Nipped-B protein

Overview
NameNipped-B protein
Smed IDSMED30018721
Length (bp)1410
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nipped-B protein (SMED30018721) t-SNE clustered cells

Violin plots show distribution of expression levels for Nipped-B protein (SMED30018721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nipped-B protein (SMED30018721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nipped-B protein (SMED30018721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Nipped-B protein vs. Ensembl Human
Match: LEXM (lymphocyte expansion molecule [Source:HGNC Symbol;Acc:HGNC:26854])

HSP 1 Score: 144.05 bits (362), Expect = 1.034e-37
Identity = 120/393 (30.53%), Postives = 186/393 (47.33%), Query Frame = 3
Query:   45 SKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSN-----NNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPA--HELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHD-SAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSK-YVNSHENIFKSKTGAQLTKEKFSML-SERLKP 1184
            +K F+GAPFG QSHRFD++ V+P  K   T      S+      ++IGPG Y +++  + FS+ KL +     GW ++    + + +P+   + +   K+ +++KLGPG Y++      L +   + +G++S  E RF        PGPG YG+ G P+   EE  N    + + G++    N     P  G  L P TY   S +   +    G RGPYD FS +R+KP+  GH ++      EL     + KS V+ LNS + K HG F K+ + P  P +R YW N +  P      LA        PQ       + PPF  +S      +      ++N VG GRY    L ++K     + ++F S +   L+     ML  ER+ P
Sbjct:   21 TKWFTGAPFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPGTYSSKE--TCFSKKKL-MKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREKPCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEE--NAWNRSHSEGLMCRMSNKPHPRPHQGSGLGPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELM----NFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCP----RTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGAKACQMIMGSWNPVGVGRYLNTWLMETKDRRQRYRSLFLSGSKRYLSDLARDMLMQERITP 400          
BLAST of Nipped-B protein vs. Ensembl Human
Match: LEXM (lymphocyte expansion molecule [Source:HGNC Symbol;Acc:HGNC:26854])

HSP 1 Score: 142.51 bits (358), Expect = 3.501e-37
Identity = 112/361 (31.02%), Postives = 172/361 (47.65%), Query Frame = 3
Query:   42 TSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSN-----NNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPA--HELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHD-SAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSK 1091
             +K F+GAPFG QSHRFD++ V+P  K   T      S+      ++IGPG Y +++  + FS+ KL +     GW ++    + + +P+   + +   K+ +++KLGPG Y++      L +   + +G++S  E RF        PGPG YG+ G P+   EE  N    + + G++    N     P  G  L P TY   S +   +    G RGPYD FS +R+KP+  GH ++      EL     + KS V+ LNS + K HG F K+ + P  P +R YW N +  P      LA        PQ       + PPF  +S      +      ++N VG GRY    L ++K
Sbjct:   20 ATKWFTGAPFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPGTYSSKE--TCFSKKKL-MKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREKPCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEE--NAWNRSHSEGLMCRMSNKPHPRPHQGSGLGPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELM----NFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCP----RTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGAKACQMIMGSWNPVGVGRYLNTWLMETK 367          
BLAST of Nipped-B protein vs. Ensembl Xenopus
Match: ENSXETT00000045218.1 (lymphocyte expansion molecule [Source:NCBI gene;Acc:100491026])

HSP 1 Score: 232.261 bits (591), Expect = 4.649e-71
Identity = 154/404 (38.12%), Postives = 211/404 (52.23%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGM------QTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNKN----VKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTK-EKFSMLSERLKPKNIPINKRHFI 1217
            M  K FSGAPFG QS RFD++ VHP  K  G+   +       +     +GPG Y  E   S FS S L+ +A  P WKR+  TE+ ++MP++L K+ Y   +  K+ LGPG Y++  S L+L +     ++GV S +E RF +  +  TPGPG YGK G P+ L EE     KSAS+ G++        +LP+TGC L P TYNL S INE + H  G RGPYD+FS +R +PI  GH A        PG Y  KS  + L S + K +G F  + QYP  P +R + N P  +         PG YD K P       SA PF SS+ R +K S    + + N VG GRYD+ +    K      + F SKT   L+   +  +L ERL+ K +    +  +
Sbjct:    1 MAEKKFSGAPFGSQSARFDVSAVHPDSKKTGSYTQVPYCRRATSELERRLGPGTYNAEQ--SDFSPSVLEKNASAPAWKRAQETEKLTTMPHLLYKETYERNRLLKQNLGPGRYNIK-SFLDLLEKKPSCIRGVCSTKEERFKKNEQFCTPGPGSYGKGGNPYSLLEE--RVSKSASSKGIMDTSPGEGHSLPSTGCELGPGTYNLKSSINETLAHVVGNRGPYDLFSASREQPILYGHFAEPKNRGPEPGAYKVKSFTEDLESHHRKKYGVFGNLAQYPKVPTERIFINRPKTM-----GNPGPGLYDPK-PFYEPKRHSAAPFLSSAKRFEKKSCRLLFGSNNPVGVGRYDVAKHLRGKAATPLRSSFLSKTERYLSNPARDKILEERLRQKTVSATNKALL 393          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Lexm (lymphocyte expansion molecule [Source:MGI Symbol;Acc:MGI:2681853])

HSP 1 Score: 142.51 bits (358), Expect = 2.356e-37
Identity = 113/359 (31.48%), Postives = 174/359 (48.47%), Query Frame = 3
Query:   48 KSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNN-----IGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHL-LKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAV--LPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNI-ISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDS 1088
            K F GAPFG QSHRFD++ V+P +K   T      S +++     IGPG Y ++D  + FS+  L+      GW +++   + + +P+   + +   K++Q  K GPG Y++      L K   + +G++S  E RF        PGPG YG+ G P+  L+E+  N+  S   +  + N    +  L   G  L P TY + S +   +   +G RGPYDIFS  R+ P+  GH +V  +   EL     D KS +D +NS + K  G F K  + P  P +R +W   +  P +++    PGS+    P      H + PPF  +S R    +       +N VG GRY    L +S
Sbjct:   19 KWFKGAPFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKD--TCFSKKFLEQKLGS-GWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDGLMCRVSN----KPPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSVQKMKPKELT----DYKSFLDEMNSQHKKKQGVFSKYPRDPKHPTERIFWTTLSQCPKNMDI-AGPGSW---LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNPVGVGRYLNTTLMES 362          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Lexm (lymphocyte expansion molecule [Source:MGI Symbol;Acc:MGI:2681853])

HSP 1 Score: 142.51 bits (358), Expect = 2.356e-37
Identity = 113/359 (31.48%), Postives = 174/359 (48.47%), Query Frame = 3
Query:   48 KSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNN-----IGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHL-LKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAV--LPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNI-ISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDS 1088
            K F GAPFG QSHRFD++ V+P +K   T      S +++     IGPG Y ++D  + FS+  L+      GW +++   + + +P+   + +   K++Q  K GPG Y++      L K   + +G++S  E RF        PGPG YG+ G P+  L+E+  N+  S   +  + N    +  L   G  L P TY + S +   +   +G RGPYDIFS  R+ P+  GH +V  +   EL     D KS +D +NS + K  G F K  + P  P +R +W   +  P +++    PGS+    P      H + PPF  +S R    +       +N VG GRY    L +S
Sbjct:   19 KWFKGAPFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKD--TCFSKKFLEQKLGS-GWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDGLMCRVSN----KPPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSVQKMKPKELT----DYKSFLDEMNSQHKKKQGVFSKYPRDPKHPTERIFWTTLSQCPKNMDI-AGPGSW---LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNPVGVGRYLNTTLMES 362          
BLAST of Nipped-B protein vs. Ensembl Mouse
Match: Lexm (lymphocyte expansion molecule [Source:MGI Symbol;Acc:MGI:2681853])

HSP 1 Score: 142.51 bits (358), Expect = 2.356e-37
Identity = 113/359 (31.48%), Postives = 174/359 (48.47%), Query Frame = 3
Query:   48 KSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNN-----IGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHL-LKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAV--LPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNI-ISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDS 1088
            K F GAPFG QSHRFD++ V+P +K   T      S +++     IGPG Y ++D  + FS+  L+      GW +++   + + +P+   + +   K++Q  K GPG Y++      L K   + +G++S  E RF        PGPG YG+ G P+  L+E+  N+  S   +  + N    +  L   G  L P TY + S +   +   +G RGPYDIFS  R+ P+  GH +V  +   EL     D KS +D +NS + K  G F K  + P  P +R +W   +  P +++    PGS+    P      H + PPF  +S R    +       +N VG GRY    L +S
Sbjct:   19 KWFKGAPFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKD--TCFSKKFLEQKLGS-GWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDGLMCRVSN----KPPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSVQKMKPKELT----DYKSFLDEMNSQHKKKQGVFSKYPRDPKHPTERIFWTTLSQCPKNMDI-AGPGSW---LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNPVGVGRYLNTTLMES 362          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|B1H283|LEXM_RAT (Lymphocyte expansion molecule OS=Rattus norvegicus OX=10116 GN=Lexm PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.563e-39
Identity = 114/351 (32.48%), Postives = 165/351 (47.01%), Query Frame = 3
Query:   48 KSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNN-----IGPGYYITEDR--SSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDS-KSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNI-ISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRY 1064
            K F GAPFG QSHRFD++ VHP +K   T      S +++     IGPG Y +++   S  F + KL       GW R+    + + +P+   + +   +++Q  K GPG Y++      L K   + +G++S  E RF        PGPG YG+ G P+   E+    R  +   G++    +    L   G  L P TY + S I   +   +G RGPYDIFS  R+ P+  GH +V    +  P    S KS VD LN+ + K  G F K  + P  P +R YW   +  P D+ N   PGS+    P      H + PPF  +S R    +       +N VG GRY
Sbjct:    6 KWFKGAPFGVQSHRFDVSAVHPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKETCFSKKFLEQKLGA-----GWARAQEASRLTQLPHFHFQAIKKEREQQANKRGPGSYNIKDFLTELQKKPQSKRGLLSSGETRFRGLIGNYYPGPGNYGEKGNPYTQLEKNSWNRSHSD--GLMCRLSSKPPPLSHQGSGLGPGTYTIKSDIETFVEKSTGTRGPYDIFSGERSSPVPYGHYSV---QKKKPRELTSFKSFVDELNAPHKKKQGGFSKYPRDPKHPTERIYWTTLSQCPKDV-NVAGPGSW---LPHETEQKHVNRPPFLLASKRSGLKACQMLLGTWNPVGVGRY 342          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|Q3ZCV2|LEXM_HUMAN (Lymphocyte expansion molecule OS=Homo sapiens OX=9606 GN=LEXM PE=2 SV=4)

HSP 1 Score: 144.05 bits (362), Expect = 4.964e-37
Identity = 120/393 (30.53%), Postives = 186/393 (47.33%), Query Frame = 3
Query:   45 SKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSN-----NNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPA--HELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHD-SAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSK-YVNSHENIFKSKTGAQLTKEKFSML-SERLKP 1184
            +K F+GAPFG QSHRFD++ V+P  K   T      S+      ++IGPG Y +++  + FS+ KL +     GW ++    + + +P+   + +   K+ +++KLGPG Y++      L +   + +G++S  E RF        PGPG YG+ G P+   EE  N    + + G++    N     P  G  L P TY   S +   +    G RGPYD FS +R+KP+  GH ++      EL     + KS V+ LNS + K HG F K+ + P  P +R YW N +  P      LA        PQ       + PPF  +S      +      ++N VG GRY    L ++K     + ++F S +   L+     ML  ER+ P
Sbjct:   21 TKWFTGAPFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPGTYSSKE--TCFSKKKL-MKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREKPCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEE--NAWNRSHSEGLMCRMSNKPHPRPHQGSGLGPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELM----NFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWANLSQCP----RTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGAKACQMIMGSWNPVGVGRYLNTWLMETKDRRQRYRSLFLSGSKRYLSDLARDMLMQERITP 400          
BLAST of Nipped-B protein vs. UniProt/SwissProt
Match: sp|A2AVQ5|LEXM_MOUSE (Lymphocyte expansion molecule OS=Mus musculus OX=10090 GN=Lexm PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.648e-36
Identity = 113/359 (31.48%), Postives = 174/359 (48.47%), Query Frame = 3
Query:   48 KSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNN-----IGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHL-LKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAV--LPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNI-ISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDS 1088
            K F GAPFG QSHRFD++ V+P +K   T      S +++     IGPG Y ++D  + FS+  L+      GW +++   + + +P+   + +   K++Q  K GPG Y++      L K   + +G++S  E RF        PGPG YG+ G P+  L+E+  N+  S   +  + N    +  L   G  L P TY + S +   +   +G RGPYDIFS  R+ P+  GH +V  +   EL     D KS +D +NS + K  G F K  + P  P +R +W   +  P +++    PGS+    P      H + PPF  +S R    +       +N VG GRY    L +S
Sbjct:   19 KWFKGAPFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKD--TCFSKKFLEQKLGS-GWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDGLMCRVSN----KPPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSVQKMKPKELT----DYKSFLDEMNSQHKKKQGVFSKYPRDPKHPTERIFWTTLSQCPKNMDI-AGPGSW---LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNPVGVGRYLNTTLMES 362          
BLAST of Nipped-B protein vs. TrEMBL
Match: A0A1I8HJX0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031511g1 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 4.225e-118
Identity = 195/423 (46.10%), Postives = 266/423 (62.88%), Query Frame = 3
Query:   48 KSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYST-LNLNKNVKGVMSEREPRFMEEY-KEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGK--RGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSY---DVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESSPCVDLDKMLSHNQIPLTI 1295
            K +SGAPFG+QS RFD++G+HPKRK+PGTL  +    + ++GPG Y    + + FS  ++   A+ P WKR+Y   + S +P++L K+ +  K+EQKRKLGPGYY V  S    L  + +G++  REPRF     +E  PGPG YGK G+PHL KEE D +R+    +GML  GG+  R  P  G  L P TY +PSF + +   ++GK  RGPY++FSL+R +P+KTGH A +    L PG Y+ K  V  LN    ++HGKFLKM QYP KP DR YW  PA VPPD  N+++  SY   D  F +   S   A  F S+SNR DK S MFF +NFNQVGPGRYD+QR +D+ +VN+H N F SKT A+L+  +  +  ERL+ K+IP  +R  +DH+ TE  P V++  + +    PL I
Sbjct:    8 KGYSGAPFGFQSTRFDVSGIHPKRKLPGTLTQVPGGISADLGPGSYDVL-QYNEFSDKRVASRAQGPNWKRAYDVHRQSQIPHLLYKEQHAEKEEQKRKLGPGYYDVAGSQDYRLEVSKRGLLEAREPRFRGHTGQEGNPGPGSYGKSGVPHLHKEEMDEKRRHCGRVGMLDCGGS--RAPPQQGTDLGPGTYQIPSFTDLLAAKKAGKNSRGPYEVFSLDRDQPVKTGHYARMSTGNLGPGQYNFKDGVADLNRPEKRNHGKFLKMVQYPAKPCDRIYWMTPATVPPDPTNKVSAASYHPTDPNFKKESFSKSEA-GFLSTSNRQDKRSLMFFTKNFNQVGPGRYDIQRQEDTAHVNAHTNDFVSKTEARLSHGQQQVYRERLRDKDIPPGRRFRVDHVATEKEPFVNIQPLFAARD-PLVI 425          
BLAST of Nipped-B protein vs. TrEMBL
Match: A0A1S3JSZ9 (lymphocyte expansion molecule OS=Lingula unguis OX=7574 GN=LOC106175621 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 5.117e-88
Identity = 168/410 (40.98%), Postives = 242/410 (59.02%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTL-------IGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV-DY--STLNLNKNVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTG-AQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTE 1235
            M  K + GAPFG Q+ RFD++ VHPK KMPGT        + M+ S N   GPG Y  E     FS   ++  A  PGW R Y  ++ ++MP++L+K+ +  K+  KRKL PG Y++ D+  ++    +++ G+ + +EPRF       TPGPG YG  G+PH   E+   +  S ST+GML    +  R+LP  G  L P +YN  SF  ++    +  RGPYD+FS  R KPI TGHLAV   H L PG YD KS VD   + + K HGK  K+ Q+PDKP +R   +  +  P ++     PG+Y+ K      +H+S P F SS+ R D+++  FF +NFN VG GRYD+Q+ +++++VN HE++FKSK+G   L +E+F  L ERL+ K++P  +R FI  IP E
Sbjct:    1 MAEKKYKGAPFGTQTARFDVSAVHPKNKMPGTFTQTPYCRVSME-SLNRTRGPGKYAVE--VGGFSPKSVEERASGPGWARQYEVQRMAAMPHLLHKEQWELKRLLKRKLAPGTYNIKDFLETSDERPRSIYGICATKEPRFRNTVTNATPGPGTYGIGGVPHAALEQ--KEMASTSTVGMLDAVSSMPRSLPLVGSDLGPGSYNFESFTKQLERKVTSLRGPYDLFSGQRNKPITTGHLAVPTWHTLGPGQYDLKSFVDDWGTIHKKKHGKMGKVQQHPDKPSERILVSTLSQCPKEMGAP-GPGAYNAKEISKPQAHNS-PGFLSSARRDDRMAQKFFTRNFNPVGAGRYDVQKWEEAQHVNGHESVFKSKSGKISLKREQF--LKERLRAKDVPFKERVFI--IPPE 399          
BLAST of Nipped-B protein vs. TrEMBL
Match: C3ZFQ3 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_124108 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 8.667e-88
Identity = 162/406 (39.90%), Postives = 234/406 (57.64%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGM------QTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV---DYSTLNLNK--NVKGVMSEREPRFMEEYK-EITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPA-CVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFI 1217
            M  K+F+GAPFG Q+ RFD+A VHPK K PGT   +       T     +GPG Y       +FSQ +++  A  PGW+R+Y T++ +++P++LN+D +  KQ QK+ LGPG Y V   D+      K  +V+G++  +E RF E  K E TPGPG YGK GIP   KEE    ++SAS +G+L +G    RTLP  G  LAP  Y   SF  E+ +    KRGPYD+F+  R KPI  GH AV     L PG Y+ KS +      +  H GKF K+ Q+P  P DR Y +  + C  P+      PG++  K      +H   PPF SS+ R DK +N FF  + N VGPGRY+++R + +++VN++ ++F SKT  Q + ++   ++ER++ K++ +  R FI
Sbjct:    1 MAKKNFTGAPFGVQTARFDVAAVHPKSKKPGTFTQVPYDKYSTTELKRKLGPGVYEVYPIIGAFSQRQVEERADGPGWERAYETQRMAALPHLLNRDHWERKQRQKKMLGPGTYEVHALDFVNALDQKPASVRGIIQTKEQRFRERVKWEETPGPGTYGKGGIPAAAKEE--KAQESASRVGLLSSGAPSSRTLPIVGTDLAPGRYERKSFTEELSDRIVSKRGPYDLFTGERNKPITVGHFAVPKTTNLGPGEYELKSFLVKWADEHNTHKGKFSKLAQHPKIPGDRIYCHTLSQCPRPE--GTPGPGTHSPKEIPTASAHH-LPPFKSSAERFDKRANKFFLGSTNPVGPGRYEVRRWERAQHVNANSSVFNSKTSRQQSLDRKKFMNERIRMKDVRVPDRVFI 401          
BLAST of Nipped-B protein vs. TrEMBL
Match: N1PB98 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226751 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.196e-84
Identity = 167/407 (41.03%), Postives = 241/407 (59.21%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGM------QTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV-DYSTLNLNK--NVKGVMSEREPRFMEEYKEI--TPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAY-WNNPACVPPDINNQLAPGSYDVKFPQNIISH-DSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKT-GAQLTKEKFSMLSERLKPKNIPINKRHFI 1217
            M  K++ GAPFG Q+ RFD++G+HPK K PGT           TS +  +GPG Y  +     FS   ++  A  PGW R+Y  ++ +++P++L+K  +  K+  K+KLGPG Y++ D+   +  K  +  G++  +E RF E+  +   TPGPG YG+ G+PH   EE    +KSASTIG+L   G  ER+LP  G  L P TY   SF  ++    +  RGPYD+FS +R KPIKTGHLA +    L PG Y  KS VD  ++ + +  G+F KM+QYP+K  DR Y ++ P    P    +  PG Y+ K    +ISH   +P F SSS R DKLS  FF  N N VGPGRY +Q+L+D+++ N H ++FKSK+   + T+ KF  L ER++ K++ +N R F+
Sbjct:    1 MADKNYKGAPFGVQTARFDVSGIHPKNKTPGTFTQTPYCKKSNTSLSCQLGPGRY--DIGLGGFSDKSVEERAGGPGWARAYEVQRLAALPHLLHKQQWELKRLLKKKLGPGSYNIKDFLEQSGEKPRSTLGIIHTKEERFKEKLTQAQETPGPGTYGEGGVPHAAVEE--KAKKSASTIGLLGASG-AERSLPTVGSGLGPGTYQFKSFTEKIDEKVTSLRGPYDLFSGDRNKPIKTGHLASVTNSNLGPGQYKIKSFVDDWSTEHKQRTGRFFKMEQYPEKAIDRIYSFSLPQN--PRNREEPGPGQYEPKMADQVISHAKKSPGFLSSSQRSDKLSTKFFTGNQNPVGPGRYVIQKLEDAQHRNGHTSVFKSKSLRPEHTRSKF--LQERIRSKDVAVNDRCFM 398          
BLAST of Nipped-B protein vs. TrEMBL
Match: K1QH27 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10010076 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 5.465e-83
Identity = 155/406 (38.18%), Postives = 233/406 (57.39%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSS------NNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV-DYSTLNLNK--NVKGVMSEREPRFMEEYKE-ITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDS--APPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGA-QLTKEKFSMLSERLKPKNIPINKRHFI 1217
            M  K ++GAPFG Q+ RFD++GVHPK K PGT   +          N  + PG Y  +     F++  +D  A  PGW R+Y  E+ +++P++L+KD +  K+  +RKL PG Y + D+  ++  K  +++GV   R+ RF E      TPGPG YGK GIPH   EE    +KS ST+GML  G +  R LP+ G  L P TYN  SF  E +   +  RGPYD+FS +R KPI  G+LA     +L PG Y+ KS VD   + +    GKF K++Q+P K  +R   +  +  P +      PG+Y+   P+ +   ++  +P F S++ R+D++S  FF +NFN VG GRYD+Q+ ++ ++ N H ++F+SKTG      EKF  L ER++ K++ +  R F+
Sbjct:    1 MAEKKYTGAPFGTQTARFDVSGVHPKSKYPGTFTEIPYDKKSIDELNRRLAPGSYKVD--VGGFNKKTVDERASGPGWARAYEVERMAALPHLLHKDQWELKRLLQRKLAPGSYDIKDFLQVSEEKPRSIRGVCQTRDQRFKENVAANETPGPGTYGKGGIPHSAVEE--KAKKSTSTVGMLDAGSSTPRNLPSVGSELGPGTYNFKSFTQEAVEKVTSLRGPYDLFSGDRNKPINDGYLAAPKLADLGPGQYELKSFVDDWKTEHRVRQGKFGKVEQHPRKGTERILCSTLSQCPKE-EGTPGPGTYE---PKQLSKPETKNSPGFLSTAQRNDRVSQRFFTRNFNPVGAGRYDVQKWEECQHKNGHGSVFQSKTGKLNAVMEKF--LKERVRAKDVQLKDRVFL 396          
BLAST of Nipped-B protein vs. Ensembl Cavefish
Match: ENSAMXT00000013749.2 (lymphocyte expansion molecule [Source:NCBI gene;Acc:103032211])

HSP 1 Score: 142.51 bits (358), Expect = 1.375e-37
Identity = 124/415 (29.88%), Postives = 187/415 (45.06%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSS------NNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNK---NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNN-PACVPPDINNQLAPGSYDVK--FPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNS-HENIFKSKTGA---QLTKEKFSMLSERLKPKNIPINKRHFIDHIPTE 1235
            M  K F GAPFG QSHRFD++GVHP  K  GT   +            N+GPG Y  +  S  FS   +   +  P WKR+  T + + +P++L +D +  KQ  K K+GPG Y +   T  L K   +++G+   RE RF ++ +  + GPGIY    I   ++   D ++K  S  G+       +R      C   P  Y      +  +  +  +     I S  R K        ++    L PG Y      + L     K HG F  ++QYP  P +R Y +  P C  P       PG YDV    P      ++  PF SS++R  K       +N N VGPGRY+   + D  + ++ H + F S T        ++K++   ERL+P+N+ +  R  +  +PTE
Sbjct:    3 MAEKKFKGAPFGSQSHRFDVSGVHPANKRVGTYTQISCCKRRTSDLERNLGPGTYNPD--SGDFSARAVRERSMGPDWKRAQETARLAQIPHLLYRDAWANKQFLKTKVGPGTYKIPSFTEELKKKPSSLRGICETREERF-KDCQNTSVGPGIY---KITSFIE---DLEKKPGSPKGICET--REQRFKDFQSCTPGPGAYGKGGIPSASLEEKERRNRGNSIDSSARLKRFPEN---IVKRTNLGPGEYTKFG--EELQRPEKKKHGVFSSLEQYPSVPTERIYLSTLPQC--PRPMTFPGPGWYDVSPVTPSRQSRSETPAPFLSSASRFSKSMETLLNKNHNMVGPGRYE---IADKNWNSTGHSSAFISDTQRYPNCPARDKYNQ--ERLRPQNVSLEGRSSL--VPTE 392          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007365.1 (pep scaffold:Pmarinus_7.0:GL476565:113022:120666:1 gene:ENSPMAG00000006647.1 transcript:ENSPMAT00000007365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.384e-36
Identity = 109/356 (30.62%), Postives = 157/356 (44.10%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGM----QTSSNN--NIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV-DYSTLNLNK--NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAY--WNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFY--QNFNQVGPGRYD 1067
            M    F GAPFG  + RF+++G+HP+ K  GT        QT SN    +GPG Y  E  S  F    +   A  PGW R     + +  P+  +++ +  ++ QK +LGPG Y   D+  L   +  + +GV    E RF+   K  TPGPG Y +   P      G       ++ G +    +  R+ P TG  L P T+   SF +E+       RGPYD+F+  RT P++TG L    +    P      S  + L +      G        P +P +R    W      P        PG+YD+      +   S PPF SSS R +  S+  F   Q+ N VGPGRY+
Sbjct:    3 MPGVEFHGAPFGSATARFNVSGIHPQLKPLGTYTEAPYCSQTMSNQIRALGPGRYNPEC-SGGFGVRAVSRRASGPGWAREVELSRSARTPHFRHREAWEKERTQKSRLGPGIYDTKDFIDLERERPSSRRGVCDTLEERFLNIGKSSTPGPGSYVRPERP------GAAWAHHPASRGPMELSSSVNRSTPETGSGLGPGTHEHRSFTDELAARVVSARGPYDLFTGRRTDPLRTGWLVAPESLWPGPRGCPQPSMAEALAARTRCRIGTVGP----PKEPAERLMEQWVKAWSWP-------GPGTYDMNLEAREVRSASRPPFLSSSARFNSRSDRLFMGSQDQNPVGPGRYN 340          
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007366.1 (pep scaffold:Pmarinus_7.0:GL476565:114349:120666:1 gene:ENSPMAG00000006647.1 transcript:ENSPMAT00000007366.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 4.512e-32
Identity = 102/340 (30.00%), Postives = 149/340 (43.82%), Query Frame = 3
Query:   87 RFDLAGVHPKRKMPGTLIGM----QTSSNN--NIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV-DYSTLNLNK--NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAY--WNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFY--QNFNQVGPGRYD 1067
            RF+++G+HP+ K  GT        QT SN    +GPG Y  E  S  F    +   A  PGW R     + +  P+  +++ +  ++ QK +LGPG Y   D+  L   +  + +GV    E RF+   K  TPGPG Y +   P      G       ++ G +    +  R+ P TG  L P T+   SF +E+       RGPYD+F+  RT P++TG L    +    P      S  + L +      G        P +P +R    W      P        PG+YD+      +   S PPF SSS R +  S+  F   Q+ N VGPGRY+
Sbjct:   29 RFNVSGIHPQLKPLGTYTEAPYCSQTMSNQIRALGPGRYNPEC-SGGFGVRAVSRRASGPGWAREVELSRSARTPHFRHREAWEKERTQKSRLGPGIYDTKDFIDLERERPSSRRGVCDTLEERFLNIGKSSTPGPGSYVRPERP------GAAWAHHPASRGPMELSSSVNRSTPETGSGLGPGTHEHRSFTDELAARVVSARGPYDLFTGRRTDPLRTGWLVAPESLWPGPRGCPQPSMAEALAARTRCRIGTVGP----PKEPAERLMEQWVKAWSWP-------GPGTYDMNLEAREVRSASRPPFLSSSARFNSRSDRLFMGSQDQNPVGPGRYN 350          
BLAST of Nipped-B protein vs. Ensembl Nematostella
Match: EDO34936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMX3])

HSP 1 Score: 265.003 bits (676), Expect = 1.993e-84
Identity = 154/406 (37.93%), Postives = 231/406 (56.90%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGM------QTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSV-DYSTLNLNK--NVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSA--PPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGA-QLTKEKFSMLSERLKPKNI-PINKRHFI 1217
            M  K +SGAPFG Q+ RFD++ +HPK K PGT   +       T  N  +GPG Y  E  +  F++  +   A  PGW+R+Y T + + +P++L K+ +  KQ QKR LGPG Y++ D+  L   K  + +G    R  RF    +   PGPG YGK GIP+ + EE   +RKS S +GML +G +  R LP  G  L P  Y + SF +E+ +H   KRGPYD+F+  R KPI  G+ A+     L PG YD KS +      + + HGKFLK+ ++PD P +R Y  + +  P D  ++  PGSY  K   ++   ++A  PPF SS+ R D+ +  FF  + N VGPGRY + R +++++++ H   F SKT    L ++K+ M  ER++ K++ P +K + +
Sbjct:    1 MAQKKYSGAPFGVQTSRFDVSSIHPKSKTPGTFTQVPYDKKCMTEVNRRLGPGSYNIE--AGGFNKKSVLERASGPGWERAYETSRLAKIPHLLYKEQWEKKQYQKRMLGPGTYNIKDFMELMAEKPRSTRGECETRAARFESSTQSGVPGPGTYGKGGIPNAVLEE--KERKSVSNVGMLDSGKSYRRQLPEVGSHLCPGQYEMESFTDEMASHVVSKRGPYDLFTGERNKPITVGYFAMPLRQNLGPGEYDLKSFLSENTGEHKQRHGKFLKVTRFPDYPTERIYCCSLSQCPRD-PSEPGPGSYSAK---DLGKPEAAKRPPFGSSAGRMDRHARRFFLGSTNPVGPGRYSVDRYENAQHIDGHTGAFNSKTRRYDLIRDKYMM--ERIRAKDVRPEDKVYMV 396          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000008990.1 (SMESG000008990.1)

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 420/420 (100.00%), Postives = 420/420 (100.00%), Query Frame = 3
Query:   39 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNKNVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESSPCVDLDKMLSHNQIPLTIS 1298
            MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNKNVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESSPCVDLDKMLSHNQIPLTIS
Sbjct:    1 MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNKNVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESSPCVDLDKMLSHNQIPLTIS 420          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000051172.1 (SMESG000051172.1)

HSP 1 Score: 222.631 bits (566), Expect = 9.298e-68
Identity = 137/399 (34.34%), Postives = 213/399 (53.38%), Query Frame = 3
Query:   54 FSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNKN--VKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNM-FFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESS 1241
             S + FG    +F   G+HPK +   +      S   N+GPG Y  + +  S S+++   +     WK  Y  E+  ++PY L K+    + E+KR+LGPGYY V+ S   L+K+     ++  +  RF ++ K+  PGP  YG   IP  + ++ D +RK A+++ +L  GGN  R        + P  YN+ S IN+V+NHQ+G+RG YD  +L+R++PIKTGH A+L +H L PG Y+  + +D  +   +   GKFL+  QYP+KPH R +W +P   P D  NQ++P SY++      I    A  F SS  R +K +   F  +N   +GPGRY+       +  NS E+ FKS        +   +L  R++P N+P  K+    H+ TE+S
Sbjct:    1 MSKSAFGSSVPKFTCYGIHPKLQSTNSF--YSKSVPPNVGPGSYNVKHQEKS-SKNRFSSEM----WKVQYKLEKQKTIPYFLIKEKKQTEAEKKRQLGPGYYEVEESMKKLSKDNHATTILQSKARRFSDDIKDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDKTNQVSPASYNLSQSLYKIGKSKA-GFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENS 388          
BLAST of Nipped-B protein vs. Planmine SMEST
Match: SMESG000035257.1 (SMESG000035257.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.389e-67
Identity = 140/399 (35.09%), Postives = 209/399 (52.38%), Query Frame = 3
Query:   87 RFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYS----VDYSTLNLNKNVKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQN------IISHDSAPPFNSSSNRHDKLSNMFFYQNFNQ-VGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESSPCV 1250
            RF   G+HP     G + G+ TS +  +GPG Y     +S F + KLD  + K  W+R+   EQ   +P+ ++K LY  K+EQKR++GPG Y      DYS    +K     +  +  RF+E  K+  PGPG YGK GIP   K E D +RK  +T+G+L  GG   R        + P  Y + S I+E + H +G R  YD  S  +  P+K GH A+L  H++ PG Y  K  +  LN   +   GKFL+  QYP KPH+R ++ +PA  PPD  NQ++  SY   +P+N      +       PFN SS R DK++   F  N     GPGRY++ +   S+++++    F +KT    ++ +  ++ ER + +N+  NK   +DH+ T  S C 
Sbjct:   17 RFIQYGIHPNAMEKGKM-GI-TSVDGELGPGKYDLS-YTSCFDEKKLDKSSFKSDWRRALFLEQQGKIPHFMSKYLYKEKEEQKRRMGPGKYEYKSIFDYSN---DKKYTTSLKSKSRRFVEAKKDSFPGPGTYGKFGIPDQKKYEADQRRKHCNTVGLLKRGGKSGRNFFNNINNIGPGIYQVKSVIDESLKHHTGLRNFYDCNSDEKLLPLKFGHRAILKPHDIGPGQYQHKEFITELNDRFHIFKGKFLQELQYPPKPHERVFYIDPANTPPDPRNQVSTHSY---YPRNPNYRKCVSFGGKTYPFNFSSLRMDKIALENFTGNRTPFTGPGRYNIDKADASRHISAATASFNAKTPQTSSEFQLKVIRERNRGRNLIRNKEDKLDHLATTKSVCF 406          
The following BLAST results are available for this feature:
BLAST of Nipped-B protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LEXM1.034e-3730.53lymphocyte expansion molecule [Source:HGNC Symbol;... [more]
LEXM3.501e-3731.02lymphocyte expansion molecule [Source:HGNC Symbol;... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nipped-B protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nipped-B protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nipped-B protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000045218.14.649e-7138.12lymphocyte expansion molecule [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lexm2.356e-3731.48lymphocyte expansion molecule [Source:MGI Symbol;A... [more]
Lexm2.356e-3731.48lymphocyte expansion molecule [Source:MGI Symbol;A... [more]
Lexm2.356e-3731.48lymphocyte expansion molecule [Source:MGI Symbol;A... [more]
back to top
BLAST of Nipped-B protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|B1H283|LEXM_RAT2.563e-3932.48Lymphocyte expansion molecule OS=Rattus norvegicus... [more]
sp|Q3ZCV2|LEXM_HUMAN4.964e-3730.53Lymphocyte expansion molecule OS=Homo sapiens OX=9... [more]
sp|A2AVQ5|LEXM_MOUSE1.648e-3631.48Lymphocyte expansion molecule OS=Mus musculus OX=1... [more]
back to top
BLAST of Nipped-B protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HJX04.225e-11846.10Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JSZ95.117e-8840.98lymphocyte expansion molecule OS=Lingula unguis OX... [more]
C3ZFQ38.667e-8839.90Uncharacterized protein OS=Branchiostoma floridae ... [more]
N1PB981.196e-8441.03Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1QH275.465e-8338.18Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000013749.21.375e-3729.88lymphocyte expansion molecule [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007365.11.384e-3630.62pep scaffold:Pmarinus_7.0:GL476565:113022:120666:1... [more]
ENSPMAT00000007366.14.512e-3230.00pep scaffold:Pmarinus_7.0:GL476565:114349:120666:1... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nipped-B protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO349361.993e-8437.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nipped-B protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nipped-B protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000008990.10.000e+0100.00SMESG000008990.1[more]
SMESG000051172.19.298e-6834.34SMESG000051172.1[more]
SMESG000035257.12.389e-6735.09SMESG000035257.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018721 ID=SMED30018721|Name=Nipped-B protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1410bp
TTTGTTTCCATGACAATTAGCTACTGTAGTTATTTTAAATGACTTCAAAA
AGCTTCTCTGGTGCTCCTTTTGGTTATCAATCACATAGATTTGATCTCGC
TGGTGTTCATCCAAAGAGAAAGATGCCAGGAACATTAATTGGTATGCAAA
CATCAAGCAATAATAACATTGGGCCAGGATATTACATTACTGAAGATAGA
TCCAGTTCTTTTAGTCAGTCGAAATTAGACCTTGATGCCAAGAAACCTGG
ATGGAAAAGAAGTTATGCAACTGAACAATTTTCATCTATGCCATATATAT
TAAATAAGGATTTATATTTAGCAAAACAAGAACAAAAAAGAAAACTTGGT
CCCGGTTATTATTCCGTTGACTATTCTACTCTCAATTTGAATAAGAATGT
AAAAGGAGTTATGTCTGAAAGGGAACCTAGATTCATGGAAGAGTATAAAG
AAATAACTCCTGGGCCTGGAATTTATGGTAAATGCGGAATACCTCATTTA
TTAAAAGAGGAAGGAGATAATCAAAGAAAATCAGCAAGCACCATAGGAAT
GCTGCATAATGGCGGAAATGGTGAACGAACATTACCAGCTACGGGATGTC
GACTGGCACCAAATACTTACAATTTACCGTCTTTTATCAATGAAGTCATT
AATCATCAAAGCGGTAAACGTGGACCCTACGATATTTTTTCATTGAATCG
AACTAAGCCTATCAAGACAGGACATTTGGCAGTCCTTCCTGCCCACGAAC
TTGCTCCCGGACATTACGATTCAAAATCCTCTGTTGATATTCTAAATAGC
AGTAACTATAAACATCATGGAAAGTTCCTTAAAATGGATCAGTATCCAGA
TAAACCCCATGATCGAGCATATTGGAACAATCCTGCTTGTGTACCACCAG
ATATCAATAATCAACTGGCTCCTGGATCATATGATGTAAAGTTTCCACAG
AACATAATTTCTCATGACTCCGCACCTCCCTTCAATAGTTCTTCTAATCG
ACACGATAAACTTTCCAATATGTTTTTCTATCAAAATTTTAATCAAGTTG
GGCCCGGGCGATATGACCTTCAACGCCTGCAAGATTCAAAATATGTTAAT
TCTCATGAGAACATTTTTAAATCAAAAACCGGAGCCCAGCTAACAAAAGA
AAAATTTTCAATGTTAAGTGAACGATTAAAACCAAAAAATATTCCAATTA
ATAAAAGGCATTTCATTGACCATATTCCAACAGAAAGTTCCCCATGTGTT
GATTTGGATAAAATGCTCAGTCATAATCAGATACCCCTGACAATATCTTA
AATGAGATCTTTTATTATTTTATCATATACTTTTTTTGGCTTGCCATTAT
TGATTGTTTTTATTTCTTTATTAGGTTTAGCTTTGAATATTTTTCAAGTT
TGAGGTGTAC
back to top

protein sequence of SMED30018721-orf-1

>SMED30018721-orf-1 ID=SMED30018721-orf-1|Name=SMED30018721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MTSKSFSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYI
TEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQK
RKLGPGYYSVDYSTLNLNKNVKGVMSEREPRFMEEYKEITPGPGIYGKCG
IPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFI
NEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVD
ILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDV
KFPQNIISHDSAPPFNSSSNRHDKLSNMFFYQNFNQVGPGRYDLQRLQDS
KYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTES
SPCVDLDKMLSHNQIPLTIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
GO:0005761mitochondrial ribosome
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0010468regulation of gene expression
GO:0008284positive regulation of cell proliferation
GO:0035740CD8-positive, alpha-beta T cell proliferation
GO:1903862positive regulation of oxidative phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033557LEXM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033557Lymphocyte expansion moleculePANTHERPTHR34914FAMILY NOT NAMEDcoord: 1..385