L D+ L+KGVIVDKDFSHPQMPK + DAKIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ Q+K +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AG+V+E+SFGTTKDKMLVIE+CKNS+AVT FIRGG++MI++EAKRSLHDALCV+RNL+RD RVVYGGGA+EI+C+LAVS  AD+ P LEQYAMRAFA+ALE IP+ALSENSG+  I T+ E++ARQ+KE+NP LG+DC   G+ DM+ Q V+ETL  KK QI LA Q+ +MILKIDDIR   E
Sbjct:    4 VGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKTKHKLDVMSVEDYKALQKYEKEKFEEMIKQIKETGANLAICQWGFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGE 538          
BLAST of T-complex protein subunit epsilon vs. TrEMBL
Match: A0A4E0RK69 (T-complex protein subunit epsilon OS=Fasciola hepatica OX=6192 GN=D915_007906 PE=3 SV=1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 422/544 (77.57%), Postives = 487/544 (89.52%), Query Frame = 2
Query:   17 LPLVMAGRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +P +M GR   Q+A DE+GRP +I RDEEKKKRL GI AHKSHI+AAK+V++ LRTSLGPKGLDK++V+PD DITVTNDGRTI++ MDVEHEIAKL+V+LS+SQDDEIGDGTTGVVVLAGSLLEQAEQLL+RG+HPIRI+DG+E+AAK CL+ L +ISDQF FS+++KEPLI+TAMT LGSKIVN+C R FAE+AV AIL+VAD+ER+DVDFELIKV+GKVGG L DS+LVKGVI+DKDFSHPQMP+S++DA++AILTC FEPPKPKTKHNL+V +V+D+  L +YE +KF EMV  VKA+GANLVICQWGFDDEANHLL Q+ LPAVRWVGGPEIELIAIATGGRIVPRFEELT  KLG AG VRELSFGTTK++MLVIE+C NSKAVTCF+RG SRMIVDEAKR+LHDALCVVRNLVRD RVV GGGA EIAC+LAVS  AD+I GLEQYAMRAFA+ALEAIP+AL+ENSG P I TVAELKARQL E NPRLGVDC  VGT DM++Q VLETLSSK+AQI+LAVQ+CKMILKIDDIRV  +
Sbjct:    4 MPPMMQGRPQGQLAFDEFGRPFIIFRDEEKKKRLTGIGAHKSHILAAKSVAHTLRTSLGPKGLDKLLVSPDGDITVTNDGRTILDKMDVEHEIAKLLVQLSQSQDDEIGDGTTGVVVLAGSLLEQAEQLLDRGLHPIRIADGFELAAKRCLDVLSEISDQFEFSEKDKEPLIKTAMTALGSKIVNRCQRLFAEIAVDAILAVADLERRDVDFELIKVEGKVGGRLEDSLLVKGVIIDKDFSHPQMPRSVEDARLAILTCPFEPPKPKTKHNLFVSSVEDYNKLKEYEQNKFKEMVQMVKATGANLVICQWGFDDEANHLLLQEKLPAVRWVGGPEIELIAIATGGRIVPRFEELTTAKLGKAGSVRELSFGTTKERMLVIEDCVNSKAVTCFLRGSSRMIVDEAKRALHDALCVVRNLVRDSRVVAGGGACEIACALAVSAEADKIGGLEQYAMRAFADALEAIPMALAENSGFPPILTVAELKARQLTEKNPRLGVDCLNVGTNDMRDQNVLETLSSKRAQILLAVQLCKMILKIDDIRVSVD 547          
BLAST of T-complex protein subunit epsilon vs. TrEMBL
Match: A0A0X3NMZ8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR36271 PE=3 SV=1)

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 413/531 (77.78%), Postives = 480/531 (90.40%), Query Frame = 2
Query:   47 AQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            +Q+A DEYGRP +I+RD+E+KKRL GI AHKSHI+AAKTVS IL+TSLGPKGLDK++V+PD D+TVTNDGRTI+E MDVEHEIAKL+V+LS+SQDDEIGDGTTGVVVLAG+LLEQAE LL+RGIHPIRI+DGYE+AA +CL+ L+ IS++F +S E+KEPLI+TAMT LGSKIV++C RQFAEMAV A+L VAD+ERKDVDFELIKV+GKVGG L DSILVKGV+VDKDFSHPQMPK +KDAK+AILTC FEPPKPKTKHNL+VE+V+D+  L +YE +KF EMVD VKA+GANLVICQWGFDDEANHLL  K LPAVRWVGG EIELIAIATGGRIVPRFEELT EKLG AGIVRE+ FGTTK++MLVIE+CKN+KAVTCF+RG SRMIVDEAKRSLHDALCVVRNLVRDPRVV GGGA E+ACS+AV++ AD+I  LEQYAMRAFA+ALE+IP+ALSENSGLPSI TVA +K RQ++E NP LG+DC   GT DM+EQ V ETL+SK+AQIMLAVQ+CKMIL+IDDIR+
Sbjct:    9 SQLAFDEYGRPFIIIRDQERKKRLTGIQAHKSHILAAKTVSCILKTSLGPKGLDKLLVSPDGDVTVTNDGRTILEKMDVEHEIAKLLVQLSRSQDDEIGDGTTGVVVLAGALLEQAEALLDRGIHPIRIADGYELAANICLKLLNDISEEFKYSAEDKEPLIKTAMTALGSKIVSRCQRQFAEMAVDAVLCVADLERKDVDFELIKVEGKVGGRLEDSILVKGVVVDKDFSHPQMPKEVKDAKLAILTCPFEPPKPKTKHNLFVESVEDYRKLRQYEQEKFTEMVDSVKATGANLVICQWGFDDEANHLLLSKQLPAVRWVGGAEIELIAIATGGRIVPRFEELTTEKLGRAGIVREMCFGTTKERMLVIEDCKNTKAVTCFLRGSSRMIVDEAKRSLHDALCVVRNLVRDPRVVAGGGACELACSIAVASEADKISTLEQYAMRAFADALESIPVALSENSGLPSIETVAYVKGRQVQEKNPHLGIDCLNKGTADMREQNVFETLTSKRAQIMLAVQLCKMILRIDDIRI 539          
BLAST of T-complex protein subunit epsilon vs. TrEMBL
Match: A0A3P7CIB3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS10775 PE=3 SV=1)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 413/531 (77.78%), Postives = 480/531 (90.40%), Query Frame = 2
Query:   47 AQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            +Q+A DEYGRP +I+RD+E+KKRL GI AHKSHI+AAKTVS IL+TSLGPKGLDK++V+PD D+TVTNDGRTI+E MDVEHEIAKL+V+LS+SQDDEIGDGTTGVVVLAG+LLEQAE LL+RGIHPIRI+DGYE+AA +CL+ L+ IS++F +S E+KEPLI+TAMT LGSKIV++C RQFAEMAV A+L VAD+ERKDVDFELIKV+GKVGG L DSILVKGV+VDKDFSHPQMPK +KDAK+AILTC FEPPKPKTKHNL+VE+V+D+  L +YE +KF EMVD VKA+GANLVICQWGFDDEANHLL  K LPAVRWVGG EIELIAIATGGRIVPRFEELT EKLG AGIVRE+ FGTTK++MLVIE+CKN+KAVTCF+RG SRMIVDEAKRSLHDALCVVRNLVRDPRVV GGGA E+ACS+AV++ AD+I  LEQYAMRAFA+ALE+IP+ALSENSGLPSI TVA +K RQ++E NP LG+DC   GT DM+EQ V ETL+SK+AQIMLAVQ+CKMIL+IDDIR+
Sbjct:    6 SQLAFDEYGRPFIIIRDQERKKRLTGIQAHKSHILAAKTVSCILKTSLGPKGLDKLLVSPDGDVTVTNDGRTILEKMDVEHEIAKLLVQLSRSQDDEIGDGTTGVVVLAGALLEQAEALLDRGIHPIRIADGYELAANICLKLLNDISEEFKYSAEDKEPLIKTAMTALGSKIVSRCQRQFAEMAVDAVLCVADLERKDVDFELIKVEGKVGGRLEDSILVKGVVVDKDFSHPQMPKEVKDAKLAILTCPFEPPKPKTKHNLFVESVEDYRKLRQYEQEKFTEMVDSVKATGANLVICQWGFDDEANHLLLSKQLPAVRWVGGAEIELIAIATGGRIVPRFEELTTEKLGRAGIVREMCFGTTKERMLVIEDCKNTKAVTCFLRGSSRMIVDEAKRSLHDALCVVRNLVRDPRVVAGGGACELACSIAVASEADKISTLEQYAMRAFADALESIPVALSENSGLPSIETVAYVKGRQVQEKNPHLGIDCLNKGTADMREQNVFETLTSKRAQIMLAVQLCKMILRIDDIRI 536          
BLAST of T-complex protein subunit epsilon vs. TrEMBL
Match: A0A183T2S7 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=3 SV=1)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 413/531 (77.78%), Postives = 480/531 (90.40%), Query Frame = 2
Query:   47 AQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRV 1639
            +Q+A DEYGRP +I+RD+E+KKRL GI AHKSHI+AAKTVS IL+TSLGPKGLDK++V+PD D+TVTNDGRTI+E MDVEHEIAKL+V+LS+SQDDEIGDGTTGVVVLAG+LLEQAE LL+RGIHPIRI+DGYE+AA +CL+ L+ IS++F +S E+KEPLI+TAMT LGSKIV++C RQFAEMAV A+L VAD+ERKDVDFELIKV+GKVGG L DSILVKGV+VDKDFSHPQMPK +KDAK+AILTC FEPPKPKTKHNL+VE+V+D+  L +YE +KF EMVD VKA+GANLVICQWGFDDEANHLL  K LPAVRWVGG EIELIAIATGGRIVPRFEELT EKLG AGIVRE+ FGTTK++MLVIE+CKN+KAVTCF+RG SRMIVDEAKRSLHDALCVVRNLVRDPRVV GGGA E+ACS+AV++ AD+I  LEQYAMRAFA+ALE+IP+ALSENSGLPSI TVA +K RQ++E NP LG+DC   GT DM+EQ V ETL+SK+AQIMLAVQ+CKMIL+IDDIR+
Sbjct:    6 SQLAFDEYGRPFIIIRDQERKKRLTGIQAHKSHILAAKTVSCILKTSLGPKGLDKLLVSPDGDVTVTNDGRTILEKMDVEHEIAKLLVQLSRSQDDEIGDGTTGVVVLAGALLEQAEALLDRGIHPIRIADGYELAANICLKLLNDISEEFKYSAEDKEPLIKTAMTALGSKIVSRCQRQFAEMAVDAVLCVADLERKDVDFELIKVEGKVGGRLEDSILVKGVVVDKDFSHPQMPKEVKDAKLAILTCPFEPPKPKTKHNLFVESVEDYRKLRQYEQEKFTEMVDSVKATGANLVICQWGFDDEANHLLLSKQLPAVRWVGGAEIELIAIATGGRIVPRFEELTTEKLGRAGIVREMCFGTTKERMLVIEDCKNTKAVTCFLRGSSRMIVDEAKRSLHDALCVVRNLVRDPRVVAGGGACELACSIAVASEADKISTLEQYAMRAFADALESIPVALSENSGLPSIETVAYVKGRQVQEKNPHLGIDCLNKGTADMREQNVFETLTSKRAQIMLAVQLCKMILRIDDIRI 536          
BLAST of T-complex protein subunit epsilon vs. TrEMBL
Match: A0A183P9Z6 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS11182 PE=3 SV=1)

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 419/540 (77.59%), Postives = 483/540 (89.44%), Query Frame = 2
Query:   35 GRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAEDV 1654
            GR   Q+A DEYGRP +ILRD+EKKKRL GI AHKSHIMAAKTV+  LRTSLGPKGLDK++V+PD D+TVTNDGRTI++ MDVEHEIAKL+V+LS+SQDDEIGDGTTGVVVLAG+LLEQAEQLL++G+HPIRI+DGYE+AAK CL  L++IS QF FS EN+EPLI+TAMTTLGSKIVN+C R FAEMAV A+LSVAD++R+DVDFELIKV+GKVGG L DS+LVKGVIVDKDFSHPQMP+S+++A++AILTC FEPPKPKTKHNL+V + +D+  L  YE  KF EMV +VK +GANLVICQWGFDDEANHLL ++ LPAVRWVGGPEIELIAIATGGRIVPRFEELT EKLG AG+VRELSFGTTK++MLVIE+C+NSKAVTCFIRG SRMIVDEAKRSLHDALCVVRNLVRD RV+ GGGA EIACSL+V+  AD++ GLEQYAMRAFA+ALEAIP+AL+ENSGLP I TV+ELKARQL + NPRLGVDC  VGT DM  Q VLETLSSK+AQIMLAVQ+CKMILKIDDIRV  +++
Sbjct:    6 GRAQGQLAFDEYGRPFIILRDQEKKKRLCGIQAHKSHIMAAKTVAGTLRTSLGPKGLDKLLVSPDGDVTVTNDGRTILDKMDVEHEIAKLLVQLSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDKGLHPIRIADGYELAAKHCLSTLEEISVQFEFSIENREPLIKTAMTTLGSKIVNRCQRMFAEMAVDAVLSVADLQRRDVDFELIKVEGKVGGRLEDSLLVKGVIVDKDFSHPQMPRSVENARLAILTCPFEPPKPKTKHNLFVSSTEDYHKLRDYEQKKFEEMVKKVKDTGANLVICQWGFDDEANHLLLREKLPAVRWVGGPEIELIAIATGGRIVPRFEELTKEKLGKAGVVRELSFGTTKERMLVIEQCENSKAVTCFIRGSSRMIVDEAKRSLHDALCVVRNLVRDSRVIAGGGACEIACSLSVAAEADKVEGLEQYAMRAFADALEAIPMALAENSGLPPIVTVSELKARQLCDHNPRLGVDCLNVGTNDMYHQNVLETLSSKRAQIMLAVQLCKMILKIDDIRVSVDEL 545          
BLAST of T-complex protein subunit epsilon vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 390/535 (72.90%), Postives = 461/535 (86.17%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D++KK RL G+DA KSHIMAAK V+N L+TSLGP GLDK+MV+ D ++TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLEQAEQLL+RGIHPIRI+DGY+ AA++ +E LDKI D F     N EPLIQTAMTTLGSK++N+CHRQ AE+AV AIL+VAD+ERKDVDFELIK++GKVGG L D+ L+KGVIVDK+FSHPQMPK +KD KIAILTC FEPPKPKTKH L + +V+D++ L KYE +KF EM+ QVK +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AG+VREL FGTTKD+ML+IEECKNS+AVT FIRGG++MI++EAKR+LHDALCV+RNLVRD R+VYGGGASEI+C+LAV+ AAD+ P LEQYAMRAFA+ALE IP+AL+ENSGL  I T+ E++ARQ+KE+N  LG+DC R+ T DMK+Q V+ETL  KK QI LA QV KMILKIDDIR   E
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDKKFRLTGLDALKSHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRNPGE 538          
BLAST of T-complex protein subunit epsilon vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 359/535 (67.10%), Postives = 422/535 (78.88%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D++KK RL G+DA KSHIMAAK V+N L+TSLGP GLDK+MV+ D ++TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLEQAEQLL+RGIHPIRI+DGY+ AA++ +E LDKI D F     N EPLIQTAMTTLGSK++N+CHRQ AE+AV AIL+VAD+ERKDVDFELIK++GKVGG L D+ L+KGVIVDK+FSHPQMPK                                                  VK +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AG+VREL FGTTKD+ML+IEECKNS+AVT FIRGG++MI++EAKR+LHDALCV+RNLVRD R+VYGGGASEI+C+LAV+ AAD+ P LEQYAMRAFA+ALE IP+AL+ENSGL  I T+ E++ARQ+KE+N  LG+DC R+ T DMK+Q V+ETL  KK QI LA QV KMILKIDDIR   E
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDKKFRLTGLDALKSHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPK--------------------------------------------------VKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRNPGE 488          
BLAST of T-complex protein subunit epsilon vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 342/535 (63.93%), Postives = 406/535 (75.89%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D++KK RL G+DA KSHIMAAK                           V N  +T                             + G  VLAG+LLEQAEQLL+RGIHPIRI+DGY+ AA++ +E LDKI D F     N EPLIQTAMTTLGSK++N+CHRQ AE+AV AIL+VAD+ERKDVDFELIK++GKVGG L D+ L+KGVIVDK+FSHPQMPK +KD KIAILTC FEPPKPKTKH L + +V+D++ L KYE +KF EM+ QVK +GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AG+VREL FGTTKD+ML+IEECKNS+AVT FIRGG++MI++EAKR+LHDALCV+RNLVRD R+VYGGGASEI+C+LAV+ AAD+ P LEQYAMRAFA+ALE IP+AL+ENSGL  I T+ E++ARQ+KE+N  LG+DC R+ T DMK+Q V+ETL  KK QI LA QV KMILKIDDIR   E
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDKKFRLTGLDALKSHIMAAKA--------------------------VANTLKT-----------------------------SLGPNVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKDVDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDIRNPGE 483          
BLAST of T-complex protein subunit epsilon vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 308.531 bits (789), Expect = 5.179e-97
Identity = 183/507 (36.09%), Postives = 300/507 (59.17%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD-IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIE--LIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I A K V++ +RTSLGPKG+DK++ +   D+T+TNDG TI++ M V H  AK++VELSK+QD E GDGTT VVV+AG+LL+   +LL++GIHP  IS+ ++ A    +E L  IS     S  ++E L+ +A T+L SK+V++     A M+V A++ V D      VD   I +  K+GGT+ D  LV G+++ +   +  + + ++ AKI ++     PPK    + + V      + + + E    + ++ Q+K +G N+++ Q         D A H L +  +  V+ +   EIE  L     G + +   ++ TPE LG A +  E+S   +  K++ I  C +  K V+  +RG ++++++EA+RS+HDALCV+R LV+   ++ GGGA EI  +L ++  A  + G+E Y +RA+A+ALE IP  L+EN+GL  ISTV EL+ R   +     G++ ++ G  ++ E+LV++ L    + + LA +  + ILKIDD+
Sbjct:   30 SNISAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTSISQPVELS--DRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATSVDLRDIHIVKKLGGTIDDCELVDGLVLTQRVVNTGVSR-VEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLNKMKIMVVKDIEREEIEEQLNICTIGTKPIAHIDQFTPEMLGLAELAEEVSLDGS-GKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRH-AQGEKTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDV 531          
BLAST of T-complex protein subunit epsilon vs. Ensembl Cavefish
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:103023813])

HSP 1 Score: 295.434 bits (755), Expect = 1.717e-92
Identity = 174/525 (33.14%), Postives = 299/525 (56.95%), Query Frame = 2
Query:   71 GRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIE--RKDVDF-ELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            GRP+++L   +  KR  G      +I AAKT+++++RT LGP+ + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG +L  AEQ LE+ +HP  +   Y  A    L  L +IS      + ++  +++   + + +K +++       +A+ A+ +V   E  RK++D  +  KV+   GG + DS ++KGV+V+KD +HP+M + IK+ +I +L C+ E  K +++ ++ +   +DF  + + E +    + + +     +L+  + G  D A H L + N+ A+R +   +   IA A G RI  R +EL  E +G  AG+      G   +    + ECK+ KA T  +RG S+ I+ E +R+L DA+ V RN++ DP ++ GGGA E+A S  ++  +  + G+EQ+  RA A+ALE IP  L +N G  +I  +  L+A+  +E +   GV+ +     DM E  + E L+ K      AV+   ++L+IDDI
Sbjct:    3 GRPVLVL--SQNMKRESGRKVQTGNINAAKTIADVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVISAYRQALDDMLSMLKEISTP--VDQNDRSMMLKIINSAINTKALSRWSSLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLKGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEITREEDFAKILQMEEEYIQLICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEVKKIG--DEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMAVSHRLTERSRALTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGSTSWGVNGETGTLADMVELGIWEPLAVKAQTYKTAVETAILLLRIDDI 521          
BLAST of T-complex protein subunit epsilon vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 383/539 (71.06%), Postives = 454/539 (84.23%), Query Frame = 2
Query:   41 QIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGT-CDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAEDV 1654
            Q   +A DEYGRP +I++D+++K RL G+DA KSHIMAAK+V++ LRTSLGPKGLDK+MV+ D DITVTNDG TI+ MMDVEH++AKLMVELS+SQDDEIGDGTTGVVVLAG+LLEQAEQLL+RGIHPIRISDGYE AA++ +  LD I++ +     N E L+ TAMTTLGSKIVN+C R  AE+AV A+LSVAD+ERKDVDFELIKV+GKVGG L D+ L+KGV+VDKDFSHPQMPK + +AKIAILTC FEPPKPKTKH L V  V+D++ L +YE +KF EMV QVK +GANL ICQWGFDDEANHLL Q  LPAVRWVGG EIELIAIATGGRIVPRF ELT +KLG+AGIVRELSFGTTKD MLVIE+C NS+AVT FIRGG++MI++EAKRS+HDALCV+RNLVRD RVVYGGG++EI+CSLAVS AAD+   LEQYAMRAFA+ALE IP+AL+ENSGL SI  +AE+++RQL E  P LG++C +  +  DMKEQ V+ETL  KK QI LA Q+ KMILKIDDIR   E++
Sbjct:    3 QTGTLAFDEYGRPFIIIKDQDRKSRLSGLDALKSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLERKDVDFELIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWGFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGHAGIVRELSFGTTKDHMLVIEQCHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYLGINCMQSSSKGDMKEQHVIETLIGKKQQISLATQMVKMILKIDDIRSPGENI 541          
BLAST of T-complex protein subunit epsilon vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 316.235 bits (809), Expect = 3.943e-101
Identity = 182/507 (35.90%), Postives = 305/507 (60.16%), Query Frame = 2
Query:  134 HKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD-IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
              S+I AAK +++ +RTSLGPKG+DK++ +   D+T+TNDG TI++ M V H  AK++VELSK+QD E GDGTT VVV+AG+LL+ + +LL++GIHP  IS+ ++ A +   E L+ +S     S  +++ L+ +A T L SK+V++     A M+V A++ V D      VD   IK+  K+GGT+ D  LV+G+++ +  S+  + + ++ AKI ++     PPK   ++ + +      + + + E    + +V QVK +G N+++ Q         D A H L +  +  V+ +   +IE I    G + +   +  T E L +A +V E+S G++  K++ +  C N  K ++  +RG ++++++EA+RSLHDALCV+R LV+   ++ GGGA EI  SL ++  A  +  +E Y +RA+ EA+E IP  L+EN+GL  ISTV EL+ R   +     G++ ++ G  ++ E+LV++ L    + + L+ +  + ILKIDDI
Sbjct:   41 RSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESMSLPLELS--DRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKVIDPATATSVDLNDIKLIRKLGGTIDDCELVEGLVLTQRISNTGIIR-VEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLASAELVEEVSVGSS--KVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRH-AQGEKTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDI 541          
BLAST of T-complex protein subunit epsilon vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 235.343 bits (599), Expect = 4.073e-71
Identity = 147/467 (31.48%), Postives = 251/467 (53.75%), Query Frame = 2
Query:   77 PLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEP----LIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHP---QMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTV 1456
            P+++L++     +  GI    S+I A   V++ +RT+LGP+G+DK++++     T++NDG TI+++++V H   K +V++++SQD E+GDGTT V +LA  LL+Q  Q +E G+HP  I+  +  A  L +E++ +IS      KE+K      L++ A T L SK+V++    FA M V A+  + ++    +   +I +    GG L DS LV GV   K FS+      PK+    KIA+L    E    +    + V  V+D++ +   E     + + +++ASGA +V+ +    D A      +++     V   +++   +A GG I      +T + LG   +  E+  G   D+    + C  +K  T  +RGG+   +DE +RSLHDA+ +VR  +++  VV GGGA E+  S  + + +  IPG EQ  + A+A ALE  P  L +N+G  + + +
Sbjct:    4 PIILLKEGTDTSQ--GIPQLLSNITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIKEIS--VPVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVDAVSMLDEL----MPLNMIGMKKVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLPIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGRCELFEEVQIG--GDRYNFFKGCPQAKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGFDATNVL 460          
BLAST of T-complex protein subunit epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 6.421e-60
Identity = 122/387 (31.52%), Postives = 217/387 (56.07%), Query Frame = 2
Query:   71 GRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVA--DIERKDVDFE-LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIV 1219
            G P+++L   +  KR  G    + +I AAK +++++RT LGP+ + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG +L  AEQ LE+ +HP  I   Y  A +  L  L  IS   V    ++  +++   + + +K +++       +A+ A+L+V   D  R+++D +   K++   GG L +S +++GV+++KD +HP+M + I+  +I +L C+ E  K +++ ++ +   +DF  + + E D   ++   +     +L+  + G  D A H L + N+ A+R +   +   IA A G RIV R  +   E +G  AG+      G   D    I ECK+ KA T  +RG S+ I+
Sbjct:    6 GAPVLVL--SQNTKRESGRKVQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAV-DVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKGISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGLFEVKKIG--DDYFTFITECKDPKACTILLRGASKDIL 387          
BLAST of T-complex protein subunit epsilon vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 7.161e-32
Identity = 83/221 (37.56%), Postives = 127/221 (57.47%), Query Frame = 2
Query:   77 PLVILR---DEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDND----ITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKE-PLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKG 715
            P+ IL+   DEEK +      A  S  + A  + ++++++LGPKG+DKI++   +     +TVTNDG TI++ + V++  AK++V++SK QDDE+GDGTT V VLA  LL +AE L+ + IHP  I  G+  +     + L+  +      KE     L+  + TTL SK++      FA++AV A+L +    R     E I V  K+GGTL DS L +G
Sbjct:    6 PINILKSGADEEKAET-----ARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALELAAVDHGHDKEKFHVDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRL----RGKGTLEAIHVIKKLGGTLLDSYLDEG 217          
BLAST of T-complex protein subunit epsilon vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 318/552 (57.61%), Postives = 435/552 (78.80%), Query Frame = 2
Query:   20 PLVMAGRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKEN--KEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSI------KDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAED 1651
            P+ M     A +A DE GRP +I++D+  KKR  G++A KSHI+AA++V++I++TSLGP+GLDKI+++PD +IT+TNDG TI+  M++++EIAKL+V+LSKSQDDEIGDGTTGVVVLA +LL+QA +L+++GIHPI+I++G++ AAKL + +L++  D    S +   ++ L++ A T+LGSKIV+K H +FAEMAV A+++V D +RKDVDF+LIK+ G+VGG++SDS L+ GVI+DKDFSHPQMPK +         K+AILTC FEPPKPKTKH L + +V++++ L  YE DKF EM+D VK +GA++VICQWGFDDEANHLL Q +LPAVRWVGG E+E IAI+T GRIVPRF++L+ +KLG    + E  FGTTKD+ML+IE+ K +K VTCF+RG ++MIVDEA+R+LHD+LCVVRNLV+D RVVYGGGA+E+  SLAVS  AD+  G++QYA R FA+AL+ IP+ L+ENSGL  I T++ LK++QLKE    +GVDC   G+ DMKE  V++    KK QI+LA Q+C+MILKID++ +  +D
Sbjct:    9 PMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVIISGKD 560          
BLAST of T-complex protein subunit epsilon vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 310.457 bits (794), Expect = 3.040e-99
Identity = 184/513 (35.87%), Postives = 308/513 (60.04%), Query Frame = 2
Query:  128 DAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKD-FSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGF-----DDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKA---VTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRL--GVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            +  K++I+AA++V++ +RTSLGPKG+DK++     +I ++NDG TI++ M + H +A+++VE+S +QD E GDGTT VV+L G+LL  AE+LL +GIHP  I+D ++ AAK  ++ L ++  +   S  ++E L++ A T+L SKIV++     A +AV ++L ++D   K+VD   I++  KVGGT+ D+ ++ GV++ +        P   + AKI ++     PPKP T++N+ V   +  + + K E    + +  ++K +  N+++ Q        +D A H L + N+  V+ +   EIE ++   G + +   E  T ++LG+A +V E+   +   K++ +   +N+ A   V+  IRG + MI+DE +RSLHDALCV+R LV++  ++ GGGA EI  S  +S  A  + G++ +  + FA ALE IP  L+EN+GL SI  V EL++   K  N  L  G+  +R GT +  E+ +L+ +    + I LA +  K IL+IDDI
Sbjct:   19 EVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSLS--DREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEID--SDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRS---KHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of T-complex protein subunit epsilon vs. Ensembl Yeast
Match: CCT3 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; capable of binding Q/N rich proteins and mediating their folding [Source:SGD;Acc:S000003551])

HSP 1 Score: 278.87 bits (712), Expect = 4.407e-87
Identity = 172/524 (32.82%), Postives = 296/524 (56.49%), Query Frame = 2
Query:  107 KKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQ-AEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDV--------DFEL-----IKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLG-NAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            ++R  G  A  S+I AAK V++++RT LGPK + K++++P   + +TNDG  I+  +DV H  AK M+ELS++QD+E+GDGTT V++LAG +L Q A  L+E+ IHP+ I    + A    LE + ++S       EN   + +    ++G+K V     +  E+A+ A+ +V    RKD+        +FE+     ++V+   GG + DS ++KGV+++KD  HP+M + I++ ++ +L C  E  K +++ N+ +E  +D+  + + E ++   M +Q+ A    LVI + G  D A H L +     +R V   +   IA  TG  IV R E+L    +G N G+ +    G   +    ++ CK  KA T  +RGGS+ I++E  R+L DA+ V RN++  P +  GGGA+E+A S+ ++  A Q+ G++Q+  +A A+A+E IP  L +N+G   I  +++L+A+   + N   G+D  +    DM    + E    K+  +  A++   ++L++DDI
Sbjct:   12 QERTTGRQAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIKQVSKP--VDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTV----RKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIG--DEYFSFLDNCKEPKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKH-AQGNFTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDI 526          
BLAST of T-complex protein subunit epsilon vs. Ensembl Yeast
Match: CCT2 (Subunit beta of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000001404])

HSP 1 Score: 254.218 bits (648), Expect = 8.727e-78
Identity = 169/510 (33.14%), Postives = 278/510 (54.51%), Query Frame = 2
Query:  128 DAHKSHIMAAKTVSNILRTSLGPKGLDKIMVN-PDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERG-IHPIRISDGYEMAAKLCLEE-----LDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLY-VETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            +A  S  + A  V ++++++LGPKG+DK++ +   N   VTNDG TI++ + +++  AK++V +SK QDDE+GDGTT V VL+  LL +AE+L+++  IHP  I +GY +A+   L+      +D   D+ +F    +E LI  A TTL SKI+++    FAE+A  AIL +    +   + E I++   +GG LSDS L +G I+ K F + Q PK I++AKI I     +  K K     + V++      L K E +K    + ++   G N  I +    D    L     + ++       +E +A+ TGG +V  F+E +  KLG   ++ E+  G  +   L    CK  +A T  +RG +   +DEA+RSLHDAL V+    ++ R V GGG +E+  S AV   A  I G +  A+ AFA AL  +P  L++N+G  S   V++L++  +       G+D       DM++  ++E+   K+A +  A +  +++L++D+I
Sbjct:   17 NARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALDALTKAAVDNSHDKTMF----REDLIHIAKTTLSSKILSQDKDHFAELATNAILRL----KGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQ-PKRIENAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLG--EQPFLKFSGCKAGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRS-SIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNI 514          
BLAST of T-complex protein subunit epsilon vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 252.677 bits (644), Expect = 5.509e-77
Identity = 157/501 (31.34%), Postives = 264/501 (52.69%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKEN-KEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHP---QMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDD 1630
            S+I A   V   L+ +LGP G D ++V  +   T++NDG TI++++DV H  AK +V++S++QD E+GDGTT V +LAG L+++A+  LE GI    I  GY  A  L +E++++++      K + +E L + A T + SK+++     F +M V A+LS   ++R D+D +LI +    GG + +S+ + GV   K FS+    Q PK   + KI  L    E    K    + VE V+D++ +   E     E + QV+ +GAN+V+ +    D A      +N+     V   ++  +  A GG I     ++ PE LG   +  E+  G+ +  +   + C  +K  T  +RGG+  ++ E +RSLHDA+ +V+  +++  +V GGGA+E+  S  + + +  I G +Q  + AFA+ALE IP  L EN+G  +I  + +L+    K      GV  +     D   + V E    K   +  A +   +IL +D+
Sbjct:   28 SNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLS---LDRNDLDDKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGSERYNLF--QGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSK-GEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDE 522          
BLAST of T-complex protein subunit epsilon vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 392/543 (72.19%), Postives = 466/543 (85.82%), Query Frame = 2
Query:   29 MAG---RQIAQ-IAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHA 1645
            MAG   R  AQ I  DE+GRP +IL+++E++KRL G++A KSHI+AA+ V++IL+TSLGPKG+DK+MV+PD ++TVTNDG TI+ MM+V+H+IAKLMVELSKSQD+EIGDGTTGVVVLAG+LLE AEQLL+ GIHPIRI+DGYE+AAK+ LE +D I+D F   K+NKE LIQTAMTTLGSKIV++CHR  AE+AV A+LSVAD+ERKDVDFELIKV+GK GG L D++LVKGV+VDKD SHPQMPK +KDAKIAILTC FEPPKPKTKH L V TV+D++ L +YE +KF EM+ QVK +GANL ICQWGFDDEANHLL Q +LPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AGIVRELSFGTTKDKMLVIEEC NS+AVT FIRGG++MIV EAKRS+HDALCVVRNLVRD RVVYGGGA+E++CS+A++  AD+I  +EQYAMRA+A+AL+ IP+AL+ENSGL  I TVA++K+RQ+ E NPRLGVDC   G  DMK Q V+ETL  KK QI LA Q+ KMILKIDDIR+ A
Sbjct:    1 MAGGPLRAAAQGITFDEFGRPFIILKEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDIRIKA 543          
BLAST of T-complex protein subunit epsilon vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 372/531 (70.06%), Postives = 446/531 (83.99%), Query Frame = 2
Query:   53 IAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHA 1645
            +  DE+GRP +IL+++E++KRL G++A KSHI+AA+ V++IL+TSLGPKG+DK+MV+PD ++TVTNDG TI+ MM+V+H+IAKLMVELSKSQD+EIGDGTTGVVVLAG+LLE AEQLL+ GIHPIRI+DGYE+AAK+ LE +D I+D F        PL       LG   V++CHR  AE+AV A+LSVAD+ERKDVDFELIKV+GK GG L D++LVKGV+VDKD SHPQMPK +KDAKIAILTC FEPPKPKTKH L V TV+D++ L +YE +KF EM+ QVK +GANL ICQWGFDDEANHLL Q +LPAVRWVGGPEIELIAIATGGRIVPRF ELT EKLG AGIVRELSFGTTKDKMLVIEEC NS+AVT FIRGG++MIV EAKRS+HDALCVVRNLVRD RVVYGGGA+E++CS+A++  AD+I  +EQYAMRA+A+AL+ IP+AL+ENSGL  I TVA++K+RQ+ E NPRLGVDC   G  DMK Q V+ETL  KK QI LA Q+ KMILKIDDIR+ A
Sbjct:    1 MTFDEFGRPFIILKEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNF--------PL------PLGYS-VSRCHRPLAEIAVDAVLSVADLERKDVDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKIATIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDIRIKA 516          
BLAST of T-complex protein subunit epsilon vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 309.686 bits (792), Expect = 2.651e-98
Identity = 179/518 (34.56%), Postives = 302/518 (58.30%), Query Frame = 2
Query:  101 EKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFV---FSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVA--DIERKDVDFE-LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGN-AGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            +  KR  G      ++ AAKT+++I+RT LGP+ + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG  +  AE  LE+ +HP +I   Y    +L ++++  I  Q +      +N+E +++   +++G+K +NK       +A+ A+ +VA    +RK++D +   KV+   GG + DS ++ GV+++KD +H +M + I++ +I +L C  E  K +++ +L + +  DF  + + E +   +M D+V A   +LVI + G  D A H L + N+ A+R V   +   IA A G  IV R EEL  E +G  AG+     FG   +    I EC N KA T  +RG S+ +++E +R+L DA+ V RN++ DPR+V GGGA E+A + A++  A  + G++Q+  +A A+ LE IP  L +N G  +I T+  L+A+   E N   G+D +     DM+E  V +T + K      A++   ++L+IDDI
Sbjct:    8 QNTKRESGRKVQLGNVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAY----RLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGDRKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFG--DEYFTFITECNNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAEGNTSWGIDGESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDI 519          
BLAST of T-complex protein subunit epsilon vs. Ensembl Nematostella
Match: EDO29932 (T-complex protein 1 subunit delta [Source:UniProtKB/TrEMBL;Acc:A7T288])

HSP 1 Score: 294.278 bits (752), Expect = 3.872e-93
Identity = 172/477 (36.06%), Postives = 284/477 (59.54%), Query Frame = 2
Query:  227 DNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKD-VDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKS-IKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGF-----DDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            + D+T+TNDG TI++ M V H  A+++VELSK+QD E GDGTT VVV+AGSLL  A +LLERGIHP  +S+ +E+A++  +E L  +S     +  ++E L+++A T+L SK+V++     A ++V A+L V +    D VD   I++  K+GGT+ D+ LV+G+++ +  SH     S ++ AKI +L     PPK   ++ + V      + + + E    +E+  ++K +G N+++ Q        +D A H L +  +  VR +   EIE I  + G + +   +   P+ L +A +V E+S GT+  K++ I    N    V+  +RG ++++++EA RSLHDALCV+R LV+   ++ GGGA EI  +L ++  +  +  ++ Y +RAFAEALE IP  L+EN+GL  I+TV EL+ R   +     G++ ++    ++ E+ VL+ L    + + LA +  + ILKIDDI
Sbjct:   11 NGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTTVVVIAGSLLNAAAKLLERGIHPTTVSESFELASRKAVEILSGMSTPLALN--DRESLLKSATTSLNSKVVSQYSNLLAPISVDAVLKVINPSVVDNVDLRDIRIVKKLGGTVEDTELVEGLVLQQKISHLAGGISQVEKAKIGLLQFCISPPKTDMENQVIVSDYAQMDRVLREERQYILEICKKIKKAGCNVLLIQKSILRDAVNDLALHFLSKMKILVVRDIERDEIEFICKSIGCKPIASLDHFNPDMLASAELVEEVSVGTS--KVVKITGVSNPGNTVSVLVRGSNKLVLEEADRSLHDALCVIRCLVKKRALIAGGGAPEIEVALRLAEYSQTLTSMDAYCVRAFAEALEIIPYTLAENAGLNPIATVTELRNRH-AQGEVTAGINVRKGTVTNILEENVLQPLLVSTSAVQLASETVRSILKIDDI 482          
BLAST of T-complex protein subunit epsilon vs. Ensembl Nematostella
Match: EDO34981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT1])

HSP 1 Score: 256.144 bits (653), Expect = 4.815e-78
Identity = 178/527 (33.78%), Postives = 284/527 (53.89%), Query Frame = 2
Query:   77 PLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIM--VNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEE-----LDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKT-KHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            P+ IL    +++R     A  S  + A  + ++++++LGPKG+DKI+     + +I VTNDG TI++ + +++  AK++VELSK QDDE+GDGTT V VL   LL++AE+L+   IHP  I  G+  + K   +      +D  SD   F    +E L+  A TTL SKI+ +    FA++AV A+L +    +   D   I++  K+GG + DS L +G ++DK     Q PK I++AKI I     +  K K     + V++     +L   E  K  E V+ +     N  I +    +    L     + A+       +E +A+ TGG IV  F      KLG    + E+  G  +DK++    C  ++A T  IRG ++ I+DEA+RSLHDALCV+   V++ R V GGGASE+  + AVS  A + PG E  AM +FA AL  +P  +++N+G  S   VA+L+A   +  N   G++       DM++  + E+   K+  ++ A +  +MI+++D+I
Sbjct:    6 PVSILNQGAEEER--AETARLSSFVGAIAIGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDGATILKSIGIDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAVDHSSDPEKF----REDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRL----KGSGDLNAIQIIKKLGGGMVDSFLDEGFLLDKKIGVNQ-PKKIENAKILIANTPMDADKIKVFGSRVRVDSTAKIADLEMAEKQKMKEKVEMIIKHDINCFINRQLIYNYPEQLFADAGVMAIEHADFEGVERLALVTGGEIVSTFGRPDLVKLGTCKKIEEVMIG--EDKLIHFSGCALNEACTVVIRGATQQILDEAERSLHDALCVLTQTVKETRTVNGGGASEVLMAHAVSQLAAKTPGKEAAAMESFATALRQLPTIIADNAGYDSADLVAKLRAAHTQGKNT-YGLNMVNGTVGDMRDLGITESYQVKRQVLLSAAEAAEMIVRVDNI 518          
BLAST of T-complex protein subunit epsilon vs. Ensembl Medaka
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:101171367])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 388/535 (72.52%), Postives = 462/535 (86.36%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +  +A DEYGRP +I++D++KK RL GIDA KSHIMAAK V+  LRTSLGP GLDK+MV+ D ++TVTNDG TI+ MMDV+H+IAKLMVELSKSQDDEIGDGTTGVVVLAG+LLE+AE LL+RGIHPIRISDGY+ AA++ +E+LDKI++ F     N EPLIQTAMTTLGSK++N+CHRQ AE+AV AIL+VAD++RKDVDFELIKV+GKVGG L D+ L+KGVIVDK+FSHPQMPK +KD KIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ QVK++GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AG+V+ELSFGTTKD MLVI+ECKN++AVT FIRGG++MI++EAKR+LHDALCV+RNL+RD RVVYGGGASEIAC+LAV+ AAD+ P LEQYAMR+FA+ALE IP+AL+ENSGL  I T+AE++ARQ+K+ NP LG+DC    T DMK+Q V+ETL +KK QI LA QV +MILKIDDIR   E
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDKKTRLTGIDALKSHIMAAKAVAGTLRTSLGPNGLDKMMVDRDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAELLLDRGIHPIRISDGYDQAARIAIEKLDKIAETFPCDPNNLEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMQRKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKELKDVKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQVKSNGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFSELTPEKLGTAGLVKELSFGTTKDHMLVIQECKNTRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLIRDNRVVYGGGASEIACALAVNRAADKCPSLEQYAMRSFADALEVIPMALAENSGLNPIQTMAEVRARQVKDNNPFLGIDCLHKNTNDMKQQHVIETLIAKKQQISLATQVVRMILKIDDIRSPGE 538          
BLAST of T-complex protein subunit epsilon vs. Ensembl Medaka
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:101171367])

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 300/414 (72.46%), Postives = 357/414 (86.23%), Query Frame = 2
Query:  407 ERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAE 1648
            +RGIHPIRISDGY+ AA++ +E+LDKI++ F     N EPLIQTAMTTLGSK++N+CHRQ AE+AV AIL+VAD++RKDVDFELIKV+GKVGG L D+ L+KGVIVDK+FSHPQMPK +KD KIAILTC FEPPKPKTKH L V +V+D++ L KYE +KF EM+ QVK++GANL ICQWGFDDEANHLL Q  LPAVRWVGGPEIELIAIATGGRIVPRF ELTPEKLG AG+V+ELSFGTTKD MLVI+ECKN++AVT FIRGG++MI++EAKR+LHDALCV+RNL+RD RVVYGGGASEIAC+LAV+ AAD+ P LEQYAMR+FA+ALE IP+AL+ENSGL  I T+AE++ARQ+K+ NP LG+DC    T DMK+Q V+ETL +KK QI LA QV +MILKIDDIR   E
Sbjct:   70 DRGIHPIRISDGYDQAARIAIEKLDKIAETFPCDPNNLEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMQRKDVDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKELKDVKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQVKSNGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFSELTPEKLGTAGLVKELSFGTTKDHMLVIQECKNTRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLIRDNRVVYGGGASEIACALAVNRAADKCPSLEQYAMRSFADALEVIPMALAENSGLNPIQTMAEVRARQVKDNNPFLGIDCLHKNTNDMKQQHVIETLIAKKQQISLATQVVRMILKIDDIRSPGE 483          

HSP 2 Score: 75.485 bits (184), Expect = 5.209e-14
Identity = 33/51 (64.71%), Postives = 41/51 (80.39%), Query Frame = 2
Query:   44 IAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGP 196
            +  +A DEYGRP +I++D++KK RL GIDA KSHIMAAK V+  LRTSLGP
Sbjct:    4 LGTLAFDEYGRPFIIIKDQDKKTRLTGIDALKSHIMAAKAVAGTLRTSLGP 54          
BLAST of T-complex protein subunit epsilon vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 317.39 bits (812), Expect = 6.321e-101
Identity = 182/505 (36.04%), Postives = 303/505 (60.00%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD-IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I AAK V++ +RTSLGPKG+DK++ +   D+T+TNDG TI++ M V H  AK++VELSK+QD E GDGTT VV++AG+LLE   +LL++GIHP  IS+ ++ A    +E L+ +S     S  ++E L+ +A T+L SK+V++     A M+V A++ V D      VD   IK+  K+GGT+ D  LV+G+++ +  +   + + ++ AKI ++     PPK    + + V      + + + E    + +V QVK +G N+++ Q         D A H L +  +  V+ +   EIE I    G + +   +  TPE LG A +  E+S   +  K++ I  C +  K V+  +RG +++++DEA+RS+HDALCV+R LV+   ++ GGGA EI  ++ ++  +  + G+E Y +RA+ +ALE IP  L+EN+GL  ISTV EL+ +   + +   G++ ++ G  ++ E+LV++ +    + + LA +  + ILKIDD+
Sbjct:   33 SNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPVELS--DRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVASTGVTR-VEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGS-GKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKH-AQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDV 532          
BLAST of T-complex protein subunit epsilon vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 293.508 bits (750), Expect = 8.836e-92
Identity = 172/512 (33.59%), Postives = 291/512 (56.84%), Query Frame = 2
Query:  110 KRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIE--RKDVDFE-LIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLG-NAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            KR  G      +I AAK +++++RT LGP+ + K++++P   I +TNDG  I+  + V+H  AK M+E+S++QD+E+GDGTT V++LAG +L  AE  LE+ +HP  I   Y  A +  LE L ++S     S  ++  +++   + + +K + +       +A+ A+ +V   E  RK++D +   KV+   GG + DS ++KGV+++KD +HP+M + IK+ +I +L C+ E  K +++ ++ +   +DF  + + E D   ++ + +     +L+  + G  D A H L + N+ A+R V   +   IA A G RIV R +EL  E +G  AG+      G   +    I ECK+ KA T  +RG S+ I+ E +R+L DA+ V RN++ DP ++ GGGA E+A S  ++  +  + G+EQ+  RA A+ALE IP  L +N G  +I  +  L+A+  +E N   G++ +     DM    + E L+ K      AV+   ++L+IDDI
Sbjct:   14 KRESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALKEVSTPVDTS--DRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIG--DEYFTFITECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGNVGWGINGESGCLTDMSTLGIWEPLAVKAQTYKTAVETAILLLRIDDI 521          
BLAST of T-complex protein subunit epsilon vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 274.633 bits (701), Expect = 8.850e-85
Identity = 169/506 (33.40%), Postives = 283/506 (55.93%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD-IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW------GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I AAK V++ +RTSLGPKG+D                              K++VELSK+QD E GDGTT VV++AG+LLE   +LL++GIHP  IS+ ++ A    +E L+ +S     S  ++E L+ +A T+L SK+V++     A M+V A++ V D      VD   IK+  K+GGT+ D  LV+G+++ +  +   + + ++ AKI ++     PPK    + + V      + + + E    + +V QVK +G N+++ Q          D A H L +  +  V+ +   EIE I    G + +   +  TPE LG A +  E+S   +  K++ I  C +  K V+  +RG +++++DEA+RS+HDALCV+R LV+   ++ GGGA EI  ++ ++  +  + G+E Y +RA+ +ALE IP  L+EN+GL  ISTV EL+ +   + +   G++ ++ G  ++ E+LV++ +    + + LA +  + ILKIDD+
Sbjct:   33 SNISAAKAVADAVRTSLGPKGMD------------------------------KMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPVELS--DRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVASTGVTR-VEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRYDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGS-GKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKH-AQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDV 503          
BLAST of T-complex protein subunit epsilon vs. Planmine SMEST
Match: SMESG000012740.1 (SMESG000012740.1)

HSP 1 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 542/546 (99.27%), Postives = 544/546 (99.63%), Query Frame = 2
Query:   29 MAGRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAEDVSLIY 1666
            MAGRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAED+  +Y
Sbjct:    1 MAGRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAEDLGSMY 546          
BLAST of T-complex protein subunit epsilon vs. Planmine SMEST
Match: SMESG000078668.1 (SMESG000078668.1)

HSP 1 Score: 324.324 bits (830), Expect = 6.873e-104
Identity = 191/511 (37.38%), Postives = 294/511 (57.53%), Query Frame = 2
Query:  122 GIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQW-----GFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKN-SKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLK-EANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            G     S+I AAK V++ +RTSLGP+G+DK++     D+TVTNDG TI++ M + H  A++MV+LS+SQD E GDGTT VVV+AGSLL    +LL++GIHP  IS+ ++ AA++  E L   S +   S  N+E L++ A T+L SK+V +     A +AV A+L   D     V+   IK+  K GGT+ D++LV G+I+D+        K ++ AKIA++     PPK    H++ V      + +   E    + +   +K+SG N+++ Q         D A H   + N+  ++ +   ++EL   A   + +   +   P+    A +V E+S GT+  +++ +    N    V+  + G + M++ EA+RSLHDALCV+R LV+ P ++ GGGA EIA S  ++N + Q+ GL QY +RA+A+ALE IP  L+ENSGL  I TV EL+ R  + E N   G++ KR    D+    V++ L    + I LA +    +LKIDDI
Sbjct:   16 GSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDIS--NREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTS--RIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNA--GINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDI 520          
BLAST of T-complex protein subunit epsilon vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 295.819 bits (756), Expect = 1.037e-92
Identity = 177/504 (35.12%), Postives = 290/504 (57.54%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKD-VDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWG-----FDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I+AAK V++ +RTSLGPKG+DK++     D+T+TNDG TI++ M + H  A+++VELSK+QD E GDGTT VVVLAGS L+   +LL +GIHP  ISD + +AA    E ++ +S     +  N   L++ A T+L SK+V++     + +AV A+L + D    + V+ + + +  K+GGT+ D+ LV G+I+D+         ++++AKI  +     PPK + + ++ V      + + K E    +E+V ++KASG N+++ Q         D A H   + N+  V+ +   ++E I    G + +   E    E LG A  V E+  G ++   +   E  + + V+  +RG +++++DEA+RSLHDALCVVR LV+   +V GGGA EI     ++  ++ + G  QY  RAFA+A++ IP  L+EN+GL  I TV EL+       +   G++ K+    ++ ++ V++ L      + LA +    ILKIDD+
Sbjct:   40 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNN--LLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDV 539          
BLAST of T-complex protein subunit epsilon vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 295.434 bits (755), Expect = 1.083e-92
Identity = 177/504 (35.12%), Postives = 290/504 (57.54%), Query Frame = 2
Query:  140 SHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKD-VDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWG-----FDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            S+I+AAK V++ +RTSLGPKG+DK++     D+T+TNDG TI++ M + H  A+++VELSK+QD E GDGTT VVVLAGS L+   +LL +GIHP  ISD + +AA    E ++ +S     +  N   L++ A T+L SK+V++     + +AV A+L + D    + V+ + + +  K+GGT+ D+ LV G+I+D+         ++++AKI  +     PPK + + ++ V      + + K E    +E+V ++KASG N+++ Q         D A H   + N+  V+ +   ++E I    G + +   E    E LG A  V E+  G ++   +   E  + + V+  +RG +++++DEA+RSLHDALCVVR LV+   +V GGGA EI     ++  ++ + G  QY  RAFA+A++ IP  L+EN+GL  I TV EL+       +   G++ K+    ++ ++ V++ L      + LA +    ILKIDD+
Sbjct:   31 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNN--LLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDV 530          
BLAST of T-complex protein subunit epsilon vs. Planmine SMEST
Match: SMESG000016726.1 (SMESG000016726.1)

HSP 1 Score: 280.796 bits (717), Expect = 4.614e-87
Identity = 186/527 (35.29%), Postives = 300/527 (56.93%), Query Frame = 2
Query:   77 PLVILR---DEEKKKRLVGIDAHKSHIMAAKTVSNILRTSLGPKGLDKIMVNPDND-ITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMA---AKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKT-KHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 1633
            P+ IL    DEE+ +      A  S  + A  + ++++T+LGPKG+DKI+++  ++ ITVTNDG TI++ + V++  AK++VE+SK QDDE+GDGTT VVVLA  LL +AEQL+ + +HP  +  G+  A   A L L++  + S QF  + E++  L+  A TTL SKI+ +   +FA++AV A+  +    +   + E I++  K+GG LSDS L +G +++K     Q PK I++AKI I     +  K K     + V+TV     L + E  K  E V+++   G N+ I +    +    L   K + A+       +E +++ TGG I   F+     KLG   ++ E+  G  +D++L        +A T  +RG ++ I+DEA+RSLHDALCV++  V+D R + GGGA+E+  + AVS  A + PG E  A+ AF+ AL A+P  +++N G  S   VA+L+A+   E +   G+D       DM +  + E+   KK  +  A +  +MI+++D+I
Sbjct:    6 PIQILSRGADEERAET-----ARMSSFVGAIAIGDLVKTTLGPKGMDKILLSGGSESITVTNDGATILKSIGVDNPAAKILVEMSKVQDDEVGDGTTSVVVLASELLREAEQLISQKLHPQTVISGWRKACVEASLALKQSARSSAQFPSTFEDE--LMNIARTTLSSKILTQHKDKFAKLAVDAVTRL----KGSGNLETIQIIKKLGGLLSDSYLDEGFLLEKKVGVNQ-PKRIENAKILIANTPMDADKIKVFGSKIKVDTVTKIAELEEAEKQKMKEKVEKIAKHGCNVFINRQLIYNYPEQLFSMKGIMAIEHADFEGVERLSLVTGGDIASTFDCPGETKLGYCDLIEEIMIG--EDRLLKFSGVAVGEACTIVLRGATQTILDEAERSLHDALCVIQQTVKDQRSINGGGAAEMLMADAVSKLAARTPGKEAIAIEAFSRALRALPNIIADNGGFDSSDLVAQLRAKH-TEGDHNYGLDMVNGKIEDMTKLGITESYRVKKQVLTAAAEAAEMIVRVDNI 517          
The following BLAST results are available for this feature:
BLAST of T-complex protein subunit epsilon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT50.000e+072.34chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT50.000e+073.96chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT50.000e+073.80chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT50.000e+063.36chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT50.000e+072.73chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-50.000e+064.97T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-50.000e+064.97T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-52.533e-16064.63T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-52.533e-16064.63T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-52.533e-16064.63T-complex protein 1 subunit epsilon [Source:UniPr... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT50.000e+069.74gene:FBgn0010621 transcript:FBtr0087987[more]
CCT50.000e+070.18gene:FBgn0010621 transcript:FBtr0087988[more]
CCT48.951e-10137.13gene:FBgn0032444 transcript:FBtr0080411[more]
CCT25.116e-8333.65gene:FBgn0030086 transcript:FBtr0071289[more]
CCT32.527e-7732.58gene:FBgn0015019 transcript:FBtr0302371[more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct50.000e+073.07chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct43.983e-10236.83chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct31.049e-9233.14chaperonin containing TCP1, subunit 3 (gamma) [Sou... [more]
tcp12.282e-7532.64t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
tcp12.629e-7532.64t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct50.000e+073.27chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct50.000e+075.15chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct50.000e+064.30chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct48.998e-10336.24chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct41.012e-10236.24chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct50.000e+071.40chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
Cct52.532e-10373.87chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
Cct41.983e-10035.84chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct33.254e-9634.16chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct32.982e-9334.05chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R6V2|TCPE_MACFA0.000e+072.34T-complex protein 1 subunit epsilon OS=Macaca fasc... [more]
sp|P48643|TCPE_HUMAN0.000e+072.34T-complex protein 1 subunit epsilon OS=Homo sapien... [more]
sp|Q5RF02|TCPE_PONAB0.000e+071.96T-complex protein 1 subunit epsilon OS=Pongo abeli... [more]
sp|Q68FQ0|TCPE_RAT0.000e+071.78T-complex protein 1 subunit epsilon OS=Rattus norv... [more]
sp|P80316|TCPE_MOUSE0.000e+071.40T-complex protein 1 subunit epsilon OS=Mus musculu... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RK690.000e+077.57T-complex protein subunit epsilon OS=Fasciola hepa... [more]
A0A0X3NMZ80.000e+077.78Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7CIB30.000e+077.78Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183T2S70.000e+077.78Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183P9Z60.000e+077.59Uncharacterized protein OS=Schistosoma mattheei OX... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct50.000e+072.90chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct50.000e+067.10chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct50.000e+063.93chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct45.179e-9736.09chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct31.717e-9233.14chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct50.000e+071.06chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct43.943e-10135.90chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct74.073e-7131.48chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
ENSPMAT00000002042.16.421e-6031.52pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
ENSPMAT00000002094.17.161e-3237.56pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT50.000e+057.61Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT43.040e-9935.87Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT34.407e-8732.82Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT28.727e-7833.14Subunit beta of the cytosolic chaperonin Cct ring ... [more]
CCT75.509e-7731.34Subunit of the cytosolic chaperonin Cct ring compl... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495710.000e+072.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274110.000e+070.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354152.651e-9834.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299323.872e-9336.06T-complex protein 1 subunit delta [Source:UniProt... [more]
EDO349814.815e-7833.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct50.000e+072.52chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct55.209e-1472.46chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct46.321e-10136.04chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct38.836e-9233.59chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct48.850e-8533.40chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein subunit epsilon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012740.10.000e+099.27SMESG000012740.1[more]
SMESG000078668.16.873e-10437.38SMESG000078668.1[more]
SMESG000060610.11.037e-9235.12SMESG000060610.1[more]
SMESG000060610.11.083e-9235.12SMESG000060610.1[more]
SMESG000016726.14.614e-8735.29SMESG000016726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018729 ID=SMED30018729|Name=T-complex protein subunit epsilon|organism=Schmidtea mediterranea sexual|type=transcript|length=1797bp
ACATTACTACTAGAAATTACCATTAGTAATGGCAGGAAGACAAATTGCAC
AAATTGCTATTGATGAATATGGAAGACCACTTGTTATTTTAAGAGATGAA
GAAAAAAAGAAACGTCTAGTGGGAATCGATGCTCATAAATCTCATATCAT
GGCTGCTAAAACGGTTTCAAACATATTGCGCACATCACTCGGACCAAAGG
GATTAGATAAAATAATGGTCAATCCGGATAACGATATAACTGTCACTAAC
GACGGACGAACCATTATGGAGATGATGGATGTAGAACATGAAATAGCAAA
ATTGATGGTTGAACTGAGCAAGTCACAGGATGACGAAATTGGTGATGGAA
CAACTGGTGTTGTTGTATTAGCGGGATCGTTATTAGAGCAAGCTGAACAG
TTACTTGAACGTGGTATTCACCCAATTAGAATATCAGATGGTTACGAAAT
GGCTGCTAAATTATGCCTAGAAGAATTGGATAAAATTAGTGATCAATTTG
TTTTTAGTAAAGAAAATAAAGAACCACTTATACAAACTGCCATGACAACA
CTTGGTTCAAAAATTGTCAACAAATGCCATCGGCAATTTGCTGAAATGGC
TGTAGGTGCCATTTTATCAGTTGCTGACATTGAAAGAAAAGATGTCGACT
TTGAATTAATTAAAGTTGATGGTAAAGTAGGGGGTACACTTTCAGACTCC
ATCTTAGTAAAAGGTGTAATAGTGGATAAAGATTTTTCACATCCCCAGAT
GCCAAAATCAATTAAAGATGCTAAAATTGCCATTTTGACTTGTGCTTTTG
AACCTCCAAAACCTAAAACTAAACATAATCTATATGTTGAAACCGTTAAA
GATTTTGAAAATTTGGCTAAATATGAGCATGATAAATTTGTTGAAATGGT
AGATCAAGTTAAAGCATCGGGTGCAAATTTAGTTATTTGTCAATGGGGAT
TTGATGATGAAGCAAATCATTTATTATATCAAAAGAATTTACCTGCTGTT
AGATGGGTTGGTGGACCTGAAATTGAGTTAATTGCTATTGCTACCGGTGG
AAGAATCGTTCCTAGATTTGAAGAATTAACACCGGAAAAATTAGGTAATG
CTGGGATTGTTAGAGAGCTTTCATTTGGAACTACCAAAGATAAAATGCTA
GTCATTGAAGAATGTAAAAACTCAAAAGCTGTTACATGTTTTATCAGAGG
TGGTTCACGTATGATTGTTGATGAGGCTAAGAGATCTCTTCATGATGCAT
TATGTGTTGTCAGAAACTTGGTTAGAGATCCTCGAGTAGTATATGGAGGA
GGAGCATCTGAAATCGCATGTTCTTTAGCAGTTTCAAATGCTGCAGATCA
AATTCCTGGATTGGAACAATATGCAATGAGAGCATTCGCAGAAGCCCTTG
AAGCTATTCCTATTGCGTTATCAGAAAATTCTGGTCTCCCATCTATATCT
ACAGTTGCCGAATTGAAGGCTAGACAGTTAAAAGAAGCCAATCCTCGTTT
GGGTGTTGATTGCAAACGTGTTGGAACTTGTGATATGAAAGAACAATTGG
TTCTTGAAACTCTGAGTTCGAAGAAAGCTCAAATAATGCTAGCTGTACAA
GTCTGTAAGATGATCTTAAAGATCGATGATATTCGAGTTCATGCTGAAGA
TGTAAGTTTGATTTATGAGTAATGTTTTTATATAGTTTTCTAAATGCAAA
TTTAGAAATGATAATTTCTTAGTAAGTAGTATTTATAGTTTTGTTTATTT
TCAAGTTTATTTTTCAAGTTCGTTAATACTTTTTATTTTTTAGCTCG
back to top

protein sequence of SMED30018729-orf-1

>SMED30018729-orf-1 ID=SMED30018729-orf-1|Name=SMED30018729-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MAGRQIAQIAIDEYGRPLVILRDEEKKKRLVGIDAHKSHIMAAKTVSNIL
RTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQ
DDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEEL
DKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVAD
IERKDVDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKI
AILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGAN
LVICQWGFDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEEL
TPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEA
KRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAM
RAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGT
CDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDIRVHAEDVSLIYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003133T_Ag_DNA-bd
IPR017998Chaperone_TCP-1
IPR027413GROEL-like_equatorial_sf
IPR027409GroEL-like_apical_dom_sf
IPR002423Cpn60/TCP-1
IPR027410TCP-1-like_intermed_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006457protein folding
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
GO:0031681G-protein beta-subunit binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005832chaperonin-containing T-complex
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 82..102
NoneNo IPR availableTIGRFAMTIGR02343TIGR02343coord: 9..537
e-value: 6.4E-280
score: 927.2
NoneNo IPR availablePANTHERPTHR11353:SF186T-COMPLEX PROTEIN 1 SUBUNIT EPSILONcoord: 13..540
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 13..540
NoneNo IPR availableCDDcd03339TCP1_epsiloncoord: 12..537
e-value: 0.0
score: 1019.92
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 48..64
score: 39.13
coord: 420..432
score: 42.45
coord: 70..88
score: 35.51
coord: 100..119
score: 53.3
coord: 386..408
score: 32.51
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 160..418
e-value: 2.3E-178
score: 595.9
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 162..418
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 46..535
e-value: 4.3E-153
score: 510.5
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 39..535
e-value: 2.3E-178
score: 595.9
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 27..535
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 229..382
e-value: 2.3E-178
score: 595.9
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 223..391
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 100..108
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 51..63