Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30018725
Length (bp)1499
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30018725) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30018725) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30018725) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30018725) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018725

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018725SMESG000025288.1 SmedASXL_010998SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30018725SMESG000025288.1 SmedASXL_010999SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30018725SMESG000025288.1 dd_Smed_v4_19210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018725SMESG000025288.1 dd_Smed_v4_19210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018725SMESG000025288.1 dd_Smed_v4_19210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018725SMESG000025288.1 dd_Smed_v4_19210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30018725SMESG000025288.1 dd_Smed_v4_19210_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ULK2 (unc-51 like autophagy activating kinase 2 [Source:HGNC Symbol;Acc:HGNC:13480])

HSP 1 Score: 57.7658 bits (138), Expect = 4.304e-8
Identity = 39/147 (26.53%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            +++R + R    W      +    +NK + LS+S   + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  +++ED                     T +  + QI  A+  LHS  GIIH D++P NI+++
Sbjct:   22 VVFRGRHRQKTDWE-----VAIKSINK-KNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSED---------------------TIRVFLHQIAAAMRILHSK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ULK2 (unc-51 like autophagy activating kinase 2 [Source:HGNC Symbol;Acc:HGNC:13480])

HSP 1 Score: 57.7658 bits (138), Expect = 4.304e-8
Identity = 39/147 (26.53%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            +++R + R    W      +    +NK + LS+S   + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  +++ED                     T +  + QI  A+  LHS  GIIH D++P NI+++
Sbjct:   22 VVFRGRHRQKTDWE-----VAIKSINK-KNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSED---------------------TIRVFLHQIAAAMRILHSK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DAPK3 (death associated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:2676])

HSP 1 Score: 53.5286 bits (127), Expect = 8.000e-8
Identity = 42/140 (30.00%), Postives = 61/140 (43.57%), Query Frame = 1
Query:  595 CIKTGINYSEVNKF---QKLSQSNF-----EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            C + G       KF   ++LS S       E+ REV IL  + H NI+  H  +  +  + L LE + G  L+ F+    S+ ED                      A Q +KQI   ++YLHS   I H D++P NIM+
Sbjct:   30 CRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTED---------------------EATQFLKQILDGVHYLHSK-RIAHFDLKPENIML 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DAPK3 (death associated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:2676])

HSP 1 Score: 53.5286 bits (127), Expect = 8.000e-8
Identity = 42/140 (30.00%), Postives = 61/140 (43.57%), Query Frame = 1
Query:  595 CIKTGINYSEVNKF---QKLSQSNF-----EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            C + G       KF   ++LS S       E+ REV IL  + H NI+  H  +  +  + L LE + G  L+ F+    S+ ED                      A Q +KQI   ++YLHS   I H D++P NIM+
Sbjct:   30 CRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTED---------------------EATQFLKQILDGVHYLHSK-RIAHFDLKPENIML 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ULK1 (unc-51 like autophagy activating kinase 1 [Source:HGNC Symbol;Acc:HGNC:12558])

HSP 1 Score: 56.6102 bits (135), Expect = 1.032e-7
Identity = 55/243 (22.63%), Postives = 99/243 (40.74%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHSICGPDNF---SPDDIR 1272
            ++++ + R  H        IN   + K Q L      + +E++IL  L H NIV  +        ++L +EY  G  L  ++++  +++ED                     T +  ++QI  A+  LHS  GIIH D++P NI+++         + N +S+R  I     +    SN++   +  S  +   E       + M    D K   D + +   +   + G   F   SP D+R
Sbjct:   29 VVFKGRHREKHDLEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSED---------------------TIRLFLQQIAGAMRLLHSK-GIIHRDLKPQNILLSNPAGR----RANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPE-------VIMSQHYDGKA--DLWSIGTIVYQCLTGKAPFQASSPQDLR 230          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 51.9878 bits (123), Expect = 4.177e-7
Identity = 39/132 (29.55%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  604 TGINYS-EVNKFQKLSQSNFEVL-REVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            TG+ ++ ++   +KLS  +F+ L RE RI   L H NIV  H    E+   +L  + + G  L+          ED+    F            S A A   I+QI  ++ Y HS+ GI+H D++P N+++ 
Sbjct:   34 TGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELF----------EDIVAREFY-----------SEADASHCIQQILESIAYCHSN-GIVHRDLKPENLLLA 143          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 51.9878 bits (123), Expect = 4.177e-7
Identity = 39/132 (29.55%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  604 TGINYS-EVNKFQKLSQSNFEVL-REVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            TG+ ++ ++   +KLS  +F+ L RE RI   L H NIV  H    E+   +L  + + G  L+          ED+    F            S A A   I+QI  ++ Y HS+ GI+H D++P N+++ 
Sbjct:   34 TGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELF----------EDIVAREFY-----------SEADASHCIQQILESIAYCHSN-GIVHRDLKPENLLLA 143          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 51.9878 bits (123), Expect = 4.177e-7
Identity = 39/132 (29.55%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  604 TGINYS-EVNKFQKLSQSNFEVL-REVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            TG+ ++ ++   +KLS  +F+ L RE RI   L H NIV  H    E+   +L  + + G  L+          ED+    F            S A A   I+QI  ++ Y HS+ GI+H D++P N+++ 
Sbjct:   34 TGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELF----------EDIVAREFY-----------SEADASHCIQQILESIAYCHSN-GIVHRDLKPENLLLA 143          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 51.9878 bits (123), Expect = 4.529e-7
Identity = 39/132 (29.55%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  604 TGINYS-EVNKFQKLSQSNFEVL-REVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            TG+ ++ ++   +KLS  +F+ L RE RI   L H NIV  H    E+   +L  + + G  L+          ED+    F            S A A   I+QI  ++ Y HS+ GI+H D++P N+++ 
Sbjct:   34 TGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELF----------EDIVAREFY-----------SEADASHCIQQILESIAYCHSN-GIVHRDLKPENLLLA 143          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 51.9878 bits (123), Expect = 4.529e-7
Identity = 39/132 (29.55%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  604 TGINYS-EVNKFQKLSQSNFEVL-REVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            TG+ ++ ++   +KLS  +F+ L RE RI   L H NIV  H    E+   +L  + + G  L+          ED+    F            S A A   I+QI  ++ Y HS+ GI+H D++P N+++ 
Sbjct:   34 TGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELF----------EDIVAREFY-----------SEADASHCIQQILESIAYCHSN-GIVHRDLKPENLLLA 143          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0309237)

HSP 1 Score: 58.5362 bits (140), Expect = 9.084e-9
Identity = 49/197 (24.87%), Postives = 82/197 (41.62%), Query Frame = 1
Query:  472 EVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFE-VLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYK 1059
            E+   +N       F ++ EI   +   +Y ++C    +   IK  ++Y+      K SQ  ++ +L+E+R L  LNH N + Y  C++ +   +L +EY +G +          ++ED                         I   +   L+YLHS +G IH DI+  NI++T      DNG   L    S   K
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKK-MSYT-----GKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIA---------------------AICLGVLSGLSYLHS-LGRIHRDIKAGNILLT------DNGVVKLADFGSAAIK 175          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0336692)

HSP 1 Score: 58.151 bits (139), Expect = 1.314e-8
Identity = 49/197 (24.87%), Postives = 82/197 (41.62%), Query Frame = 1
Query:  472 EVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFE-VLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYK 1059
            E+   +N       F ++ EI   +   +Y ++C    +   IK  ++Y+      K SQ  ++ +L+E+R L  LNH N + Y  C++ +   +L +EY +G +          ++ED                         I   +   L+YLHS +G IH DI+  NI++T      DNG   L    S   K
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKK-MSYT-----GKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIA---------------------AICLGVLSGLSYLHS-LGRIHRDIKAGNILLT------DNGVVKLADFGSAAIK 175          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0303999)

HSP 1 Score: 55.8398 bits (133), Expect = 6.669e-8
Identity = 48/184 (26.09%), Postives = 81/184 (44.02%), Query Frame = 1
Query:  472 EVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFE-VLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNG 1020
            E+   +N       F ++ EI   +   +Y ++C    +   IK  ++Y+      K SQ  ++ +L+E+R L  LNH N + Y  C++ +   +L +EY +G +          ++ED                   IA    I   +   L+YLHS +G IH DI+  NI++T      DNG
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKK-MSYT-----GKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHED------------------EIAA---ICLGVLSGLSYLHS-LGRIHRDIKAGNILLT------DNG 162          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0074772)

HSP 1 Score: 55.8398 bits (133), Expect = 6.669e-8
Identity = 48/184 (26.09%), Postives = 81/184 (44.02%), Query Frame = 1
Query:  472 EVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFE-VLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNG 1020
            E+   +N       F ++ EI   +   +Y ++C    +   IK  ++Y+      K SQ  ++ +L+E+R L  LNH N + Y  C++ +   +L +EY +G +          ++ED                   IA    I   +   L+YLHS +G IH DI+  NI++T      DNG
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKK-MSYT-----GKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHED------------------EIAA---ICLGVLSGLSYLHS-LGRIHRDIKAGNILLT------DNG 162          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Tao (gene:FBgn0031030 transcript:FBtr0074771)

HSP 1 Score: 55.8398 bits (133), Expect = 6.669e-8
Identity = 48/184 (26.09%), Postives = 81/184 (44.02%), Query Frame = 1
Query:  472 EVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFE-VLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNG 1020
            E+   +N       F ++ EI   +   +Y ++C    +   IK  ++Y+      K SQ  ++ +L+E+R L  LNH N + Y  C++ +   +L +EY +G +          ++ED                   IA    I   +   L+YLHS +G IH DI+  NI++T      DNG
Sbjct:   13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKK-MSYT-----GKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHED------------------EIAA---ICLGVLSGLSYLHS-LGRIHRDIKAGNILLT------DNG 162          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ulk1b (unc-51 like autophagy activating kinase 1 [Source:ZFIN;Acc:ZDB-GENE-071203-2])

HSP 1 Score: 60.8474 bits (146), Expect = 2.443e-9
Identity = 38/147 (25.85%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + R  H+W      IN   + K Q L      + +E++IL  L H NIV  H        ++L +EY  G  L  +++S  +++ED                     T +  ++QI  A+  L +  GIIH D++P NI+++
Sbjct:   22 VVFKGRHREKHEWEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALHDFQETASSVYLVMEYCNGGDLADYLHSKGTLSED---------------------TIRVFLQQITGAMRVLQAK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ulk1a (unc-51 like autophagy activating kinase 1a [Source:ZFIN;Acc:ZDB-GENE-080723-31])

HSP 1 Score: 54.6842 bits (130), Expect = 7.222e-8
Identity = 41/168 (24.40%), Postives = 74/168 (44.05%), Query Frame = 1
Query:  514 FNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDN 1017
            FN    I      ++++ + +  H +      IN   + K Q L      + +E++IL  L H NIV+         C++L +EY  G  L  +++S   ++ED                     T + +++Q+  A++ L S  GIIH D++P NI+++ S     N
Sbjct:    9 FNRKDLIGHGAFAVVFKGRHKQKHNFEVAVKCINRKNLAKSQSL------LGKEIKILKELKHENIVSLLDFQEISGCVYLVMEYCNGGDLAEYLHSKGCLSED---------------------TIRVLLQQLAGAMSVLRSK-GIIHRDLKPQNILLSYSTGRKSN 148          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ulk1a (unc-51 like autophagy activating kinase 1a [Source:ZFIN;Acc:ZDB-GENE-080723-31])

HSP 1 Score: 55.4546 bits (132), Expect = 1.161e-7
Identity = 41/168 (24.40%), Postives = 74/168 (44.05%), Query Frame = 1
Query:  514 FNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDN 1017
            FN    I      ++++ + +  H +      IN   + K Q L      + +E++IL  L H NIV+         C++L +EY  G  L  +++S   ++ED                     T + +++Q+  A++ L S  GIIH D++P NI+++ S     N
Sbjct:    9 FNRKDLIGHGAFAVVFKGRHKQKHNFEVAVKCINRKNLAKSQSL------LGKEIKILKELKHENIVSLLDFQEISGCVYLVMEYCNGGDLAEYLHSKGCLSED---------------------TIRVLLQQLAGAMSVLRSK-GIIHRDLKPQNILLSYSTGRKSN 148          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: dapk2a (death-associated protein kinase 2a [Source:ZFIN;Acc:ZDB-GENE-080402-8])

HSP 1 Score: 53.5286 bits (127), Expect = 4.016e-7
Identity = 42/128 (32.81%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  631 KFQKLSQSNF--------EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            KF K  QSN         E+ REV IL  ++H NIV  H  +  +  + L LE + G  L+ F+    S++E+                      A Q IKQI   ++YLHS   I H D++P NIM+
Sbjct:   42 KFIKKRQSNASRRGVLREEIEREVNILQQIHHPNIVMLHDVFENKTDVVLILELVSGGELFDFLAQKESLSEE---------------------EATQFIKQILEGVHYLHSR-NIAHFDLKPENIML 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ulk2 (unc-51 like autophagy activating kinase 2 [Source:ZFIN;Acc:ZDB-GENE-090218-30])

HSP 1 Score: 53.9138 bits (128), Expect = 4.510e-7
Identity = 36/147 (24.49%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + +    W      +    +NK + LS+S   + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  ++ ED                     T +  ++QI  A+  L+S  GIIH D++P NI+++
Sbjct:   22 VVFKGRHKKKTDWE-----VAIKSINK-KNLSKSQILLGKEIKILKELQHENIVALYDVQETPSSVFLVMEYCNGGDLADYLQAKGTLRED---------------------TLRVFLQQIAAAMRILNSK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: twnk (twinkle mtDNA helicase [Source:Xenbase;Acc:XB-GENE-978896])

HSP 1 Score: 56.9954 bits (136), Expect = 7.039e-8
Identity = 37/131 (28.24%), Postives = 65/131 (49.62%), Query Frame = 1
Query:  625 VNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDN 1017
            +NK + L++S   + +E++IL  L H NIV  +        ++L +EY  G  L  ++++  +++ED                     T +  ++QI  A+  LHS  GIIH D++P NI+++CS     N
Sbjct:   41 INK-KNLAKSQTLLGKEIKILKELKHENIVALYDFQELANSVYLVMEYCNGGDLADYLHTMRTLSED---------------------TIRLFLQQIAGAMKMLHSK-GIIHRDLKPQNILLSCSGGRKSN 148          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ULK2 (unc-51 like autophagy activating kinase 2 [Source:NCBI gene;Acc:100487396])

HSP 1 Score: 55.8398 bits (133), Expect = 1.633e-7
Identity = 55/243 (22.63%), Postives = 98/243 (40.33%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHSICGPDNF---SPDDIR 1272
            ++++ + R    W      IN       + LS+S   + +E++IL  L H NIV  +        +FL +E+  G  L  ++ +  +++ED                     T +  ++QI  A+  LHS  GIIH D++P NI+++ +  +    K     +R  I     +    SN++   +  S  +   E       + M    D K   D + +   I   + G   F   SP D+R
Sbjct:   22 VVFKGRHRKKTDWEVAIKSINK------KNLSKSQILLGKEIKILKELQHENIVALYDVQEMPNSVFLVMEFCNGGDLADYLQAKGTLSED---------------------TIRIFLQQIAAAMRVLHSK-GIIHRDLKPQNILLSYASRK----KATFSGIRIKIADFGFARYLQSNMMAATLCGSPMYMAPE-------VIMSQHYDAKA--DLWSIGTVIYQCLVGKPPFQANSPQDLR 223          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:100144678])

HSP 1 Score: 54.6842 bits (130), Expect = 1.699e-7
Identity = 37/135 (27.41%), Postives = 62/135 (45.93%), Query Frame = 1
Query:  604 TGINYS------EVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            TG++Y+         K  +   +  ++ REV IL  + H N++  H+ +  +  + L LE + G  L+ F+    S+ E+                      A + IKQI   +NYLHS + I H D++P NIM+
Sbjct:   35 TGVHYAAKFIKKRRTKSSRRGVTREDIEREVSILKEIQHPNVITLHEVYENKADVILILELVAGGELFDFLAEKESLTEE---------------------EATEFIKQILNGVNYLHS-LHIAHFDLKPENIML 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: c7orf26 (chromosome 7 open reading frame 26 [Source:Xenbase;Acc:XB-GENE-5734232])

HSP 1 Score: 54.6842 bits (130), Expect = 1.833e-7
Identity = 42/138 (30.43%), Postives = 63/138 (45.65%), Query Frame = 1
Query:  601 KTGINYSEVNKFQKLSQS--------NFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            KTG+ Y+   KF K  QS          E+ REV IL  + H+NI+     +  +  + L LE + G  L+ F+    S++E+                      A + IKQI   +NYLH+   I H D++P NIM+
Sbjct:   39 KTGVEYA--AKFIKKRQSPASRRGVIRGEIEREVDILKDIQHQNIITLQDVYENKTDVVLILELVSGGELFDFLAQKESLSEE---------------------EATRFIKQILEGVNYLHTR-KIAHFDLKPENIML 152          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: c7orf26 (chromosome 7 open reading frame 26 [Source:Xenbase;Acc:XB-GENE-5734232])

HSP 1 Score: 54.6842 bits (130), Expect = 1.876e-7
Identity = 42/138 (30.43%), Postives = 63/138 (45.65%), Query Frame = 1
Query:  601 KTGINYSEVNKFQKLSQS--------NFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            KTG+ Y+   KF K  QS          E+ REV IL  + H+NI+     +  +  + L LE + G  L+ F+    S++E+                      A + IKQI   +NYLH+   I H D++P NIM+
Sbjct:   39 KTGVEYA--AKFIKKRQSPASRRGVIRGEIEREVDILKDIQHQNIITLQDVYENKTDVVLILELVSGGELFDFLAQKESLSEE---------------------EATRFIKQILEGVNYLHTR-KIAHFDLKPENIML 152          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Eif2ak2 (eukaryotic translation initiation factor 2-alpha kinase 2 [Source:MGI Symbol;Acc:MGI:1353449])

HSP 1 Score: 59.6918 bits (143), Expect = 4.417e-9
Identity = 45/177 (25.42%), Postives = 76/177 (42.94%), Query Frame = 1
Query:  508 TSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCW----------------IEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            + F +I EI       ++++K R D + Y IK            ++  +  +   EV+ L+ LNH NIV YH CW                 + +C+F+Q+E+    +L  +M + N                    +KV  A    + +QI   + Y+HS  G+IH D++P NI +
Sbjct:  240 SDFEDIEEIGLGGFGQVFKAKHRIDGKRYAIK------------RVKYNTEKAEHEVQALAELNHVNIVQYHSCWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQ-------------------SKVDKALILDLYEQIVTGVEYIHSK-GLIHRDLKPGNIFL 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ulk2 (unc-51 like kinase 2 [Source:MGI Symbol;Acc:MGI:1352758])

HSP 1 Score: 58.9214 bits (141), Expect = 1.174e-8
Identity = 58/243 (23.87%), Postives = 100/243 (41.15%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHSICGPDNF---SPDDIR 1272
            +++R + R    W      +    +NK + LS+S   + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  +++ED                     T +  + QI  A+  LHS  GIIH D++P NI+++ +    +  K N+  +R  I     +    SN +   +  S  +   E       + M    D K   D + +   I   + G   F   SP D+R
Sbjct:   22 VVFRGRHRQKTDWE-----VAIKSINK-KNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSED---------------------TIRVFLHQIAAAMRILHSK-GIIHRDLKPQNILLSYA----NRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPE-------VIMSQHYDAKA--DLWSIGTVIYQCLVGKPPFQANSPQDLR 223          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ulk1 (unc-51 like kinase 1 [Source:MGI Symbol;Acc:MGI:1270126])

HSP 1 Score: 56.225 bits (134), Expect = 8.434e-8
Identity = 37/147 (25.17%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + R  H        IN   + K Q L      + +E++IL  L H NIV  +        ++L +EY  G  L  ++++  +++ED                     T +  ++QI  A+  LHS  GIIH D++P NI+++
Sbjct:   29 VVFKGRHREKHDLEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSED---------------------TVRLFLQQIAGAMRLLHSK-GIIHRDLKPQNILLS 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ulk1 (unc-51 like kinase 1 [Source:MGI Symbol;Acc:MGI:1270126])

HSP 1 Score: 56.225 bits (134), Expect = 8.946e-8
Identity = 37/147 (25.17%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + R  H        IN   + K Q L      + +E++IL  L H NIV  +        ++L +EY  G  L  ++++  +++ED                     T +  ++QI  A+  LHS  GIIH D++P NI+++
Sbjct:   29 VVFKGRHREKHDLEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSED---------------------TVRLFLQQIAGAMRLLHSK-GIIHRDLKPQNILLS 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 53.5286 bits (127), Expect = 9.096e-8
Identity = 41/140 (29.29%), Postives = 59/140 (42.14%), Query Frame = 1
Query:  595 CIKTGINYSEVNKFQKLSQ--------SNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            C + G       KF K  +        S  E+ REV IL  + H NI+  H  +  +  + L LE + G  L+ F+    S+ ED                      A Q +KQI   ++YLHS   I H D++P NIM+
Sbjct:   30 CQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTED---------------------EATQFLKQILDGVHYLHSK-RIAHFDLKPENIML 147          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q63184|E2AK2_RAT (Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Eif2ak2 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.598e-8
Identity = 44/178 (24.72%), Postives = 76/178 (42.70%), Query Frame = 1
Query:  514 FNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCW-------------------IEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            F +I EI       ++++K R D + Y IK            +++ +  +  REV+ L+ LNH NIV Y  CW                    + +C+F+Q+E+    +L  ++   N   ED                    A   ++ +QI   ++Y+HS  G+IH D++P NI +
Sbjct:  236 FEDIEEIGSGGFGQVFKAKHRIDGKTYAIK------------RITYNTKKAKREVQALAELNHANIVQYRVCWEGEDYDYDPENSTNGDTSRYKTRCLFIQMEFCDKGTLQQWLEKRNRSQEDK-------------------ALVLELFEQIVTGVDYIHSK-GLIHRDLKPGNIFL 381          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q03963|E2AK2_MOUSE (Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus OX=10090 GN=Eif2ak2 PE=1 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 3.090e-8
Identity = 45/177 (25.42%), Postives = 76/177 (42.94%), Query Frame = 1
Query:  508 TSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCW----------------IEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            + F +I EI       ++++K R D + Y IK            ++  +  +   EV+ L+ LNH NIV YH CW                 + +C+F+Q+E+    +L  +M + N                    +KV  A    + +QI   + Y+HS  G+IH D++P NI +
Sbjct:  240 SDFEDIEEIGLGGFGQVFKAKHRIDGKRYAIK------------RVKYNTEKAEHEVQALAELNHVNIVQYHSCWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQ-------------------SKVDKALILDLYEQIVTGVEYIHSK-GLIHRDLKPGNIFL 384          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9QY01|ULK2_MOUSE (Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 8.209e-8
Identity = 58/243 (23.87%), Postives = 100/243 (41.15%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHSICGPDNF---SPDDIR 1272
            +++R + R    W      +    +NK + LS+S   + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  +++ED                     T +  + QI  A+  LHS  GIIH D++P NI+++ +    +  K N+  +R  I     +    SN +   +  S  +   E       + M    D K   D + +   I   + G   F   SP D+R
Sbjct:   22 VVFRGRHRQKTDWE-----VAIKSINK-KNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSED---------------------TIRVFLHQIAAAMRILHSK-GIIHRDLKPQNILLSYA----NRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPE-------VIMSQHYDAKA--DLWSIGTVIYQCLVGKPPFQANSPQDLR 223          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IYT8|ULK2_HUMAN (Serine/threonine-protein kinase ULK2 OS=Homo sapiens OX=9606 GN=ULK2 PE=1 SV=3)

HSP 1 Score: 57.7658 bits (138), Expect = 2.067e-7
Identity = 39/147 (26.53%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            +++R + R    W      +    +NK + LS+S   + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  +++ED                     T +  + QI  A+  LHS  GIIH D++P NI+++
Sbjct:   22 VVFRGRHRQKTDWE-----VAIKSINK-KNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSED---------------------TIRVFLHQIAAAMRILHSK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0CLX3|ATG1_ASPTN (Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg1 PE=3 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.580e-7
Identity = 47/187 (25.13%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  460 RDTSEVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNG 1020
            R+TS+      S  ++  +  + +I + +   +Y+        +  IK+ +N S++NK  KL ++ F    E+ IL  L H +IV    C      I L +EY     L  F+   N++ E  +  + + K   P    ++    +  +KQ+  AL +L  D  +IH DI+P N+++  S      G
Sbjct:   11 RETSQT---SQSEMSVGRYTRLGQIGKGSFATVYQGVHTKSRTYVAIKS-VNLSQLNK--KLKENLFS---EIHILKGLYHPHIVALIDCHETTSHIHLVMEYCALGDLSQFIRHRNTLGEHRYTRDMIAKYPNPRGGALNEVVVRHFLKQLASALKFLR-DRNLIHRDIKPQNLLLCPSPTSYRAG 187          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5K3FSD8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.823e-22
Identity = 87/313 (27.80%), Postives = 145/313 (46.33%), Query Frame = 1
Query:  484 FYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINE--------DLFGNNF---LIKEHFPLTN-KVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINE---LDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVN---HKSIYMPSFDDNKK------SRDFYCLAISIIHSICGPDNFSP-DDIRNKGVGENL-CDDNELRNILTQMMEP 1344
             +NS  A+ S++ ++E+ R+   I+Y  + R     +C+K     SE  K      +  E+  EV+ L+ L H NIV Y+  W+E   IF+QLE+ +G SL+++++    ++         D    N    ++ +   L   ++ +A    ++  I  AL+YLHS   ++H D++P NI+I     E        E +   +SL Y  IL     S V FKL  F ++   GE           Y+P  DD          RD Y L +++ H+  GP N S  + +R  G   +L    + LR I+  M++P
Sbjct:  233 MFNSPCAVGSYSFLTELSRTRLAIVYLGRHRLTGILHCLKRSRCESEREK--NFGSTLPEMYNEVQALAILKHNNIVQYYNSWLEAGSIFMQLEFCLGGSLFHYLHPGRPLDTCHSLQKTVDRPNGNADASVVSDSMELVGRRLPLAALTMLLAHISSALSYLHSTWSMVHGDVKPSNILIQLKQAENHPAYTKDEMVHEAKSLCYS-ILESTDPSGVDFKLADFGRASKAGEDRDGDNLGDGRYLPRLDDPGSPECAAIGRDIYALGVTMYHAAGGPMNSSVWEHLRAVGSVPDLSVVPSSLRPIVKNMLKP 542          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3P6HUQ3 (Protein kinase domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3466 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 8.148e-22
Identity = 79/282 (28.01%), Postives = 130/282 (46.10%), Query Frame = 1
Query:  484 FYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINE--------DLFGNNF---LIKEHFPLTN-KVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINE---LDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVN---HKSIYMPSFDDNKK------SRDFYCLAISIIHSICGPDNFS 1257
             +NS  A+ S++ ++E+ R+   I+Y  + R     +C+K     SE  K      +  E+  EV+ L+ L H NIV Y+  W+E   IF+QLE+ +G SL+++++    ++         D    N    ++ +   L   ++ +A    ++  I  AL+YLHS   ++H D++P NI+I     E        E +   +SL Y  IL     S V FKL  F ++   GE           Y+P  DD          RD Y L +++ H+  GP N S
Sbjct:   64 MFNSPCAVGSYSFLTELSRTRLAIVYLGRHRLTGILHCLKRSRCESEREK--NFGSTLPEMYNEVQALAILKHNNIVQYYNSWLEAGSIFMQLEFCLGGSLFHYLHPGRPLDTCHSLQKTVDRPNGNADASVVSDSMELVGRRLPLAALTMLLAHISSALSYLHSTWSMVHGDVKPSNILIQLKQAENHPAYTKDEMVHEAKSLCYS-ILESTDPSGVDFKLADFGRASKAGEDRDGDNLGDGRYLPRLDDPGSPECAAIGRDIYALGVTMYHAAGGPMNSS 342          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A095CET5 (Wee1-like protein kinase OS=Schistosoma haematobium OX=6185 GN=MS3_09836 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.515e-21
Identity = 77/272 (28.31%), Postives = 132/272 (48.53%), Query Frame = 1
Query:  511 SFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMY--------------STNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINE--LDNGKE--NLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGE---TEVNHKSIYMPSFDDNKK------SRDFYCLAISIIHSICGP 1245
            SF+N+ +I R+   ++Y+++ R     YC+K      E+        S+ E+L EV+ L+ L H NI+ +   W E   ++ QLE  +G SL++ +Y              STN I+ ++ G+           N++S      +   +  AL+Y+H++  ++H D++P NI+I  S  E  L + KE   +D+ R   +K +L+G  ++ +VFKL  F ++   GE    E      Y+P  +D          RD Y L I++ HS  GP
Sbjct:  246 SFSNLVDICRTRLAVLYKARHRLSGVLYCLKRSRCDFELEHLN--GSSSVEMLNEVQALALLQHSNIIRFFGSWYEADSVYTQLELCLGGSLFHLLYPDRQNDTSEAVSLVSTNHIDNEIPGSPTSGSPSDANRNRLSEKPLIVLASHVLSALHYMHTNWSMVHGDVKPSNILIQLSRPEAYLASAKECIEMDAKRH-CHKLLLAG-DTAGIVFKLSDFGRASRAGEDRDGEDLGDGRYLPRLNDPSPPARAATGRDLYALGITLYHSAGGP 513          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4Z2DR43 (Wee1-like protein OS=Schistosoma japonicum OX=6182 GN=EWB00_009634 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.811e-20
Identity = 75/272 (27.57%), Postives = 131/272 (48.16%), Query Frame = 1
Query:  511 SFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMY--------------STNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINE--LDNGKE--NLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGE---TEVNHKSIYMPSFDDNKK------SRDFYCLAISIIHSICGP 1245
            SF+N+ +I R+   ++Y+++ R     YC+K   +  E+        S+ E+L EV+ L+ L H NI+ +   W E   ++ QLE  +G SL++ ++              STN +  ++ G+           N++       +   I  AL+Y+H++  ++H D++P NI+I  S  E  L + K+   +D+ R   YK +L+G  ++ +VFKL  F ++   GE    E      Y+P  +D          RD Y L I++ HS  GP
Sbjct:  245 SFSNLVDICRTRLAVLYKARHRLSGVLYCLKRSRSDFELEHLN--GSSSVEMLNEVQALALLQHTNIIRFFGSWYEADSVYTQLELCLGGSLFHLLHPDRQHDTSEVVSFISTNHMESEIPGSPTSCSSSDSNRNRLPEKPLIILASHILSALHYMHTNWSMVHGDVKPSNILIQLSRPEAYLASAKDCIEMDAKRH-CYKLLLAG-DTTGIVFKLSDFGRASRAGEDRDGEDLGDGRYLPRLNDPSPPARAATGRDLYALGITLYHSAGGP 512          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5J4NC56 (Wee1-like protein kinase OS=Paragonimus westermani OX=34504 GN=DEA37_0004917 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.420e-20
Identity = 79/282 (28.01%), Postives = 142/282 (50.35%), Query Frame = 1
Query:  511 SFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYS-------------TNSINEDLFGN-NFLIKEHFPLTNKVSIATAKQ-----------IIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINE--LDNGKENLD-SLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGE---TEVNHKSIYMPSFDDNKK------SRDFYCLAISIIHSICGP 1245
            SF+NI++I R+   ++Y+++ R     YC+K      EV +      S+ E+L EV+ L+ L H NI+ ++  W E   I+ QLE+ +G SL++F++              T+S+ E  FGN + L + +   +N  S ++A +           +   I  AL+Y+H++  ++H D++P NI+I  +  E  L + KE ++   +   +K +L+G  ++ ++FKL  F ++   GE    E      Y+P  +D          RD Y L I++ H+  GP
Sbjct:  285 SFSNITDISRTRLAVLYKARHRLSGVLYCLKRSRCEFEVER--PYGSSSAEMLNEVQALALLQHPNIIRFYGSWYEADSIYTQLEFCLGGSLFHFLHPDRQLDTSEAVPRITSSLME--FGNVDDLTEANCVDSNVASPSSATKANVLSEKSLHVLTAHILGALHYIHTNWSMVHGDVKPSNILIQLARPEAYLASTKEFIELEAKHHCHKLLLAG-DTTGILFKLSDFGRASRAGEDRDGEDLGDGRYLPRLNDPSPPARAATGRDLYALGITLYHAAGGP 561          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: eif2ak2 (eukaryotic translation initiation factor 2-alpha kinase 2 [Source:ZFIN;Acc:ZDB-GENE-080422-1])

HSP 1 Score: 63.5438 bits (153), Expect = 2.351e-10
Identity = 45/182 (24.73%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  505 LTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQC-------------------IFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            L +FN+IS++ +     +++++   + + Y +K  + Y+             + LREV  L+ L H NIV YH  WIE+                     +++Q+E   G++L +++ + N+            K+  P   +     A +I+ Q+ +A+ Y+HS + +IH D++P NIM T
Sbjct:  393 LENFNSISKLGKGGFGRVFKARKVIEQKDYAVKI-VKYTS------------KALREVAALAKLVHPNIVRYHTSWIEETAYQYESSESSTSTSSSEGSFLYIQMELCEGDTLQFWIETENT------------KDPSPERRQ----EAAKIMTQVLKAVEYIHS-VNLIHRDLKPANIMFT 544          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: eif2ak2 (eukaryotic translation initiation factor 2-alpha kinase 2 [Source:ZFIN;Acc:ZDB-GENE-080422-1])

HSP 1 Score: 62.003 bits (149), Expect = 8.516e-10
Identity = 48/190 (25.26%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  481 CFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQC-------------------IFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            CF   F  L +FN+IS++ +     +++++   + + Y +K  + Y+             + LREV  L+ L H NIV YH  WIE+                     +++Q+E   G++L +++ + N+            K+  P   +     A +I+ Q+ +A+ Y+HS + +IH D++P NIM T
Sbjct:  310 CFCRFF--LENFNSISKLGKGGFGRVFKARKVIEQKDYAVKI-VKYTS------------KALREVAALAKLVHPNIVRYHTSWIEETAYQYESSESSTSTSSSEGSFLYIQMELCEGDTLQFWIETENT------------KDPSPERRQ----EAAKIMTQVLKAVEYIHS-VNLIHRDLKPANIMFT 467          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ulk1b (unc-51 like autophagy activating kinase 1 [Source:NCBI gene;Acc:103042154])

HSP 1 Score: 60.4622 bits (145), Expect = 3.468e-9
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + R  H W      IN   + K Q L      + +E++IL  L H NIV  H        ++L +EY  G  L  +++S  +++ED                     T +  ++QI  A+  L +  GIIH D++P NI+++
Sbjct:   22 VVFKGRNREKHDWEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALHDFQETASSVYLVMEYCNGGDLADYLHSKGTLSED---------------------TIRVFLQQIAGAMRVLQAK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ulk1b (unc-51 like autophagy activating kinase 1 [Source:NCBI gene;Acc:103042154])

HSP 1 Score: 60.077 bits (144), Expect = 3.705e-9
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + R  H W      IN   + K Q L      + +E++IL  L H NIV  H        ++L +EY  G  L  +++S  +++ED                     T +  ++QI  A+  L +  GIIH D++P NI+++
Sbjct:   22 VVFKGRNREKHDWEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALHDFQETASSVYLVMEYCNGGDLADYLHSKGTLSED---------------------TIRVFLQQIAGAMRVLQAK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:103026419])

HSP 1 Score: 53.9138 bits (128), Expect = 2.012e-7
Identity = 43/137 (31.39%), Postives = 62/137 (45.26%), Query Frame = 1
Query:  604 TGINYSEVNKFQKLSQSNF--------EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            TG+ Y+   KF K  QS          E+ REV IL  L H NI++ H  +  +  + L LE + G  L+ F+    S++E+                      A + IKQI   + YLHS   I H D++P NIM+
Sbjct:   40 TGVEYA--AKFIKKRQSRASRRGVRREEIEREVNILQHLQHPNIISLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEE---------------------EATEFIKQILDGVQYLHSK-RISHFDLKPENIML 152          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001278.1 (pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-1 gene:ENSPMAG00000001147.1 transcript:ENSPMAT00000001278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 2.484e-6
Identity = 33/110 (30.00%), Postives = 52/110 (47.27%), Query Frame = 1
Query:  661 EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            ++ REV IL  L H NI++ H+ +     + L LE + G  L+ F+    S++ED                      A + +KQI   ++YLH    I H D++P NIM+
Sbjct:   42 DIKREVSILRELRHPNIISLHEVYENDTDVTLILELVSGGELFDFLAHKESLSED---------------------EATEFLKQILDGVSYLHCR-RIAHFDLKPENIML 129          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 52.7582 bits (125), Expect = 9.416e-8
Identity = 30/109 (27.52%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  664 VLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            V RE+ +L  LNH  IV     + + +  ++ +E++ G  L  F+ +  ++ ED                       ++I +QI  A+ Y+HS +GI H D++P NI+I
Sbjct:  241 VTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGED---------------------AGREISRQILTAIKYIHS-MGISHRDLKPDNILI 327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 49.6766 bits (117), Expect = 5.314e-7
Identity = 33/107 (30.84%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  670 REVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            REV I ++LNH N+   +  + +++ ++L +EYL+   +Y                  L++ H P  +      A   I QI  AL+Y+H    IIH DI+P NI+I
Sbjct:  151 REVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYK-----------------LLRLHGPFND----ILASDYIYQIANALDYMHKK-NIIHRDIKPENILI 235          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 48.1358 bits (113), Expect = 2.787e-6
Identity = 40/158 (25.32%), Postives = 70/158 (44.30%), Query Frame = 1
Query:  532 IFRSTNRIIYRSKCRHDHQWYCIKTGI--NYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFM-YSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITC 996
            I R +  ++Y++  +H  Q   IK  +  N  E+N          +++ E+ +L  LNH NIV YH    +   +++ LEY    SL   +  S+  ++E+                      +K  + Q    L YLH + G+IH DI+  NI+++ 
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELN----------DIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSEN---------------------ESKTYVTQTLLGLKYLHGE-GVIHRDIKAANILLSA 156          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKU3])

HSP 1 Score: 58.9214 bits (141), Expect = 2.864e-9
Identity = 39/130 (30.00%), Postives = 65/130 (50.00%), Query Frame = 1
Query:  610 INYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCS 999
            + + EVN  +   +   + L+E+ ILS LNH NIV Y   +I+   +F+++EY  G +L    +    +  +LF    +I   F                QIC A+ ++H + GI+H DI+ +NI +T S
Sbjct:   43 VVWKEVNLSRASDRERADALKEIDILSLLNHTNIVTYFNHFIDGTSLFIEMEYCNGGTL----HDKICVQNELFPEEVVIWYFF----------------QICAAVGHIHEN-GIVHRDIKTMNIFLTKS 151          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ0])

HSP 1 Score: 53.5286 bits (127), Expect = 7.695e-8
Identity = 40/146 (27.40%), Postives = 74/146 (50.68%), Query Frame = 1
Query:  568 KCRH--DHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCS 999
            KCRH   +Q   IK  I   +    +K++      +REVR+L  L H N+VN  + +  ++ +FL  E++            +++ +DL        E +P  N +   T ++++ Q+ RA+ ++H    IIH D++P NI+++ S
Sbjct:   20 KCRHKDSNQIVAIKKFIESEDDKMVKKIA------MREVRMLRQLRHENLVNLIEVFRRKKRLFLVFEFV-----------DHTVLDDL--------ERYP--NGLDENTVRKVMWQVLRAIEFIHRH-NIIHRDVKPENILVSRS 137          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO43725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU7])

HSP 1 Score: 51.6026 bits (122), Expect = 3.430e-7
Identity = 35/113 (30.97%), Postives = 55/113 (48.67%), Query Frame = 1
Query:  664 VLREVRILSTLN-HRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCS 999
             LREV   + L  H ++V Y+  W E   + +Q EY  G SL   + S N + E                 ++S A  K ++ Q+ + L Y+HS + ++H DI+P NI I+ S
Sbjct:   65 ALREVYAHAVLGTHPHVVRYYSAWAEDNHMLIQNEYCDGGSLADRIQSNNKLGE-----------------RLSEADLKMLLLQLAQGLKYIHS-LHLVHMDIKPGNIFISHS 159          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Z6])

HSP 1 Score: 50.0618 bits (118), Expect = 6.688e-7
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  661 EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            +++RE  +L ++ H+ I+  H  +  +    L LE L G  L+ F+   + + ED     FLI                    Q+ RA+ YLH D+ I+H DI+P NI++
Sbjct:   64 QIIREATVLRSVAHQGIIYLHDIYETKMEFVLILELLSGGELFEFLSEQDFLTEDE-AVGFLI--------------------QVIRAIEYLH-DLSIVHLDIKPENIVL 151          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN7])

HSP 1 Score: 51.2174 bits (121), Expect = 6.764e-7
Identity = 39/144 (27.08%), Postives = 66/144 (45.83%), Query Frame = 1
Query:  589 WYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSD--IGIIHNDIQPLNIMITCSINELD 1014
            W   +  +  +  + ++  +Q+   V +E RI S L H+NIV      +EQ  + L LEY  G +L   + S N               + P +  ++ A       QI + + YLHS+  + I+H D++  NI++   INE D
Sbjct:   94 WRDEEVAVKVARTDNYEDFTQTLDSVKKEARIFSMLRHQNIVGLLGVSLEQPNLCLVLEYARGGALSRALSSYN--------------RNIPPSVLLNWAI------QIAQGMFYLHSEAPVTIVHRDLKSGNILLHYKINESD 217          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ulk2 (serine/threonine-protein kinase ULK2 [Source:NCBI gene;Acc:101160680])

HSP 1 Score: 59.3066 bits (142), Expect = 7.895e-9
Identity = 57/243 (23.46%), Postives = 99/243 (40.74%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHSICGPDNF---SPDDIR 1272
            ++++ + R    W      IN   + K Q L      + +E++IL  L H NIV  +        +FL +EY  G  L  ++ +  ++ ED                     T +  ++QI  A+  L+S  GIIH D++P NI+++ S  +    + N+ S+R  I     +    SN++   +  S  +   E       + M    D K   D + +   I   + G   F   SP D+R
Sbjct:   22 VVFKGRHRKKTDWEVAIKSINKKNLTKSQIL------LGKEIKILKELQHENIVGLYDVQETPNSVFLVMEYCNGGDLADYLQAKGTLRED---------------------TMRVFLQQIAAAMRVLNSK-GIIHRDLKPQNILLSYSARK----RSNVSSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPE-------VIMSQNYDAKA--DLWSIGTVIYQCLVGKPPFQANSPQDLR 223          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ulk1a (serine/threonine-protein kinase ULK1 [Source:NCBI gene;Acc:101167046])

HSP 1 Score: 56.9954 bits (136), Expect = 3.256e-8
Identity = 37/146 (25.34%), Postives = 67/146 (45.89%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            ++++ + +  H W      IN   + K Q L      + +E++IL  L H NIV          C++L +EY  G  L  +++S  +++ED                     T +  ++QI +A+  L S  GI+H D++P NI++
Sbjct:   22 VVFKGRHKEKHSWEVAVKCINKKNLAKSQSL------LGKEIKILKELKHGNIVRLLDYQEIGGCVYLVMEYCNGGDLAEYLHSKGTLSED---------------------TIRIFLQQIAQAMKVLQSK-GILHRDLKPQNILL 139          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ulk1b (unc-51 like autophagy activating kinase 1 [Source:NCBI gene;Acc:101155703])

HSP 1 Score: 55.8398 bits (133), Expect = 9.052e-8
Identity = 38/147 (25.85%), Postives = 66/147 (44.90%), Query Frame = 1
Query:  553 IIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMIT 993
            ++++ + R  H W      IN   + K Q L      + +E++IL  L H NIV           ++L +EY  G  L  +++S  +++ED                     T +  ++QI  A+  L S  GIIH D++P NI+++
Sbjct:   22 VVFKGRHREKHDWEVAVKCINKKNLAKSQTL------LGKEIKILKELKHENIVALLDFQETVSSVYLVMEYCNGGDLADYLHSKGTLSED---------------------TIRVFLQQIVGAIKVLQSK-GIIHRDLKPQNILLS 140          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: mfap1 (microfibril associated protein 1 [Source:NCBI gene;Acc:101169659])

HSP 1 Score: 55.0694 bits (131), Expect = 1.164e-7
Identity = 40/135 (29.63%), Postives = 62/135 (45.93%), Query Frame = 1
Query:  604 TGINYSE--VNKFQKLSQSNF----EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            TG+ ++   + K Q+   S      E+ REV IL  + H NI+  H  +  +  + L LE + G  L+ F+    S++E+                      A Q IKQI   +NYLH+   I H D++P NIM+
Sbjct:   35 TGLEFAAKFIKKRQRTGSSRGVRREEIEREVSILQQIQHPNIIMLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEE---------------------EATQFIKQILEGVNYLHTR-KIAHFDLKPENIML 147          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:101165975])

HSP 1 Score: 53.1434 bits (126), Expect = 2.894e-7
Identity = 36/110 (32.73%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  661 EVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            E+ REV IL  L H NIV  H  +  +  + L +E + G  L+ F+    S++E+                      A Q IKQI   + YLHS   I H D++P NIM+
Sbjct:   65 EIEREVGILQQLQHPNIVALHDVYENRTDVVLIMELVSGGELFDFLAQKESLSEE---------------------EATQFIKQILDGVQYLHSK-RIAHFDLKPENIML 152          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000025288.1 (SMESG000025288.1)

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 414/419 (98.81%), Postives = 416/419 (99.28%), Query Frame = 1
Query:   34 MNLNLXXXXXXXXXXXXXXPAIFEAESPPPDQIIKVANLHPRKLGSCDSTKKLCFAPKAKTVDSNKMKMGKENDRLFNNPLFGRLLTAIXXXXXXXXXXXXXXXSFSVIEEGILDSLIRLNQIFENAHILNNLEFNNDVDNIRDTSEVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHSICGPDNFSPDDIRNKGVGE 1290
            MNLNLSFRASSYSSVSFGSPAIFEAESPPPDQIIKVANLHPRKLGSCDSTKKLCFAPKAKTVDSNKMKMGKENDRLFNNPLFGRLLTAIPPLKINLNENKNNEISFSVIEEGILDSLIRLNQIFENAHILNNLEFNNDVDNI+DTSEVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQ LSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIAT KQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFY LA+SIIHSICGPDNFSPDDIRNKGVGE
Sbjct:    1 MNLNLSFRASSYSSVSFGSPAIFEAESPPPDQIIKVANLHPRKLGSCDSTKKLCFAPKAKTVDSNKMKMGKENDRLFNNPLFGRLLTAIPPLKINLNENKNNEISFSVIEEGILDSLIRLNQIFENAHILNNLEFNNDVDNIKDTSEVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQNLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATGKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYGLAMSIIHSICGPDNFSPDDIRNKGVGE 419          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000064686.1 (SMESG000064686.1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.390e-19
Identity = 62/222 (27.93%), Postives = 113/222 (50.90%), Query Frame = 1
Query:  487 YNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEY----LIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGET 1140
            YNSFH   +F ++ ++        +R+K R D  WYC  T I+    ++ Q LS+S+  +  E+ +LS L+H NI++Y   WIE Q I+ QLEY    L+ E+L + +Y               IK     T  +++ ++K+++ QI  AL+++H+D   +HND+  +N+++           +  D  + ++ + +       +++FKL GF     V E+
Sbjct:  141 YNSFHVSPTFCDMVKLHSLVGIKYFRAKHRFDSHWYC--TRISSYNNDEIQTLSKSSRLLQNEIMMLSRLSHENIISYFSSWIEYQTIYEQLEYNKFGLLEEALNFTIYDK-------------IK-----TRVLTLKSSKELVLQIVSALDFMHTDWTFVHNDVNFINVLL------FPVNSKKTDVKKEILLECLFEKTSFFDILFKLAGFENCELVKES 336          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000052154.1 (SMESG000052154.1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.601e-17
Identity = 65/223 (29.15%), Postives = 110/223 (49.33%), Query Frame = 1
Query:  490 NSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIK-TGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEIL-----SGIQSSNVVFKLIGFSKSFYVGET 1140
            NS H    F ++ ++        +R+K R D  WYCIK +  N  E+   Q LS+S+  +  E+ +LS+L+H NI+ Y   WIE Q ++ QLEY              S+ E L   NF I +    T  +++ ++K+++ QI  AL+++H D   +H+D+   N+++             +DS ++ + KEIL           +++FKL GF     V E+
Sbjct:  253 NSIHVSPIFCDMVKLHSLVGIKYFRAKHRFDSHWYCIKISSYNNDEI---QTLSKSSRLLQNEIMMLSSLSHENIIKYFSSWIEYQTLYEQLEY----------NKFGSLEEAL---NFTINDKIE-TRVLTLKSSKELVLQIGSALDFMHIDWTFVHDDVNFSNVLLFA-----------VDSKKTYVEKEILLECLFEKTSFFDILFKLAGFENCELVRES 447          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000073764.1 (SMESG000073764.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.670e-12
Identity = 69/258 (26.74%), Postives = 122/258 (47.29%), Query Frame = 1
Query:  523 ISEIFRSTNRI--IYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLN-HRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNI---MITCSINELDNGKENLDSLRSLIYKEILSGIQSSNVVFKLIGFSKSFYVGETEVNHK-----SIYMPSFDDNK-------KSRDFYCLAISIIHSICG 1242
            I++I  S+ ++  IY  + R + Q+Y +K+G   +       LS+S+ E++ EV+IL+ +  H ++V+++  WIE +   LQL ++ G SL  F+   ++    +   + L K +     ++S  +A  ++  I   L Y+H  + I H DI+P N+   M+  + N+L   K    S        +L    +  + FKL  F +S   G T    K       Y+P+ +DN         SRD Y L ++I     G
Sbjct:  171 INKILISSTKLSEIYLCQHRFNSQYYVVKSGYKSNS----HCLSESSREIINEVKILTLIGKHSHVVDFYDAWIEDERFHLQLGFISGGSLIDFIVGNSNRFCAICDISKLEKRY-----RISSCSAYIMLAHISSVLVYMHEVLNIFHGDIKPSNVLVDMVRYTSNDLSMAKLECHS-------ALLDSNPNPRLRFKLCDFGRS---GATSNVIKMDEGDGRYLPTLNDNSSNYHLFASSRDIYALGLTIFDCFGG 409          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000008335.1 (SMESG000008335.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.068e-10
Identity = 47/181 (25.97%), Postives = 81/181 (44.75%), Query Frame = 1
Query:  448 VDNIRDTSEVMCFYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNKFQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGESLYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNYLHSDIGIIHNDIQPLNIMI 990
            VDN    S + C     H+L                 +R+K R D  WYCIK  I+    ++ Q LS+S+  +  E+ +LS+L+H NI+ Y   WIE Q +                             NF I +    T  +++ ++K+++ QI  AL+++H D   +H+D+   N+++
Sbjct:  531 VDNSIHVSPIFCDMVKLHSLVGIK------------YFRAKHRFDSHWYCIK--ISSYNNDEIQTLSKSSRLLQNEIMMLSSLSHENIIKYFSSWIEYQTL-----------------------------NFTINDKIE-TRVLTLKSSKELVLQIGSALDFMHIDWTFVHDDVNFSNVLL 667          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ULK24.304e-826.53unc-51 like autophagy activating kinase 2 [Source:... [more]
ULK24.304e-826.53unc-51 like autophagy activating kinase 2 [Source:... [more]
DAPK38.000e-830.00death associated protein kinase 3 [Source:HGNC Sym... [more]
DAPK38.000e-830.00death associated protein kinase 3 [Source:HGNC Sym... [more]
ULK11.032e-722.63unc-51 like autophagy activating kinase 1 [Source:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-434.177e-729.55Calcium/calmodulin-dependent protein kinase type I... [more]
unc-434.177e-729.55Calcium/calmodulin-dependent protein kinase type I... [more]
unc-434.177e-729.55Calcium/calmodulin-dependent protein kinase type I... [more]
unc-434.529e-729.55Calcium/calmodulin-dependent protein kinase type I... [more]
unc-434.529e-729.55Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tao9.084e-924.87gene:FBgn0031030 transcript:FBtr0309237[more]
Tao1.314e-824.87gene:FBgn0031030 transcript:FBtr0336692[more]
Tao6.669e-826.09gene:FBgn0031030 transcript:FBtr0303999[more]
Tao6.669e-826.09gene:FBgn0031030 transcript:FBtr0074772[more]
Tao6.669e-826.09gene:FBgn0031030 transcript:FBtr0074771[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ulk1b2.443e-925.85unc-51 like autophagy activating kinase 1 [Source:... [more]
ulk1a7.222e-824.40unc-51 like autophagy activating kinase 1a [Source... [more]
ulk1a1.161e-724.40unc-51 like autophagy activating kinase 1a [Source... [more]
dapk2a4.016e-732.81death-associated protein kinase 2a [Source:ZFIN;Ac... [more]
ulk24.510e-724.49unc-51 like autophagy activating kinase 2 [Source:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twnk7.039e-828.24twinkle mtDNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
ULK21.633e-722.63unc-51 like autophagy activating kinase 2 [Source:... [more]
dapk11.699e-727.41death associated protein kinase 1 [Source:NCBI gen... [more]
c7orf261.833e-730.43chromosome 7 open reading frame 26 [Source:Xenbase... [more]
c7orf261.876e-730.43chromosome 7 open reading frame 26 [Source:Xenbase... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif2ak24.417e-925.42eukaryotic translation initiation factor 2-alpha k... [more]
Ulk21.174e-823.87unc-51 like kinase 2 [Source:MGI Symbol;Acc:MGI:13... [more]
Ulk18.434e-825.17unc-51 like kinase 1 [Source:MGI Symbol;Acc:MGI:12... [more]
Ulk18.946e-825.17unc-51 like kinase 1 [Source:MGI Symbol;Acc:MGI:12... [more]
Dapk39.096e-829.29death-associated protein kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63184|E2AK2_RAT1.598e-824.72Interferon-induced, double-stranded RNA-activated ... [more]
sp|Q03963|E2AK2_MOUSE3.090e-825.42Interferon-induced, double-stranded RNA-activated ... [more]
sp|Q9QY01|ULK2_MOUSE8.209e-823.87Serine/threonine-protein kinase ULK2 OS=Mus muscul... [more]
sp|Q8IYT8|ULK2_HUMAN2.067e-726.53Serine/threonine-protein kinase ULK2 OS=Homo sapie... [more]
sp|Q0CLX3|ATG1_ASPTN2.580e-725.13Serine/threonine-protein kinase atg1 OS=Aspergillu... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FSD81.823e-2227.80Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3P6HUQ38.148e-2228.01Protein kinase domain-containing protein OS=Mesoce... [more]
A0A095CET55.515e-2128.31Wee1-like protein kinase OS=Schistosoma haematobiu... [more]
A0A4Z2DR432.811e-2027.57Wee1-like protein OS=Schistosoma japonicum OX=6182... [more]
A0A5J4NC564.420e-2028.01Wee1-like protein kinase OS=Paragonimus westermani... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif2ak22.351e-1024.73eukaryotic translation initiation factor 2-alpha k... [more]
eif2ak28.516e-1025.26eukaryotic translation initiation factor 2-alpha k... [more]
ulk1b3.468e-925.85unc-51 like autophagy activating kinase 1 [Source:... [more]
ulk1b3.705e-925.85unc-51 like autophagy activating kinase 1 [Source:... [more]
dapk2b2.012e-731.39death associated protein kinase 2 [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001278.12.484e-630.00pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RAD539.416e-827.52DNA damage response protein kinase; required for c... [more]
IPL15.314e-730.84Aurora kinase of chromosomal passenger complex; me... [more]
CDC152.787e-625.32Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356992.864e-930.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354027.695e-827.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437253.430e-730.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422876.688e-729.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364426.764e-727.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ulk27.895e-923.46serine/threonine-protein kinase ULK2 [Source:NCBI ... [more]
ulk1a3.256e-825.34serine/threonine-protein kinase ULK1 [Source:NCBI ... [more]
ulk1b9.052e-825.85unc-51 like autophagy activating kinase 1 [Source:... [more]
mfap11.164e-729.63microfibril associated protein 1 [Source:NCBI gene... [more]
dapk2b2.894e-732.73death associated protein kinase 2 [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025288.10.000e+098.81SMESG000025288.1[more]
SMESG000064686.11.390e-1927.93SMESG000064686.1[more]
SMESG000052154.12.601e-1729.15SMESG000052154.1[more]
SMESG000073764.11.670e-1226.74SMESG000073764.1[more]
SMESG000008335.11.068e-1025.97SMESG000008335.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018725 ID=SMED30018725|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1499bp
AATTTAAATTGACTTTTGAAAATAGCTACTCGCATGAATCTAAATTTGTC
ATTTAGAGCTTCATCATACAGTAGCGTGTCATTTGGATCGCCAGCTATAT
TTGAAGCTGAATCTCCACCACCTGATCAAATTATTAAAGTAGCTAATCTT
CATCCACGAAAATTGGGCTCTTGTGATTCAACCAAAAAGCTATGCTTCGC
ACCAAAAGCTAAAACTGTAGATTCTAACAAGATGAAAATGGGGAAAGAAA
ATGATAGACTCTTTAACAATCCACTTTTTGGAAGATTGTTAACTGCTATT
CCCCCACTAAAAATTAATTTGAATGAAAACAAAAATAATGAAATATCATT
TTCAGTTATCGAAGAAGGAATTTTAGATTCTTTGATTCGTTTGAATCAAA
TATTTGAGAATGCTCATATTCTGAATAATTTAGAGTTTAATAATGATGTG
GATAATATAAGGGATACTAGCGAAGTTATGTGCTTCTATAATTCATTTCA
TGCGCTAACTAGTTTTAATAATATTTCCGAAATTTTCCGCTCGACTAATA
GAATCATTTATCGATCAAAATGCCGCCATGATCATCAATGGTATTGCATT
AAAACTGGAATCAACTATAGCGAGGTTAATAAGTTTCAAAAATTATCACA
GTCGAATTTTGAGGTTCTAAGAGAAGTCAGGATACTATCTACTCTAAATC
ATCGAAATATTGTCAACTATCATAAATGCTGGATTGAACAGCAATGTATT
TTTCTTCAGTTAGAATATTTAATAGGAGAGTCTTTGTATTATTTTATGTA
TTCAACCAATTCTATTAATGAAGACTTATTTGGAAATAATTTTCTGATTA
AAGAGCATTTTCCATTGACAAATAAAGTTTCCATCGCTACAGCGAAACAG
ATTATTAAACAAATCTGCAGAGCGCTGAATTACTTGCACAGTGATATTGG
GATTATTCACAATGATATTCAGCCGTTGAATATTATGATAACATGTTCAA
TAAACGAACTGGATAATGGAAAAGAAAATTTGGATTCTTTGAGATCGTTG
ATTTATAAAGAGATTTTGAGTGGAATTCAAAGCTCCAATGTCGTGTTTAA
ATTGATTGGTTTTAGCAAGTCGTTTTATGTCGGAGAAACTGAGGTCAACC
ATAAATCAATTTACATGCCGTCTTTCGATGACAATAAAAAAAGTAGAGAT
TTCTACTGCCTTGCTATCTCGATTATACACTCGATTTGTGGACCCGATAA
CTTTTCCCCTGATGACATTCGTAATAAAGGGGTAGGAGAAAATTTGTGTG
ATGATAATGAATTACGAAATATTTTGACACAAATGATGGAACCGAACTCG
TTTATGAATGCGCAGCAATTCTTTCATCATGACAATTTGTGATTTGAACA
GTGTTTTCTGATTTTTCATACGTTTTATGAGAGATTATGTTTGGGTGATT
ATATGAATATATTTTTTGTTAGTTTATTATTTTCAATCCTTGGAGCTAG
back to top

protein sequence of SMED30018725-orf-1

>SMED30018725-orf-1 ID=SMED30018725-orf-1|Name=SMED30018725-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=453bp
MNLNLSFRASSYSSVSFGSPAIFEAESPPPDQIIKVANLHPRKLGSCDST
KKLCFAPKAKTVDSNKMKMGKENDRLFNNPLFGRLLTAIPPLKINLNENK
NNEISFSVIEEGILDSLIRLNQIFENAHILNNLEFNNDVDNIRDTSEVMC
FYNSFHALTSFNNISEIFRSTNRIIYRSKCRHDHQWYCIKTGINYSEVNK
FQKLSQSNFEVLREVRILSTLNHRNIVNYHKCWIEQQCIFLQLEYLIGES
LYYFMYSTNSINEDLFGNNFLIKEHFPLTNKVSIATAKQIIKQICRALNY
LHSDIGIIHNDIQPLNIMITCSINELDNGKENLDSLRSLIYKEILSGIQS
SNVVFKLIGFSKSFYVGETEVNHKSIYMPSFDDNKKSRDFYCLAISIIHS
ICGPDNFSPDDIRNKGVGENLCDDNELRNILTQMMEPNSFMNAQQFFHHD
NL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0010998regulation of translational initiation by eIF2 alpha phosphorylation
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity